F433046

General Info

Members Datasets Scaffolds Average Seq Length
394 229 788 260

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0084911|Ga0501039_0084911_1168_2022
Length 284
Sequence MSVMTETPILASPHKAVDPLPTVWDPNTRVGEMLKGKRGLVIGVANADSIAYGCAVKMRAFGADIALTYLNDKAKQYVAPLAEKIDASLLLPLDVTKPGQMQAVFDRIRADWGRLDFVVHSIAFAPREDLHGRVIDCSQAGFLQAMQVSCHSFLEMARLAEPLMTQGGTLITMSYYGADKVVSNYNLMGPVKAALEASVRYAANELAPRNIRVFAVSPGPLRTRASSGIAQFDELIDMAVKRSPGHRLVDIAEVGRVVAFLAMPASSAMTGDVVYVDAGLHNMA

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
105 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
114 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
115 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
118 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
188 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
191 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
218 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
219 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
220 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
221 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
222 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
223 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
224 2643221594 Achromobacter sp. Root170 Isolate Unclassified
225 2643221621 Achromobacter sp. Root83 Isolate Unclassified
226 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
227 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
228 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
229 2941479691

Type Distribution

Type Percentage (%)
Metagenomes 95.94
Metatranscriptomes 0.76
Isolates 3.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0.51
Rhizoplane 12.18
Rhizosphere 77.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0084911 3300049575 Bacteria 2466
2 Ga0058863_10012097 3300004799 Bacteria 1750
3 Ga0058861_10049879 3300004800 Bacteria 1786
4 Ga0058862_12891056 3300004803 Bacteria 2181
5 Ga0070677_10133377 3300005333 Bacteria 1136
6 Ga0068869_100228387 3300005334 Bacteria 1478
7 Ga0070666_10003297 3300005335 Bacteria 9785
8 Ga0070666_10146013 3300005335 Bacteria 1649
9 Ga0068868_100141245 3300005338 Bacteria 1977
10 Ga0070689_100016742 3300005340 Bacteria 5370
11 Ga0070691_10006267 3300005341 Bacteria 5434
12 Ga0070687_100089234 3300005343 Bacteria 1701
13 Ga0070692_10004989 3300005345 Bacteria 5604
14 Ga0070668_100066984 3300005347 Bacteria 2788
15 Ga0070669_100015499 3300005353 Bacteria 5433
16 Ga0070669_100137989 3300005353 Bacteria 1877
17 Ga0070675_100391833 3300005354 Bacteria 1238
18 Ga0070671_100018147 3300005355 Bacteria 5713
19 Ga0070671_100021172 3300005355 Bacteria 5309
20 Ga0070671_100028429 3300005355 Bacteria 4604
21 Ga0070674_100490556 3300005356 Bacteria 1021
22 Ga0070659_100139257 3300005366 Bacteria 1975
23 Ga0070667_100029687 3300005367 Bacteria 4558
24 Ga0070667_100725048 3300005367 Bacteria 921
25 Ga0070667_100725844 3300005367 Bacteria 920
26 Ga0070700_100002254 3300005441 Bacteria 9820
27 Ga0070694_100036826 3300005444 Bacteria 3243
28 Ga0070694_100038678 3300005444 Bacteria 3171
29 Ga0070678_100622719 3300005456 Bacteria 965
30 Ga0068867_100001299 3300005459 Bacteria 17252
31 Ga0068867_100358594 3300005459 Bacteria 1219
32 Ga0068867_100363496 3300005459 Bacteria 1211
33 Ga0070672_100002941 3300005543 Bacteria 10965
34 Ga0070686_100088549 3300005544 Bacteria 2066
35 Ga0070695_100000633 3300005545 Bacteria 18646
36 Ga0070664_100064312 3300005564 Bacteria 3129
37 Ga0068859_100033293 3300005617 Bacteria 5176
38 Ga0068859_100446460 3300005617 Bacteria 1390
39 Ga0068864_100102883 3300005618 Bacteria 2535
40 Ga0068861_100016152 3300005719 Bacteria 5275
41 Ga0068861_100357625 3300005719 Bacteria 1283
42 Ga0068863_100013452 3300005841 Bacteria 7891
43 Ga0068858_100086726 3300005842 Bacteria 2912
44 Ga0068858_100091085 3300005842 Bacteria 2838
45 Ga0068862_100010404 3300005844 Bacteria 7680
46 Ga0068862_100352378 3300005844 Bacteria 1366
47 Ga0081455_10034663 3300005937 Bacteria 4519
48 Ga0070715_10014962 3300006163 Bacteria 2885
49 Ga0075367_10103785 3300006178 Bacteria 1740
50 Ga0097621_100013044 3300006237 Bacteria 6178
51 Ga0097621_100153518 3300006237 Bacteria 1975
52 Ga0068871_100014907 3300006358 Bacteria 5809
53 Ga0068871_100075801 3300006358 Bacteria 2777
54 Ga0068871_100595992 3300006358 Bacteria 1005
55 Ga0075428_100045576 3300006844 Bacteria 4818
56 Ga0075430_100031480 3300006846 Bacteria 4502
57 Ga0075430_100038149 3300006846 Bacteria 4071
58 Ga0075430_100057116 3300006846 Bacteria 3283
59 Ga0075433_10000981 3300006852 Bacteria 20288
60 Ga0075434_100001241 3300006871 Bacteria 21209
61 Ga0075434_100108896 3300006871 Bacteria 2780
62 Ga0075429_100052101 3300006880 Bacteria 3560
63 Ga0068865_100009875 3300006881 Bacteria 5929
64 Ga0097620_100033293 3300006931 Bacteria 5176
65 Ga0097620_100446437 3300006931 Bacteria 1390
66 Ga0099826_10000028 3300006948 Bacteria 129794
67 Ga0075435_100143753 3300007076 Bacteria 2003
68 Ga0075435_100166796 3300007076 Bacteria 1857
69 Ga0105251_10094188 3300009011 Bacteria 1373
70 Ga0111539_10037016 3300009094 Bacteria 5896
71 Ga0111539_10072834 3300009094 Bacteria 4051
72 Ga0111539_10463275 3300009094 Bacteria 1476
73 Ga0111539_10483172 3300009094 Bacteria 1443
74 Ga0105245_10131395 3300009098 Bacteria 2349
75 Ga0105247_10167832 3300009101 Bacteria 1457
76 Ga0114129_10216719 3300009147 Bacteria 2585
77 Ga0114129_10470836 3300009147 Bacteria 1645
78 Ga0105242_10199005 3300009176 Bacteria 1778
79 Ga0105248_10017754 3300009177 Bacteria 7849
80 Ga0105248_10027863 3300009177 Bacteria 6289
81 Ga0105248_10414792 3300009177 Bacteria 1516
82 Ga0105248_11135414 3300009177 Bacteria 883
83 Ga0105238_10633544 3300009551 Bacteria 1078
84 Ga0105249_10014155 3300009553 Bacteria 7051
85 Ga0105249_10255612 3300009553 Bacteria 1739
86 Ga0105246_10113164 3300011119 Bacteria 1998
87 Ga0105246_10458375 3300011119 Bacteria 1073
88 Ga0157374_10145614 3300013296 Bacteria 2301
89 Ga0157374_10228547 3300013296 Bacteria 1827
90 Ga0157378_10019575 3300013297 Bacteria 5950
91 Ga0157378_10294438 3300013297 Bacteria 1569
92 Ga0163162_10011425 3300013306 Bacteria 8658
93 Ga0163162_10016912 3300013306 Bacteria 7132
94 Ga0163162_10053707 3300013306 Bacteria 4050
95 Ga0163162_10103481 3300013306 Bacteria 2942
96 Ga0163162_10173784 3300013306 Bacteria 2279
97 Ga0163162_10221997 3300013306 Bacteria 2019
98 Ga0163162_10456774 3300013306 Bacteria 1409
99 Ga0157375_10007360 3300013308 Bacteria 9638
100 Ga0157375_10119790 3300013308 Bacteria 2740
101 Ga0157375_10385164 3300013308 Bacteria 1569
102 Ga0163163_10069759 3300014325 Bacteria 3499
103 Ga0163163_10120025 3300014325 Bacteria 2662
104 Ga0163163_10167539 3300014325 Bacteria 2243
105 Ga0157380_10022720 3300014326 Bacteria 4728
106 Ga0157380_10051902 3300014326 Bacteria 3245
107 Ga0157380_10458417 3300014326 Bacteria 1226
108 Ga0157380_10712150 3300014326 Bacteria 1010
109 Ga0157379_10194564 3300014968 Bacteria 1833
110 Ga0157379_10455478 3300014968 Bacteria 1182
111 Ga0157376_10001351 3300014969 Bacteria 16163
112 Ga0157376_10539160 3300014969 Bacteria 1153
113 Ga0163161_10020029 3300017792 Bacteria 4693
114 Ga0163161_10107246 3300017792 Bacteria 2085
115 Ga0163161_10263717 3300017792 Bacteria 1346
116 Ga0213872_10000807 3300021361 Bacteria 22716
117 Ga0213872_10001945 3300021361 Bacteria 12615
118 Ga0213872_10018536 3300021361 Bacteria 3210
119 Ga0213872_10023197 3300021361 Bacteria 2855
120 Ga0213872_10038439 3300021361 Bacteria 2184
121 Ga0213872_10039934 3300021361 Bacteria 2142
122 Ga0209051_1010958 3300025303 Bacteria 4524
123 Ga0209051_1026212 3300025303 Bacteria 2355
124 Ga0207688_10037451 3300025901 Bacteria 2690
125 Ga0207680_10048496 3300025903 Bacteria 2523
126 Ga0207680_10070510 3300025903 Bacteria 2164
127 Ga0207699_10264950 3300025906 Bacteria 1189
128 Ga0207663_10097521 3300025916 Bacteria 1966
129 Ga0207681_10027134 3300025923 Bacteria 3700
130 Ga0207681_10187727 3300025923 Bacteria 1579
131 Ga0207650_10062493 3300025925 Bacteria 2782
132 Ga0207659_10068366 3300025926 Bacteria 2583
133 Ga0207644_10000652 3300025931 Bacteria 21952
134 Ga0207644_10048636 3300025931 Bacteria 3033
135 Ga0207644_10386474 3300025931 Bacteria 1142
136 Ga0207670_10355136 3300025936 Bacteria 1162
137 Ga0207704_10007280 3300025938 Bacteria 5217
138 Ga0207691_10018251 3300025940 Bacteria 6646
139 Ga0207691_10178513 3300025940 Bacteria 1856
140 Ga0207711_10009303 3300025941 Bacteria 8203
141 Ga0207711_10012804 3300025941 Bacteria 6967
142 Ga0207711_10108521 3300025941 Bacteria 2466
143 Ga0207711_10316535 3300025941 Bacteria 1441
144 Ga0207711_10494550 3300025941 Bacteria 1140
145 Ga0207651_10172585 3300025960 Bacteria 1707
146 Ga0207651_10485421 3300025960 Bacteria 1066
147 Ga0207712_10007161 3300025961 Bacteria 7037
148 Ga0207668_10075037 3300025972 Bacteria 2430
149 Ga0207677_10211462 3300026023 Bacteria 1549
150 Ga0207703_10417762 3300026035 Bacteria 1247
151 Ga0207703_10430964 3300026035 Bacteria 1229
152 Ga0207678_10318388 3300026067 Bacteria 1338
153 Ga0207708_10014358 3300026075 Bacteria 5926
154 Ga0207708_10029858 3300026075 Bacteria 4133
155 Ga0207641_10075759 3300026088 Bacteria 2906
156 Ga0207648_10002082 3300026089 Bacteria 21786
157 Ga0207676_10005392 3300026095 Bacteria 9052
158 Ga0207676_10070612 3300026095 Bacteria 2801
159 Ga0207675_100008178 3300026118 Bacteria 9859
160 Ga0207675_100028976 3300026118 Bacteria 5158
161 Ga0207675_100495261 3300026118 Bacteria 1216
162 Ga0207683_10016635 3300026121 Bacteria 6259
163 Ga0207683_10457951 3300026121 Bacteria 1176
164 Ga0209282_1000115 3300027666 Bacteria 51607
165 Ga0207428_10031929 3300027907 Bacteria 4337
166 Ga0268266_10142507 3300028379 Bacteria 2152
167 Ga0268265_10008248 3300028380 Bacteria 7037
168 Ga0268265_10287162 3300028380 Bacteria 1475
169 Ga0265338_10011300 3300028800 Bacteria 10333
170 Ga0265331_10023761 3300031250 Bacteria 3109
171 Ga0265327_10002210 3300031251 Bacteria 21270
172 Ga0265327_10058289 3300031251 Bacteria 1982
173 Ga0265327_10065387 3300031251 Bacteria 1839
174 Ga0265316_10082640 3300031344 Bacteria 2461
175 Ga0307406_10315502 3300031901 Bacteria 1207
176 Ga0307412_10003055 3300031911 Bacteria 9277
177 Ga0307416_100398661 3300032002 Bacteria 1413
178 Ga0373938_0033786 3300034957 Bacteria 1108
179 Ga0373928_0053084 3300035084 Bacteria 962
180 Ga0373960_0011601 3300035121 Bacteria 2173
181 Ga0373961_0012566 3300035241 Bacteria 2122
182 Ga0373962_0011054 3300035242 Bacteria 2257
183 Ga0373962_0122863 3300035242 Bacteria 829
184 Ga0373931_0011387 3300035691 Bacteria 4297
185 Ga0373931_0034212 3300035691 Bacteria 2636
186 Ga0373931_0101080 3300035691 Bacteria 1622
187 Ga0373931_0155226 3300035691 Bacteria 1337
188 Ga0373937_0009306 3300036401 Bacteria 8530
189 Ga0373937_0317305 3300036401 Bacteria 1474
190 Ga0373925_0677330 3300037068 Bacteria 850
191 Ga0395898_0430255 3300037466 Bacteria 1258
192 Ga0400485_00692 3300038735 Bacteria 2252
193 Ga0400487_61161 3300039110 Bacteria 1972
194 Ga0436360_0678191 3300039438 Bacteria 1095
195 Ga0436361_0066216 3300039447 Bacteria 14338
196 Ga0436361_0105560 3300039447 Bacteria 44727
197 Ga0436361_0232942 3300039447 Bacteria 2527
198 Ga0436361_0259084 3300039447 Bacteria 9561
199 Ga0436361_0424881 3300039447 Bacteria 19319
200 Ga0436361_0460003 3300039447 Bacteria 2384
201 Ga0436361_0711735 3300039447 Bacteria 3740
202 Ga0436361_0778940 3300039447 Bacteria 2912
203 Ga0439444_0000851 3300042437 Bacteria 3702
204 Ga0439460_0001707 3300042461 Bacteria 5203
205 Ga0453684_0414133 3300044712 Bacteria 1507
206 Ga0451576_0000262 3300045051 Bacteria 128472
207 Ga0495603_0032761 3300046455 Bacteria 3126
208 Ga0495603_0202000 3300046455 Bacteria 1149
209 Ga0495629_0066587 3300046459 Bacteria 2514
210 Ga0495653_0000978 3300046463 Bacteria 21974
211 Ga0495653_0007080 3300046463 Bacteria 9199
212 Ga0495653_0392264 3300046463 Bacteria 884
213 Ga0495580_0229494 3300046472 Bacteria 1275
214 Ga0495580_0319903 3300046472 Bacteria 1054
215 Ga0495582_0003181 3300046473 Bacteria 9226
216 Ga0495605_0001930 3300046474 Bacteria 13188
217 Ga0495639_0022196 3300046475 Bacteria 2783
218 Ga0495584_0046298 3300046491 Bacteria 2194
219 Ga0495584_0064261 3300046491 Bacteria 1845
220 Ga0495585_0000410 3300046492 Bacteria 41579
221 Ga0495594_0003633 3300046499 Bacteria 7932
222 Ga0495596_0000123 3300046500 Bacteria 53547
223 Ga0495607_0034604 3300046501 Bacteria 3063
224 Ga0495608_0400277 3300046511 Bacteria 840
225 Ga0495610_0001888 3300046512 Bacteria 18100
226 Ga0495616_0000597 3300046513 Bacteria 27242
227 Ga0495630_0014901 3300046517 Bacteria 5670
228 Ga0495630_0350600 3300046517 Bacteria 1130
229 Ga0495648_0028194 3300046524 Bacteria 3744
230 Ga0495666_0003566 3300046526 Bacteria 7869
231 Ga0495652_0015103 3300046529 Bacteria 6917
232 Ga0495652_0051153 3300046529 Bacteria 3530
233 Ga0495652_0445816 3300046529 Bacteria 907
234 Ga0495665_0007475 3300046531 Bacteria 5911
235 Ga0495665_0028585 3300046531 Bacteria 2988
236 Ga0495586_0009554 3300046535 Bacteria 5166
237 Ga0495609_0005119 3300046538 Bacteria 6984
238 Ga0495621_0014128 3300046539 Bacteria 2522
239 Ga0495597_0008921 3300046542 Bacteria 5002
240 Ga0495622_0001203 3300046557 Bacteria 13333
241 Ga0495633_0091180 3300046558 Bacteria 1417
242 Ga0495667_0050828 3300046559 Bacteria 2736
243 Ga0495634_0106267 3300046642 Bacteria 1809
244 Ga0495625_0006300 3300046660 Bacteria 10610
245 Ga0495661_0007327 3300046665 Bacteria 7689
246 Ga0495661_0038759 3300046665 Bacteria 2965
247 Ga0495588_0002703 3300046674 Bacteria 7595
248 Ga0495588_0007136 3300046674 Bacteria 5067
249 Ga0495588_0054222 3300046674 Bacteria 2068
250 Ga0495623_0016293 3300046679 Bacteria 4801
251 Ga0495613_0092439 3300046689 Bacteria 2191
252 Ga0495613_0375976 3300046689 Bacteria 972
253 Ga0495624_0001290 3300046690 Bacteria 19765
254 Ga0495624_0196649 3300046690 Bacteria 1225
255 Ga0495670_0012853 3300046691 Bacteria 4116
256 Ga0495671_0002126 3300046692 Bacteria 12663
257 Ga0495671_0199825 3300046692 Bacteria 970
258 Ga0495649_0013183 3300046694 Bacteria 4775
259 Ga0495600_0006165 3300046809 Bacteria 7270
260 Ga0495600_0077175 3300046809 Bacteria 2175
261 Ga0495600_0180334 3300046809 Bacteria 1361
262 Ga0495581_0000164 3300047315 Bacteria 29843
263 Ga0495581_0021943 3300047315 Bacteria 3700
264 Ga0495604_0005167 3300047317 Bacteria 10337
265 Ga0495672_0021116 3300047320 Bacteria 4251
266 Ga0495676_0009654 3300047321 Bacteria 8779
267 Ga0495676_0121056 3300047321 Bacteria 1904
268 Ga0495680_0108154 3300047322 Bacteria 2064
269 Ga0495687_014045 3300047443 Bacteria 4143
270 Ga0495675_0003820 3300047444 Bacteria 9124
271 Ga0495675_0095702 3300047444 Bacteria 1861
272 Ga0495593_0015203 3300047673 Bacteria 4366
273 Ga0495602_0113469 3300048088 Bacteria 2196
274 Ga0495626_0100322 3300048091 Bacteria 1263
275 Ga0496100_0001790 3300048903 Bacteria 10716
276 Ga0496101_0000352 3300048904 Bacteria 31023
277 Ga0496101_0117935 3300048904 Bacteria 2004
278 Ga0496101_0269467 3300048904 Bacteria 1329
279 Ga0496102_0006273 3300048905 Bacteria 10134
280 Ga0496102_0046350 3300048905 Bacteria 3948
281 Ga0496102_0108821 3300048905 Bacteria 2582
282 Ga0496103_0069591 3300048906 Bacteria 2200
283 Ga0496104_0000777 3300048907 Bacteria 27303
284 Ga0496104_0006963 3300048907 Bacteria 9970
285 Ga0496105_0002877 3300048908 Bacteria 12609
286 Ga0496105_0048222 3300048908 Bacteria 3516
287 Ga0496105_0111434 3300048908 Bacteria 2258
288 Ga0496106_0129359 3300048909 Bacteria 1979
289 Ga0496106_0187029 3300048909 Bacteria 1646
290 Ga0496107_0027745 3300048910 Bacteria 4022
291 Ga0496107_0091323 3300048910 Bacteria 2225
292 Ga0496107_0121473 3300048910 Bacteria 1925
293 Ga0496107_0526896 3300048910 Bacteria 876
294 Ga0496108_0061414 3300048911 Bacteria 3162
295 Ga0496108_0143297 3300048911 Bacteria 2059
296 Ga0496108_0192362 3300048911 Bacteria 1768
297 Ga0496108_0290675 3300048911 Bacteria 1423
298 Ga0496108_0437169 3300048911 Bacteria 1143
299 Ga0496109_0044775 3300048912 Bacteria 4015
300 Ga0496109_0060351 3300048912 Bacteria 3465
301 Ga0496109_0088225 3300048912 Bacteria 2866
302 Ga0496109_0177650 3300048912 Bacteria 1999
303 Ga0496109_0230851 3300048912 Bacteria 1741
304 Ga0496109_0440010 3300048912 Bacteria 1232
305 Ga0496109_0767243 3300048912 Bacteria 902
306 Ga0496110_0010089 3300048913 Bacteria 7669
307 Ga0496110_0033730 3300048913 Bacteria 4430
308 Ga0496110_0047559 3300048913 Bacteria 3758
309 Ga0496110_0170143 3300048913 Bacteria 1976
310 Ga0496111_0074807 3300048914 Bacteria 2467
311 Ga0496111_0262129 3300048914 Bacteria 1282
312 Ga0496111_0361968 3300048914 Bacteria 1073
313 Ga0496111_0418639 3300048914 Bacteria 990
314 Ga0496112_0029227 3300048915 Bacteria 5329
315 Ga0496112_0063768 3300048915 Bacteria 3635
316 Ga0496112_0064105 3300048915 Bacteria 3625
317 Ga0496112_0130354 3300048915 Bacteria 2485
318 Ga0496112_0217634 3300048915 Bacteria 1866
319 Ga0496113_0041567 3300048916 Bacteria 3393
320 Ga0496113_0118539 3300048916 Bacteria 2067
321 Ga0496114_0063215 3300048917 Bacteria 3099
322 Ga0496114_0175752 3300048917 Bacteria 1868
323 Ga0496116_0004838 3300048919 Bacteria 12703
324 Ga0496116_0014319 3300048919 Bacteria 6340
325 Ga0496117_0000108 3300048920 Bacteria 185583
326 Ga0496117_0060014 3300048920 Bacteria 2624
327 Ga0496117_0100006 3300048920 Bacteria 1838
328 Ga0496118_0026133 3300048921 Bacteria 4983
329 Ga0496119_0014425 3300048922 Bacteria 6186
330 Ga0496120_0001965 3300048923 Bacteria 22470
331 Ga0496121_0000164 3300048924 Bacteria 145421
332 Ga0496121_0007286 3300048924 Bacteria 13384
333 Ga0496122_0000227 3300048925 Bacteria 125743
334 Ga0496122_0011893 3300048925 Bacteria 8743
335 Ga0496122_0015884 3300048925 Bacteria 7168
336 Ga0496123_0001764 3300048926 Bacteria 28549
337 Ga0496123_0002172 3300048926 Bacteria 25044
338 Ga0496123_0036833 3300048926 Bacteria 3461
339 Ga0496124_0037320 3300048927 Bacteria 4227
340 Ga0496124_0133127 3300048927 Bacteria 1972
341 Ga0496125_0000241 3300048928 Bacteria 112044
342 Ga0496125_0017963 3300048928 Bacteria 6724
343 Ga0496125_0029414 3300048928 Bacteria 4936
344 Ga0496126_0022286 3300048929 Bacteria 6167
345 Ga0496126_0077661 3300048929 Bacteria 2943
346 Ga0495682_0052337 3300049460 Bacteria 1484
347 Ga0501036_0361882 3300049572 Bacteria 1211
348 Ga0501039_0181766 3300049575 Bacteria 1654
349 Ga0501040_0063825 3300049576 Bacteria 2535
350 Ga0501043_0038816 3300049579 Bacteria 3744
351 Ga0501071_0004126 3300049587 Bacteria 9182
352 Ga0501071_0318586 3300049587 Bacteria 1181
353 Ga0501072_0027691 3300049588 Bacteria 4421
354 Ga0501072_0136328 3300049588 Bacteria 1957
355 Ga0501075_0112022 3300049591 Bacteria 2075
356 Ga0501075_0212570 3300049591 Bacteria 1475
357 Ga0501076_0303436 3300049592 Bacteria 1309
358 Ga0501080_0331149 3300049742 Bacteria 1377
359 Ga0501081_0140435 3300049743 Bacteria 1731
360 Ga0501045_0069103 3300049824 Bacteria 2596
361 Ga0501045_0237953 3300049824 Bacteria 1355
362 nmdc:mga06z11_238563_c1 3300050494 Bacteria 1067
363 nmdc:mga09592_82951_c1 3300050508 Bacteria 2732
364 nmdc:mga0qj67_143197_c1 3300050509 Bacteria 1938
365 nmdc:mga0qj67_27059_c1 3300050509 Bacteria 4442
366 nmdc:mga06r32_1846_c1 3300050510 Bacteria 18882
367 nmdc:mga08y16_141218_c1 3300050511 Bacteria 2504
368 nmdc:mga08y16_150705_c1 3300050511 Bacteria 2417
369 nmdc:mga08y16_293377_c1 3300050511 Bacteria 1676
370 nmdc:mga0n895_16039_c1 3300050512 Bacteria 6862
371 nmdc:mga0n895_20717_c1 3300050512 Bacteria 6138
372 nmdc:mga0n895_276146_c1 3300050512 Bacteria 1704
373 nmdc:mga0rr50_81587_c1 3300050513 Bacteria 2496
374 nmdc:mga0a205_2472_c1 3300050515 Bacteria 16291
375 nmdc:mga0a205_256762_c1 3300050515 Bacteria 1626
376 Ga0500616_0028939 3300053153 Bacteria 3051
377 Ga0590074_020063 3300059423 Bacteria 1149
378 Ga0501082_0006872 3300060353 Bacteria 9841
379 Ga0501082_0349805 3300060353 Bacteria 1288
380 Ga0530510_0024219 3300061734 Bacteria 4330
381 Ga0530510_0048246 3300061734 Bacteria 3078
382 2501069977 2501025501 Bacteria 7768574
383 2501080474 2501025502 Bacteria 9641094
384 2501407726 2501025504 Bacteria 8008976
385 2511089791 2510917013 Bacteria 9951648
386 2511092609 2510917013 Bacteria 9951648
387 2511097603 2510917014 Bacteria 8296963
388 2511105448 2510917015 Bacteria 7950052
389 2643982610 2643221594 Bacteria 5811388
390 2644121881 2643221621 Bacteria 6212786
391 2809034718 2808606395 Bacteria 6020352
392 2883095816 2883087390 Bacteria 9532701
393 2894772859 2894772417 Bacteria 5305674
394 2941480459
395 Ga0501039_0084911
396 Ga0058863_10012097
397 Ga0058861_10049879
398 Ga0058862_12891056
399 Ga0070677_10133377
400 Ga0068869_100228387
401 Ga0070666_10003297
402 Ga0070666_10146013
403 Ga0068868_100141245
404 Ga0070689_100016742
405 Ga0070691_10006267
406 Ga0070687_100089234
407 Ga0070692_10004989
408 Ga0070668_100066984
409 Ga0070669_100015499
410 Ga0070669_100137989
411 Ga0070675_100391833
412 Ga0070671_100018147
413 Ga0070671_100021172
414 Ga0070671_100028429
415 Ga0070674_100490556
416 Ga0070659_100139257
417 Ga0070667_100029687
418 Ga0070667_100725048
419 Ga0070667_100725844
420 Ga0070700_100002254
421 Ga0070694_100036826
422 Ga0070694_100038678
423 Ga0070678_100622719
424 Ga0068867_100001299
425 Ga0068867_100358594
426 Ga0068867_100363496
427 Ga0070672_100002941
428 Ga0070686_100088549
429 Ga0070695_100000633
430 Ga0070664_100064312
431 Ga0068859_100033293
432 Ga0068859_100446460
433 Ga0068864_100102883
434 Ga0068861_100016152
435 Ga0068861_100357625
436 Ga0068863_100013452
437 Ga0068858_100086726
438 Ga0068858_100091085
439 Ga0068862_100010404
440 Ga0068862_100352378
441 Ga0081455_10034663
442 Ga0070715_10014962
443 Ga0075367_10103785
444 Ga0097621_100013044
445 Ga0097621_100153518
446 Ga0068871_100014907
447 Ga0068871_100075801
448 Ga0068871_100595992
449 Ga0075428_100045576
450 Ga0075430_100031480
451 Ga0075430_100038149
452 Ga0075430_100057116
453 Ga0075433_10000981
454 Ga0075434_100001241
455 Ga0075434_100108896
456 Ga0075429_100052101
457 Ga0068865_100009875
458 Ga0097620_100033293
459 Ga0097620_100446437
460 Ga0099826_10000028
461 Ga0075435_100143753
462 Ga0075435_100166796
463 Ga0105251_10094188
464 Ga0111539_10037016
465 Ga0111539_10072834
466 Ga0111539_10463275
467 Ga0111539_10483172
468 Ga0105245_10131395
469 Ga0105247_10167832
470 Ga0114129_10216719
471 Ga0114129_10470836
472 Ga0105242_10199005
473 Ga0105248_10017754
474 Ga0105248_10027863
475 Ga0105248_10414792
476 Ga0105248_11135414
477 Ga0105238_10633544
478 Ga0105249_10014155
479 Ga0105249_10255612
480 Ga0105246_10113164
481 Ga0105246_10458375
482 Ga0157374_10145614
483 Ga0157374_10228547
484 Ga0157378_10019575
485 Ga0157378_10294438
486 Ga0163162_10011425
487 Ga0163162_10016912
488 Ga0163162_10053707
489 Ga0163162_10103481
490 Ga0163162_10173784
491 Ga0163162_10221997
492 Ga0163162_10456774
493 Ga0157375_10007360
494 Ga0157375_10119790
495 Ga0157375_10385164
496 Ga0163163_10069759
497 Ga0163163_10120025
498 Ga0163163_10167539
499 Ga0157380_10022720
500 Ga0157380_10051902
501 Ga0157380_10458417
502 Ga0157380_10712150
503 Ga0157379_10194564
504 Ga0157379_10455478
505 Ga0157376_10001351
506 Ga0157376_10539160
507 Ga0163161_10020029
508 Ga0163161_10107246
509 Ga0163161_10263717
510 Ga0213872_10000807
511 Ga0213872_10001945
512 Ga0213872_10018536
513 Ga0213872_10023197
514 Ga0213872_10038439
515 Ga0213872_10039934
516 Ga0209051_1010958
517 Ga0209051_1026212
518 Ga0207688_10037451
519 Ga0207680_10048496
520 Ga0207680_10070510
521 Ga0207699_10264950
522 Ga0207663_10097521
523 Ga0207681_10027134
524 Ga0207681_10187727
525 Ga0207650_10062493
526 Ga0207659_10068366
527 Ga0207644_10000652
528 Ga0207644_10048636
529 Ga0207644_10386474
530 Ga0207670_10355136
531 Ga0207704_10007280
532 Ga0207691_10018251
533 Ga0207691_10178513
534 Ga0207711_10009303
535 Ga0207711_10012804
536 Ga0207711_10108521
537 Ga0207711_10316535
538 Ga0207711_10494550
539 Ga0207651_10172585
540 Ga0207651_10485421
541 Ga0207712_10007161
542 Ga0207668_10075037
543 Ga0207677_10211462
544 Ga0207703_10417762
545 Ga0207703_10430964
546 Ga0207678_10318388
547 Ga0207708_10014358
548 Ga0207708_10029858
549 Ga0207641_10075759
550 Ga0207648_10002082
551 Ga0207676_10005392
552 Ga0207676_10070612
553 Ga0207675_100008178
554 Ga0207675_100028976
555 Ga0207675_100495261
556 Ga0207683_10016635
557 Ga0207683_10457951
558 Ga0209282_1000115
559 Ga0207428_10031929
560 Ga0268266_10142507
561 Ga0268265_10008248
562 Ga0268265_10287162
563 Ga0265338_10011300
564 Ga0265331_10023761
565 Ga0265327_10002210
566 Ga0265327_10058289
567 Ga0265327_10065387
568 Ga0265316_10082640
569 Ga0307406_10315502
570 Ga0307412_10003055
571 Ga0307416_100398661
572 Ga0373938_0033786
573 Ga0373928_0053084
574 Ga0373960_0011601
575 Ga0373961_0012566
576 Ga0373962_0011054
577 Ga0373962_0122863
578 Ga0373931_0011387
579 Ga0373931_0034212
580 Ga0373931_0101080
581 Ga0373931_0155226
582 Ga0373937_0009306
583 Ga0373937_0317305
584 Ga0373925_0677330
585 Ga0395898_0430255
586 Ga0400485_00692
587 Ga0400487_61161
588 Ga0436360_0678191
589 Ga0436361_0066216
590 Ga0436361_0105560
591 Ga0436361_0232942
592 Ga0436361_0259084
593 Ga0436361_0424881
594 Ga0436361_0460003
595 Ga0436361_0711735
596 Ga0436361_0778940
597 Ga0439444_0000851
598 Ga0439460_0001707
599 Ga0453684_0414133
600 Ga0451576_0000262
601 Ga0495603_0032761
602 Ga0495603_0202000
603 Ga0495629_0066587
604 Ga0495653_0000978
605 Ga0495653_0007080
606 Ga0495653_0392264
607 Ga0495580_0229494
608 Ga0495580_0319903
609 Ga0495582_0003181
610 Ga0495605_0001930
611 Ga0495639_0022196
612 Ga0495584_0046298
613 Ga0495584_0064261
614 Ga0495585_0000410
615 Ga0495594_0003633
616 Ga0495596_0000123
617 Ga0495607_0034604
618 Ga0495608_0400277
619 Ga0495610_0001888
620 Ga0495616_0000597
621 Ga0495630_0014901
622 Ga0495630_0350600
623 Ga0495648_0028194
624 Ga0495666_0003566
625 Ga0495652_0015103
626 Ga0495652_0051153
627 Ga0495652_0445816
628 Ga0495665_0007475
629 Ga0495665_0028585
630 Ga0495586_0009554
631 Ga0495609_0005119
632 Ga0495621_0014128
633 Ga0495597_0008921
634 Ga0495622_0001203
635 Ga0495633_0091180
636 Ga0495667_0050828
637 Ga0495634_0106267
638 Ga0495625_0006300
639 Ga0495661_0007327
640 Ga0495661_0038759
641 Ga0495588_0002703
642 Ga0495588_0007136
643 Ga0495588_0054222
644 Ga0495623_0016293
645 Ga0495613_0092439
646 Ga0495613_0375976
647 Ga0495624_0001290
648 Ga0495624_0196649
649 Ga0495670_0012853
650 Ga0495671_0002126
651 Ga0495671_0199825
652 Ga0495649_0013183
653 Ga0495600_0006165
654 Ga0495600_0077175
655 Ga0495600_0180334
656 Ga0495581_0000164
657 Ga0495581_0021943
658 Ga0495604_0005167
659 Ga0495672_0021116
660 Ga0495676_0009654
661 Ga0495676_0121056
662 Ga0495680_0108154
663 Ga0495687_014045
664 Ga0495675_0003820
665 Ga0495675_0095702
666 Ga0495593_0015203
667 Ga0495602_0113469
668 Ga0495626_0100322
669 Ga0496100_0001790
670 Ga0496101_0000352
671 Ga0496101_0117935
672 Ga0496101_0269467
673 Ga0496102_0006273
674 Ga0496102_0046350
675 Ga0496102_0108821
676 Ga0496103_0069591
677 Ga0496104_0000777
678 Ga0496104_0006963
679 Ga0496105_0002877
680 Ga0496105_0048222
681 Ga0496105_0111434
682 Ga0496106_0129359
683 Ga0496106_0187029
684 Ga0496107_0027745
685 Ga0496107_0091323
686 Ga0496107_0121473
687 Ga0496107_0526896
688 Ga0496108_0061414
689 Ga0496108_0143297
690 Ga0496108_0192362
691 Ga0496108_0290675
692 Ga0496108_0437169
693 Ga0496109_0044775
694 Ga0496109_0060351
695 Ga0496109_0088225
696 Ga0496109_0177650
697 Ga0496109_0230851
698 Ga0496109_0440010
699 Ga0496109_0767243
700 Ga0496110_0010089
701 Ga0496110_0033730
702 Ga0496110_0047559
703 Ga0496110_0170143
704 Ga0496111_0074807
705 Ga0496111_0262129
706 Ga0496111_0361968
707 Ga0496111_0418639
708 Ga0496112_0029227
709 Ga0496112_0063768
710 Ga0496112_0064105
711 Ga0496112_0130354
712 Ga0496112_0217634
713 Ga0496113_0041567
714 Ga0496113_0118539
715 Ga0496114_0063215
716 Ga0496114_0175752
717 Ga0496116_0004838
718 Ga0496116_0014319
719 Ga0496117_0000108
720 Ga0496117_0060014
721 Ga0496117_0100006
722 Ga0496118_0026133
723 Ga0496119_0014425
724 Ga0496120_0001965
725 Ga0496121_0000164
726 Ga0496121_0007286
727 Ga0496122_0000227
728 Ga0496122_0011893
729 Ga0496122_0015884
730 Ga0496123_0001764
731 Ga0496123_0002172
732 Ga0496123_0036833
733 Ga0496124_0037320
734 Ga0496124_0133127
735 Ga0496125_0000241
736 Ga0496125_0017963
737 Ga0496125_0029414
738 Ga0496126_0022286
739 Ga0496126_0077661
740 Ga0495682_0052337
741 Ga0501036_0361882
742 Ga0501039_0181766
743 Ga0501040_0063825
744 Ga0501043_0038816
745 Ga0501071_0004126
746 Ga0501071_0318586
747 Ga0501072_0027691
748 Ga0501072_0136328
749 Ga0501075_0112022
750 Ga0501075_0212570
751 Ga0501076_0303436
752 Ga0501080_0331149
753 Ga0501081_0140435
754 Ga0501045_0069103
755 Ga0501045_0237953
756 nmdc:mga06z11_238563_c1
757 nmdc:mga09592_82951_c1
758 nmdc:mga0qj67_143197_c1
759 nmdc:mga0qj67_27059_c1
760 nmdc:mga06r32_1846_c1
761 nmdc:mga08y16_141218_c1
762 nmdc:mga08y16_150705_c1
763 nmdc:mga08y16_293377_c1
764 nmdc:mga0n895_16039_c1
765 nmdc:mga0n895_20717_c1
766 nmdc:mga0n895_276146_c1
767 nmdc:mga0rr50_81587_c1
768 nmdc:mga0a205_2472_c1
769 nmdc:mga0a205_256762_c1
770 Ga0500616_0028939
771 Ga0590074_020063
772 Ga0501082_0006872
773 Ga0501082_0349805
774 Ga0530510_0024219
775 Ga0530510_0048246
776 2501069977
777 2501080474
778 2501407726
779 2511089791
780 2511092609
781 2511097603
782 2511105448
783 2643982610
784 2644121881
785 2809034718
786 2883095816
787 2894772859
788 2941480459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

43

281

0.99

PF00106

adh_short

short chain dehydrogenase

37

234

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fhs-assembly1.cif.gz_B structure of acyl carrier protein bound to fabi, the enoyl reductase from escherichia coli 0.9549 9 255
5koi-assembly2.cif.gz_C crystal structure of a possible enoyl-(acyl-carrier-protein) reductase from brucella melitensis 0.9543 8 255
2p91-assembly1.cif.gz_D crystal structure of enoyl-[acyl-carrier-protein] reductase (nadh) from aquifex aeolicus vf5 0.9536 9 260
2yw9-assembly2.cif.gz_E crystal structure of tt0143 from thermus thermophilus hb8 0.9518 10 260
3pjf-assembly1.cif.gz_A structure of enr g93v mutant-nad+-triclosan complex 0.9513 9 255
ID Description Score Start End Superfamily
3grkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9549 9 258 3.40.50.720
2wyuB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9504 10 260 3.40.50.720
2p91C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9447 10 260 3.40.50.720
af_P0AEK4_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9414 9 259 3.40.50.720
af_Q2FZQ3_8_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9384 15 205 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6L5I4U1-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] FabI (EC 1.3.1.9) (NADH-dependent enoyl-ACP reductase) 0.9881 10 189 GO:0004318
GO:0006633
AF-A0A431MZJ8-F1-model_v4 enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) 0.9798 11 140 GO:0004318
GO:0006633
AF-A0A3M1JCV6-F1-model_v4 enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) 0.9795 11 174 GO:0004318
GO:0006633
AF-A0A356HZB3-F1-model_v4 NADH-specific enoyl-ACP reductase 0.9783 10 171 GO:0004318
GO:0006633
AF-A0A7R8WV49-F1-model_v4 Uncharacterized protein 0.9768 8 193 GO:0004318
GO:0006633

Map