F432944

General Info

Members Datasets Scaffolds Average Seq Length
394 200 389 356

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10008689|Ga0307413_100086892
Length 386
Sequence VSHVTAFRARKGVCRRLTLGGARHACGRRTGRAVSYQQWGAMQGQSPLPQSMADQVVVPCFNEEAVLEATHRRLTAVLAELQGLDYEIVYVDDGSRDRTGAILAGLQAGDRRVRVVRFSRNFGHQIAVTAGIEHAGGEATVLIDADLQDPPEVIRDMVARWREGYHVAYGVRTDRPGETAFKRWTAKAFYRLINRLSDTVIPLDTGDFRLMDRCVVDALLAMPEHDRFVRGMVSWAGFRQIAVPYRRAERVAGESKYPLSKMLRFAFDGIASFSIAPLTAATYAGFAASAIALLGIVYALALRLFTDSFVTGWTALFIAVLFVGGIQLTALGVMGQYIGRIYRETKRRPLYLVQERLGFLAHPAGGVERRRIVGRQMHRQYSARSA

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
3 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
4 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
142 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
200 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0.25
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0.25
Rhizoplane 1.27
Rhizosphere 96.19
Stem 0
Stem Tuber 0
Unclassified 2.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10063003 3300003320 Bacteria 3442
2 Ga0058861_11241329 3300004800 Unclassified 1688
3 Ga0065715_10096841 3300005293 Unclassified 3803
4 Ga0065707_10193484 3300005295 Bacteria 1322
5 Ga0070676_10021460 3300005328 Bacteria 3616
6 Ga0070683_100010419 3300005329 Bacteria 7995
7 Ga0070683_100012571 3300005329 Bacteria 7359
8 Ga0070683_100040195 3300005329 Bacteria 4299
9 Ga0070683_100044419 3300005329 Bacteria 4097
10 Ga0070670_100006672 3300005331 Bacteria 9784
11 Ga0070670_100007520 3300005331 Bacteria 9249
12 Ga0070670_100047686 3300005331 Bacteria 3686
13 Ga0070670_100057696 3300005331 Bacteria 3332
14 Ga0070670_100142518 3300005331 Bacteria 2072
15 Ga0068869_100002830 3300005334 Bacteria 10516
16 Ga0068869_100147680 3300005334 Unclassified 1821
17 Ga0068869_100220467 3300005334 Bacteria 1503
18 Ga0070680_100055337 3300005336 Bacteria 3242
19 Ga0070680_100143803 3300005336 Bacteria 2000
20 Ga0068868_100217222 3300005338 Bacteria 1599
21 Ga0070660_100009918 3300005339 Bacteria 6719
22 Ga0070689_100005955 3300005340 Bacteria 8387
23 Ga0070689_100011476 3300005340 Bacteria 6349
24 Ga0070689_100335463 3300005340 Bacteria 1265
25 Ga0070687_100002802 3300005343 Bacteria 6641
26 Ga0070687_100103612 3300005343 Bacteria 1598
27 Ga0070687_100173927 3300005343 Bacteria 1284
28 Ga0070661_100001380 3300005344 Bacteria 16967
29 Ga0070661_100001650 3300005344 Bacteria 15450
30 Ga0070661_100001753 3300005344 Bacteria 15059
31 Ga0070661_100004650 3300005344 Bacteria 9454
32 Ga0070661_100134466 3300005344 Bacteria 1859
33 Ga0070692_10062346 3300005345 Bacteria 1968
34 Ga0070692_10160205 3300005345 Unclassified 1289
35 Ga0070668_100008326 3300005347 Bacteria 7698
36 Ga0070668_100016200 3300005347 Bacteria 5577
37 Ga0070669_100005733 3300005353 Bacteria 8953
38 Ga0070669_100007830 3300005353 Bacteria 7633
39 Ga0070675_100007400 3300005354 Bacteria 8481
40 Ga0070675_100007851 3300005354 Bacteria 8271
41 Ga0070675_100020027 3300005354 Bacteria 5338
42 Ga0070671_100075658 3300005355 Unclassified 2813
43 Ga0070671_100221223 3300005355 Bacteria 1606
44 Ga0070674_100022759 3300005356 Bacteria 4044
45 Ga0070674_100043495 3300005356 Unclassified 3056
46 Ga0070674_100233762 3300005356 Bacteria 1436
47 Ga0070688_100001100 3300005365 Bacteria 13496
48 Ga0070688_100262399 3300005365 Bacteria 1234
49 Ga0070659_100015433 3300005366 Bacteria 5721
50 Ga0070659_100037463 3300005366 Bacteria 3780
51 Ga0070659_100046383 3300005366 Bacteria 3406
52 Ga0070659_100153477 3300005366 Bacteria 1880
53 Ga0070659_100223459 3300005366 Bacteria 1555
54 Ga0070667_100035682 3300005367 Bacteria 4167
55 Ga0070667_100051078 3300005367 Unclassified 3485
56 Ga0070709_10045976 3300005434 Bacteria 2712
57 Ga0070714_100040587 3300005435 Bacteria 3923
58 Ga0070714_100193318 3300005435 Bacteria 1858
59 Ga0070710_10041834 3300005437 Bacteria 2531
60 Ga0070701_10014005 3300005438 Bacteria 3666
61 Ga0070701_10184527 3300005438 Bacteria 1224
62 Ga0070694_100046250 3300005444 Bacteria 2921
63 Ga0070663_100027018 3300005455 Bacteria 3893
64 Ga0070662_100017772 3300005457 Bacteria 4798
65 Ga0070662_100041888 3300005457 Bacteria 3269
66 Ga0070662_100073287 3300005457 Bacteria 2530
67 Ga0070662_100123464 3300005457 Bacteria 1987
68 Ga0070681_10002336 3300005458 Bacteria 17350
69 Ga0070681_10011743 3300005458 Bacteria 8678
70 Ga0068867_100021218 3300005459 Bacteria 4634
71 Ga0068867_100096989 3300005459 Bacteria 2245
72 Ga0070685_10011902 3300005466 Bacteria 4563
73 Ga0070699_100265706 3300005518 Bacteria 1535
74 Ga0070679_100036816 3300005530 Bacteria 4856
75 Ga0070684_100001666 3300005535 Bacteria 16133
76 Ga0070684_100031067 3300005535 Bacteria 4544
77 Ga0070684_100058581 3300005535 Bacteria 3366
78 Ga0068853_100029524 3300005539 Bacteria 4624
79 Ga0070672_100042960 3300005543 Bacteria 3482
80 Ga0070672_100238952 3300005543 Bacteria 1527
81 Ga0070672_100276300 3300005543 Bacteria 1419
82 Ga0070686_100003950 3300005544 Bacteria 8155
83 Ga0070686_100080454 3300005544 Bacteria 2156
84 Ga0070665_100031811 3300005548 Bacteria 5310
85 Ga0070665_100084631 3300005548 Bacteria 3176
86 Ga0070665_100135121 3300005548 Unclassified 2468
87 Ga0068855_100327402 3300005563 Bacteria 1692
88 Ga0070664_100002164 3300005564 Bacteria 15759
89 Ga0070664_100005472 3300005564 Bacteria 10196
90 Ga0070664_100006386 3300005564 Bacteria 9509
91 Ga0070664_100058945 3300005564 Bacteria 3266
92 Ga0070664_100082206 3300005564 Bacteria 2777
93 Ga0068857_100001328 3300005577 Bacteria 19440
94 Ga0068857_100028474 3300005577 Bacteria 4930
95 Ga0068857_100045538 3300005577 Bacteria 3892
96 Ga0068857_100049018 3300005577 Bacteria 3747
97 Ga0068852_100019364 3300005616 Bacteria 5384
98 Ga0068852_100025704 3300005616 Bacteria 4775
99 Ga0068852_100203364 3300005616 Bacteria 1875
100 Ga0068852_100335761 3300005616 Bacteria 1472
101 Ga0068859_100012556 3300005617 Bacteria 8523
102 Ga0068859_100017755 3300005617 Bacteria 7153
103 Ga0068859_100080066 3300005617 Bacteria 3307
104 Ga0068864_100018982 3300005618 Bacteria 5748
105 Ga0068864_100036078 3300005618 Bacteria 4213
106 Ga0068866_10025158 3300005718 Bacteria 2795
107 Ga0068861_100001830 3300005719 Bacteria 13680
108 Ga0068861_100105179 3300005719 Bacteria 2253
109 Ga0068861_100113276 3300005719 Bacteria 2176
110 Ga0068851_10004209 3300005834 Bacteria 6480
111 Ga0068851_10012153 3300005834 Bacteria 4054
112 Ga0068851_10041239 3300005834 Bacteria 2321
113 Ga0068863_100023997 3300005841 Bacteria 5821
114 Ga0068863_100071479 3300005841 Bacteria 3282
115 Ga0068863_100118958 3300005841 Bacteria 2518
116 Ga0068863_100174143 3300005841 Bacteria 2065
117 Ga0068858_100013755 3300005842 Bacteria 7639
118 Ga0068858_100057105 3300005842 Bacteria 3607
119 Ga0068860_100023818 3300005843 Bacteria 5918
120 Ga0068860_100045952 3300005843 Bacteria 4164
121 Ga0068862_100079081 3300005844 Bacteria 2850
122 Ga0081539_10006596 3300005985 Bacteria 11026
123 Ga0070717_10010945 3300006028 Bacteria 6870
124 Ga0070716_100076778 3300006173 Bacteria 1981
125 Ga0068871_100225286 3300006358 Bacteria 1626
126 Ga0075428_100062360 3300006844 Bacteria 4082
127 Ga0075428_100079394 3300006844 Bacteria 3582
128 Ga0075430_100017324 3300006846 Bacteria 6135
129 Ga0075430_100019144 3300006846 Bacteria 5823
130 Ga0075430_100036599 3300006846 Unclassified 4161
131 Ga0075431_100000783 3300006847 Bacteria 27699
132 Ga0075431_100054200 3300006847 Bacteria 4135
133 Ga0075431_100173019 3300006847 Bacteria 2218
134 Ga0075433_10068065 3300006852 Bacteria 3125
135 Ga0075433_10125837 3300006852 Bacteria 2276
136 Ga0075434_100000441 3300006871 Bacteria 30825
137 Ga0075434_100051521 3300006871 Bacteria 4092
138 Ga0075434_100074561 3300006871 Bacteria 3386
139 Ga0075429_100011510 3300006880 Bacteria 7671
140 Ga0068865_100035807 3300006881 Unclassified 3341
141 Ga0097620_100012556 3300006931 Bacteria 8523
142 Ga0097620_100017755 3300006931 Bacteria 7153
143 Ga0097620_100080067 3300006931 Bacteria 3307
144 Ga0075435_100113198 3300007076 Bacteria 2258
145 Ga0111539_10011903 3300009094 Bacteria 10906
146 Ga0111539_10063218 3300009094 Bacteria 4380
147 Ga0111539_10068746 3300009094 Bacteria 4182
148 Ga0111539_10178094 3300009094 Bacteria 2484
149 Ga0105245_10070018 3300009098 Bacteria 3182
150 Ga0105245_10542423 3300009098 Bacteria 1184
151 Ga0114129_10008919 3300009147 Bacteria 14294
152 Ga0114129_10014514 3300009147 Bacteria 11227
153 Ga0114129_10019059 3300009147 Bacteria 9773
154 Ga0114129_10025742 3300009147 Bacteria 8334
155 Ga0114129_10107878 3300009147 Bacteria 3845
156 Ga0114129_10232261 3300009147 Unclassified 2484
157 Ga0105248_10009393 3300009177 Bacteria 10768
158 Ga0105248_10146023 3300009177 Bacteria 2669
159 Ga0105248_10289602 3300009177 Bacteria 1844
160 Ga0105248_10458337 3300009177 Bacteria 1437
161 Ga0105249_10020876 3300009553 Bacteria 5857
162 Ga0105239_10071951 3300010375 Bacteria 3800
163 Ga0105239_10286268 3300010375 Bacteria 1856
164 Ga0105239_10473179 3300010375 Bacteria 1423
165 Ga0105246_10028570 3300011119 Bacteria 3665
166 Ga0105246_10047758 3300011119 Bacteria 2925
167 Ga0157373_10012703 3300013100 Bacteria 6189
168 Ga0157371_10042475 3300013102 Bacteria 3240
169 Ga0157371_10126121 3300013102 Bacteria 1820
170 Ga0157369_10024561 3300013105 Bacteria 6700
171 Ga0157369_10140241 3300013105 Bacteria 2558
172 Ga0157378_10035957 3300013297 Bacteria 4383
173 Ga0163162_10004681 3300013306 Bacteria 13193
174 Ga0163162_10009135 3300013306 Bacteria 9640
175 Ga0163162_10091834 3300013306 Bacteria 3119
176 Ga0157372_10039716 3300013307 Bacteria 5195
177 Ga0157375_10026117 3300013308 Bacteria 5438
178 Ga0157375_10026801 3300013308 Bacteria 5378
179 Ga0157375_10075225 3300013308 Bacteria 3401
180 Ga0157375_10264128 3300013308 Bacteria 1883
181 Ga0163163_10002882 3300014325 Bacteria 14543
182 Ga0163163_10031877 3300014325 Bacteria 5090
183 Ga0157380_10010623 3300014326 Bacteria 6626
184 Ga0182008_10024090 3300014497 Bacteria 3101
185 Ga0157377_10007949 3300014745 Bacteria 5149
186 Ga0157377_10045029 3300014745 Bacteria 2463
187 Ga0157379_10008875 3300014968 Bacteria 8763
188 Ga0157379_10020055 3300014968 Bacteria 5908
189 Ga0163161_10027267 3300017792 Bacteria 4051
190 Ga0207697_10002297 3300025315 Bacteria 9991
191 Ga0207697_10025088 3300025315 Bacteria 2438
192 Ga0207642_10035457 3300025899 Bacteria 2131
193 Ga0207642_10048134 3300025899 Bacteria 1910
194 Ga0207688_10026251 3300025901 Bacteria 3201
195 Ga0207645_10002544 3300025907 Bacteria 14271
196 Ga0207645_10017279 3300025907 Bacteria 4765
197 Ga0207643_10127758 3300025908 Bacteria 1510
198 Ga0207707_10001590 3300025912 Bacteria 20931
199 Ga0207663_10012988 3300025916 Bacteria 4516
200 Ga0207660_10046641 3300025917 Bacteria 3059
201 Ga0207662_10016087 3300025918 Bacteria 4216
202 Ga0207662_10134104 3300025918 Bacteria 1564
203 Ga0207657_10036171 3300025919 Bacteria 4422
204 Ga0207657_10078361 3300025919 Bacteria 2782
205 Ga0207657_10082108 3300025919 Bacteria 2706
206 Ga0207649_10010220 3300025920 Bacteria 5152
207 Ga0207649_10021224 3300025920 Bacteria 3734
208 Ga0207652_10016634 3300025921 Bacteria 6009
209 Ga0207652_10067805 3300025921 Bacteria 3094
210 Ga0207681_10009000 3300025923 Bacteria 6099
211 Ga0207650_10050762 3300025925 Bacteria 3069
212 Ga0207650_10125404 3300025925 Bacteria 2004
213 Ga0207659_10007034 3300025926 Bacteria 6909
214 Ga0207659_10007673 3300025926 Bacteria 6656
215 Ga0207687_10219092 3300025927 Unclassified 1497
216 Ga0207664_10018020 3300025929 Bacteria 5187
217 Ga0207664_10184483 3300025929 Bacteria 1793
218 Ga0207644_10035717 3300025931 Bacteria 3484
219 Ga0207690_10030864 3300025932 Bacteria 3423
220 Ga0207690_10046007 3300025932 Bacteria 2887
221 Ga0207690_10138191 3300025932 Bacteria 1792
222 Ga0207690_10221016 3300025932 Unclassified 1449
223 Ga0207706_10001301 3300025933 Bacteria 25143
224 Ga0207706_10002673 3300025933 Bacteria 17368
225 Ga0207706_10071836 3300025933 Bacteria 3044
226 Ga0207706_10095859 3300025933 Bacteria 2609
227 Ga0207706_10143733 3300025933 Bacteria 2099
228 Ga0207686_10043018 3300025934 Bacteria 2765
229 Ga0207670_10077750 3300025936 Bacteria 2312
230 Ga0207669_10010520 3300025937 Bacteria 4457
231 Ga0207669_10174749 3300025937 Bacteria 1533
232 Ga0207704_10009194 3300025938 Bacteria 4757
233 Ga0207704_10070303 3300025938 Bacteria 2216
234 Ga0207665_10012192 3300025939 Bacteria 5645
235 Ga0207691_10001935 3300025940 Bacteria 20209
236 Ga0207691_10002074 3300025940 Bacteria 19551
237 Ga0207691_10010072 3300025940 Bacteria 9073
238 Ga0207691_10010521 3300025940 Bacteria 8878
239 Ga0207711_10138595 3300025941 Bacteria 2187
240 Ga0207689_10010957 3300025942 Bacteria 7794
241 Ga0207689_10011499 3300025942 Bacteria 7586
242 Ga0207689_10114907 3300025942 Unclassified 2212
243 Ga0207661_10037488 3300025944 Bacteria 3792
244 Ga0207661_10138098 3300025944 Bacteria 2095
245 Ga0207661_10170872 3300025944 Bacteria 1892
246 Ga0207679_10000881 3300025945 Bacteria 19153
247 Ga0207679_10002408 3300025945 Bacteria 11531
248 Ga0207679_10008826 3300025945 Bacteria 6425
249 Ga0207679_10018106 3300025945 Bacteria 4712
250 Ga0207679_10028898 3300025945 Bacteria 3855
251 Ga0207667_10316237 3300025949 Bacteria 1595
252 Ga0207651_10025585 3300025960 Bacteria 3671
253 Ga0207651_10044793 3300025960 Bacteria 2964
254 Ga0207651_10049354 3300025960 Bacteria 2851
255 Ga0207668_10081861 3300025972 Bacteria 2343
256 Ga0207658_10100708 3300025986 Unclassified 2262
257 Ga0207677_10093291 3300026023 Unclassified 2194
258 Ga0207703_10086343 3300026035 Bacteria 2628
259 Ga0207639_10047643 3300026041 Bacteria 3240
260 Ga0207678_10033574 3300026067 Bacteria 4469
261 Ga0207641_10113238 3300026088 Bacteria 2409
262 Ga0207648_10013377 3300026089 Bacteria 7636
263 Ga0207648_10049473 3300026089 Unclassified 3678
264 Ga0207648_10101959 3300026089 Bacteria 2515
265 Ga0207676_10018276 3300026095 Bacteria 5094
266 Ga0207676_10043846 3300026095 Bacteria 3447
267 Ga0207674_10000596 3300026116 Bacteria 47593
268 Ga0207674_10001240 3300026116 Bacteria 33282
269 Ga0207674_10004407 3300026116 Bacteria 16958
270 Ga0207674_10005722 3300026116 Bacteria 14737
271 Ga0207675_100000146 3300026118 Bacteria 61267
272 Ga0207675_100065402 3300026118 Bacteria 3398
273 Ga0207675_100138052 3300026118 Bacteria 2314
274 Ga0207698_10052032 3300026142 Bacteria 3135
275 Ga0207698_10072800 3300026142 Bacteria 2733
276 Ga0207698_10376217 3300026142 Unclassified 1350
277 Ga0268266_10265730 3300028379 Unclassified 1591
278 Ga0268265_10015262 3300028380 Bacteria 5252
279 Ga0268265_10036583 3300028380 Bacteria 3596
280 Ga0265326_10026663 3300028558 Bacteria 1647
281 Ga0265318_10087730 3300028577 Bacteria 1146
282 Ga0265323_10011040 3300028653 Bacteria 3653
283 Ga0265323_10020446 3300028653 Bacteria 2548
284 Ga0265338_10059596 3300028800 Bacteria 3362
285 Ga0265338_10060552 3300028800 Bacteria 3325
286 Ga0265324_10000020 3300029957 Bacteria 172436
287 Ga0265330_10000474 3300031235 Bacteria 26967
288 Ga0265330_10009987 3300031235 Bacteria 4493
289 Ga0265332_10045067 3300031238 Bacteria 1901
290 Ga0265320_10011913 3300031240 Bacteria 5092
291 Ga0265325_10001875 3300031241 Bacteria 14503
292 Ga0265329_10000051 3300031242 Bacteria 50997
293 Ga0265329_10039760 3300031242 Bacteria 1510
294 Ga0265340_10000704 3300031247 Bacteria 18880
295 Ga0265340_10006236 3300031247 Bacteria 6572
296 Ga0265339_10000009 3300031249 Bacteria 221449
297 Ga0265339_10046683 3300031249 Bacteria 2379
298 Ga0265331_10002264 3300031250 Bacteria 13162
299 Ga0265316_10000519 3300031344 Bacteria 43466
300 Ga0265316_10005211 3300031344 Bacteria 12710
301 Ga0265316_10005809 3300031344 Bacteria 11903
302 Ga0265316_10146274 3300031344 Bacteria 1772
303 Ga0307408_100001905 3300031548 Bacteria 15160
304 Ga0307408_100007114 3300031548 Bacteria 7407
305 Ga0265313_10003030 3300031595 Bacteria 13969
306 Ga0265313_10007837 3300031595 Bacteria 7208
307 Ga0316579_10080352 3300031691 Bacteria 1552
308 Ga0265314_10002590 3300031711 Bacteria 18300
309 Ga0265314_10002980 3300031711 Bacteria 16781
310 Ga0265314_10193396 3300031711 Bacteria 1208
311 Ga0265342_10001816 3300031712 Bacteria 19392
312 Ga0265342_10003741 3300031712 Bacteria 12298
313 Ga0265342_10012057 3300031712 Bacteria 5869
314 Ga0265342_10156499 3300031712 Bacteria 1262
315 Ga0316576_10189046 3300031727 Bacteria 1553
316 Ga0316578_10118191 3300031728 Bacteria 1593
317 Ga0307413_10008689 3300031824 Bacteria 4812
318 Ga0307413_10016758 3300031824 Unclassified 3797
319 Ga0307410_10002787 3300031852 Bacteria 8558
320 Ga0307406_10002023 3300031901 Bacteria 11069
321 Ga0307406_10005298 3300031901 Bacteria 7054
322 Ga0307406_10139051 3300031901 Bacteria 1716
323 Ga0307407_10244722 3300031903 Bacteria 1225
324 Ga0307409_100028834 3300031995 Bacteria 3962
325 Ga0307409_100179496 3300031995 Bacteria 1873
326 Ga0307409_100558848 3300031995 Bacteria 1125
327 Ga0307416_100101091 3300032002 Bacteria 2510
328 Ga0307416_100124841 3300032002 Bacteria 2304
329 Ga0307414_10077680 3300032004 Bacteria 2417
330 Ga0307414_10120477 3300032004 Bacteria 2016
331 Ga0307411_10009606 3300032005 Bacteria 5100
332 Ga0307411_10329092 3300032005 Bacteria 1237
333 Ga0307415_100052113 3300032126 Bacteria 2781
334 Ga0373946_0098895 3300035171 Bacteria 1305
335 Ga0373931_0126588 3300035691 Bacteria 1466
336 Ga0395905_0107922 3300037471 Bacteria 2614
337 Ga0395905_0425715 3300037471 Bacteria 1224
338 Ga0436365_0103412 3300039437 Bacteria 5006
339 Ga0451853_0562678 3300041512 Bacteria 1208
340 Ga0451577_0000059 3300042876 Bacteria 271425
341 Ga0453683_0000196 3300044673 Bacteria 82692
342 Ga0453683_0009894 3300044673 Bacteria 6348
343 Ga0453683_0014535 3300044673 Bacteria 5108
344 Ga0453684_0078655 3300044712 Bacteria 4126
345 Ga0453684_0139833 3300044712 Bacteria 2893
346 Ga0453684_0310240 3300044712 Unclassified 1790
347 Ga0453684_0380144 3300044712 Bacteria 1586
348 Ga0451576_0017428 3300045051 Bacteria 7898
349 Ga0451576_0042761 3300045051 Bacteria 4783
350 Ga0451576_0110012 3300045051 Bacteria 2867
351 Ga0495621_0014092 3300046539 Bacteria 2524
352 Ga0495670_0032433 3300046691 Bacteria 2599
353 Ga0495685_009613 3300047447 Bacteria 3235
354 Ga0496107_0286002 3300048910 Unclassified 1227
355 Ga0496108_0181724 3300048911 Bacteria 1821
356 Ga0496109_0242231 3300048912 Bacteria 1697
357 Ga0496111_0031513 3300048914 Bacteria 3777
358 Ga0496119_0000128 3300048922 Bacteria 107532
359 Ga0496120_0000390 3300048923 Bacteria 70903
360 Ga0496124_0000402 3300048927 Bacteria 78711
361 Ga0501039_0050374 3300049575 Bacteria 3222
362 Ga0501039_0304595 3300049575 Bacteria 1253
363 Ga0501046_0000590 3300049580 Bacteria 35675
364 Ga0501047_0134392 3300049581 Bacteria 2353
365 Ga0501067_0020781 3300049583 Bacteria 3631
366 nmdc:mga05p37_116015_c1 3300050507 Bacteria 3291
367 nmdc:mga05p37_193174_c1 3300050507 Unclassified 2470
368 nmdc:mga05p37_31598_c1 3300050507 Bacteria 6468
369 nmdc:mga05p37_44584_c1 3300050507 Bacteria 5456
370 nmdc:mga05p37_9138_c1 3300050507 Bacteria 11716
371 nmdc:mga09592_12873_c1 3300050508 Bacteria 6821
372 nmdc:mga0qj67_23216_c1 3300050509 Bacteria 4769
373 nmdc:mga0qj67_53069_c1 3300050509 Bacteria 3209
374 nmdc:mga06r32_111973_c1 3300050510 Bacteria 2686
375 nmdc:mga06r32_13887_c1 3300050510 Bacteria 7308
376 nmdc:mga06r32_15153_c1 3300050510 Bacteria 7000
377 nmdc:mga08y16_172463_c1 3300050511 Bacteria 2247
378 nmdc:mga08y16_43973_c1 3300050511 Bacteria 4680
379 nmdc:mga08y16_50237_c1 3300050511 Bacteria 4364
380 nmdc:mga08y16_62820_c1 3300050511 Unclassified 3878
381 nmdc:mga0n895_1377_c1 3300050512 Bacteria 18093
382 nmdc:mga0n895_156354_c1 3300050512 Bacteria 2311
383 nmdc:mga0n895_45010_c1 3300050512 Unclassified 4305
384 nmdc:mga0n895_865_c1 3300050512 Bacteria 21747
385 nmdc:mga0rr50_202099_c1 3300050513 Bacteria 1633
386 nmdc:mga0a205_18537_c1 3300050515 Bacteria 6545
387 nmdc:mga0a205_59441_c1 3300050515 Bacteria 3692
388 Ga0500622_0009083 3300053156 Bacteria 5520
389 Ga0530510_0024037 3300061734 Bacteria 4346

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10045976 Ga0070709_100459763 301
2 3300005435 Ga0070714_100040587 Ga0070714_1000405872 301
3 3300005437 Ga0070710_10041834 Ga0070710_100418342 301
4 3300006028 Ga0070717_10010945 Ga0070717_100109453 301
5 3300006173 Ga0070716_100076778 Ga0070716_1000767782 301
6 3300025929 Ga0207664_10018020 Ga0207664_100180203 301
7 3300025939 Ga0207665_10012192 Ga0207665_100121922 301
8 3300042876 Ga0451577_0000059 Ga0451577_0000059_3298_4290 301
9 3300039437 Ga0436365_0103412 Ga0436365_0103412_3238_4248 310
10 iso_pu_bacteria 2600254931 2600362966 310
11 3300044712 Ga0453684_0139833 Ga0453684_0139833_1404_2387 311
12 3300031824 Ga0307413_10008689 Ga0307413_100086892 313
13 3300031852 Ga0307410_10002787 Ga0307410_100027873 313
14 3300032005 Ga0307411_10009606 Ga0307411_100096062 313
15 3300044712 Ga0453684_0078655 Ga0453684_0078655_388_1464 313
16 3300031711 Ga0265314_10002590 Ga0265314_1000259015 314
17 3300031995 Ga0307409_100179496 Ga0307409_1001794962 314
18 3300009147 Ga0114129_10107878 Ga0114129_101078782 315
19 3300031548 Ga0307408_100001905 Ga0307408_10000190510 315
20 3300031901 Ga0307406_10002023 Ga0307406_100020235 315
21 3300050507 nmdc:mga05p37_116015_c1 nmdc:mga05p37_116015_c1_200_1222 315
22 3300005293 Ga0065715_10096841 Ga0065715_100968412 316
23 3300005548 Ga0070665_100135121 Ga0070665_1001351212 316
24 3300028379 Ga0268266_10265730 Ga0268266_102657302 316
25 3300044673 Ga0453683_0009894 Ga0453683_0009894_5205_6212 316
26 3300005334 Ga0068869_100220467 Ga0068869_1002204672 317
27 3300005345 Ga0070692_10062346 Ga0070692_100623462 317
28 3300010375 Ga0105239_10473179 Ga0105239_104731791 317
29 3300011119 Ga0105246_10028570 Ga0105246_100285704 317
30 3300013100 Ga0157373_10012703 Ga0157373_100127034 317
31 3300028558 Ga0265326_10026663 Ga0265326_100266631 317
32 3300028577 Ga0265318_10087730 Ga0265318_100877301 317
33 3300028653 Ga0265323_10011040 Ga0265323_100110402 317
34 3300028653 Ga0265323_10020446 Ga0265323_100204463 317
35 3300028800 Ga0265338_10060552 Ga0265338_100605521 317
36 3300031235 Ga0265330_10009987 Ga0265330_100099873 317
37 3300031238 Ga0265332_10045067 Ga0265332_100450672 317
38 3300031240 Ga0265320_10011913 Ga0265320_100119133 317
39 3300031241 Ga0265325_10001875 Ga0265325_1000187511 317
40 3300031242 Ga0265329_10000051 Ga0265329_1000005126 317
41 3300031242 Ga0265329_10039760 Ga0265329_100397601 317
42 3300031247 Ga0265340_10000704 Ga0265340_100007041 317
43 3300031249 Ga0265339_10046683 Ga0265339_100466832 317
44 3300031250 Ga0265331_10002264 Ga0265331_100022646 317
45 3300031344 Ga0265316_10000519 Ga0265316_1000051913 317
46 3300031344 Ga0265316_10005211 Ga0265316_1000521110 317
47 3300031595 Ga0265313_10007837 Ga0265313_100078372 317
48 3300031711 Ga0265314_10193396 Ga0265314_101933962 317
49 3300031712 Ga0265342_10001816 Ga0265342_100018168 317
50 3300031712 Ga0265342_10003741 Ga0265342_100037418 317
51 3300032002 Ga0307416_100124841 Ga0307416_1001248412 317
52 3300053156 Ga0500622_0009083 Ga0500622_0009083_3004_4059 317
53 3300005331 Ga0070670_100047686 Ga0070670_1000476862 318
54 3300005340 Ga0070689_100005955 Ga0070689_1000059552 318
55 3300005343 Ga0070687_100103612 Ga0070687_1001036121 318
56 3300005353 Ga0070669_100007830 Ga0070669_1000078301 318
57 3300005354 Ga0070675_100007400 Ga0070675_1000074009 318
58 3300005466 Ga0070685_10011902 Ga0070685_100119023 318
59 3300005544 Ga0070686_100080454 Ga0070686_1000804543 318
60 3300005617 Ga0068859_100017755 Ga0068859_1000177552 318
61 3300006931 Ga0097620_100017755 Ga0097620_1000177554 318
62 3300009177 Ga0105248_10146023 Ga0105248_101460232 318
63 3300011119 Ga0105246_10047758 Ga0105246_100477582 318
64 3300013306 Ga0163162_10091834 Ga0163162_100918342 318
65 3300013308 Ga0157375_10026801 Ga0157375_100268013 318
66 3300014745 Ga0157377_10045029 Ga0157377_100450292 318
67 3300025315 Ga0207697_10025088 Ga0207697_100250882 318
68 3300025918 Ga0207662_10134104 Ga0207662_101341042 318
69 3300025923 Ga0207681_10009000 Ga0207681_100090002 318
70 3300025926 Ga0207659_10007673 Ga0207659_100076732 318
71 3300025931 Ga0207644_10035717 Ga0207644_100357172 318
72 3300025933 Ga0207706_10143733 Ga0207706_101437331 318
73 3300025936 Ga0207670_10077750 Ga0207670_100777502 318
74 3300025960 Ga0207651_10025585 Ga0207651_100255851 318
75 3300028800 Ga0265338_10059596 Ga0265338_100595962 318
76 3300029957 Ga0265324_10000020 Ga0265324_1000002099 318
77 3300031249 Ga0265339_10000009 Ga0265339_10000009132 318
78 3300031595 Ga0265313_10003030 Ga0265313_1000303010 318
79 3300031691 Ga0316579_10080352 Ga0316579_100803521 318
80 3300031712 Ga0265342_10156499 Ga0265342_101564991 318
81 3300031728 Ga0316578_10118191 Ga0316578_101181912 318
82 3300046539 Ga0495621_0014092 Ga0495621_0014092_210_1298 318
83 3300006844 Ga0075428_100062360 Ga0075428_1000623602 319
84 3300006847 Ga0075431_100000783 Ga0075431_10000078312 319
85 3300031247 Ga0265340_10006236 Ga0265340_100062364 319
86 3300044712 Ga0453684_0380144 Ga0453684_0380144_139_1146 319
87 3300050510 nmdc:mga06r32_13887_c1 nmdc:mga06r32_13887_c1_5764_6753 319
88 3300005329 Ga0070683_100040195 Ga0070683_1000401952 320
89 3300009147 Ga0114129_10014514 Ga0114129_100145144 320
90 3300025944 Ga0207661_10138098 Ga0207661_101380982 320
91 3300032002 Ga0307416_100101091 Ga0307416_1001010912 320
92 3300032126 Ga0307415_100052113 Ga0307415_1000521133 320
93 3300049580 Ga0501046_0000590 Ga0501046_0000590_28641_29648 320
94 3300049581 Ga0501047_0134392 Ga0501047_0134392_84_1091 320
95 3300050507 nmdc:mga05p37_31598_c1 nmdc:mga05p37_31598_c1_3527_4525 320
96 3300009094 Ga0111539_10011903 Ga0111539_100119038 321
97 3300013297 Ga0157378_10035957 Ga0157378_100359572 321
98 3300025908 Ga0207643_10127758 Ga0207643_101277582 321
99 3300031344 Ga0265316_10005809 Ga0265316_100058095 321
100 3300031711 Ga0265314_10002980 Ga0265314_1000298011 321
101 3300048914 Ga0496111_0031513 Ga0496111_0031513_2097_3098 321
102 3300050509 nmdc:mga0qj67_23216_c1 nmdc:mga0qj67_23216_c1_247_1239 321
103 3300050511 nmdc:mga08y16_172463_c1 nmdc:mga08y16_172463_c1_1191_2204 321
104 iso_pu_bacteria 2884298095 2884299535 321
105 3300005347 Ga0070668_100008326 Ga0070668_1000083265 322
106 3300031824 Ga0307413_10016758 Ga0307413_100167582 322
107 3300032005 Ga0307411_10329092 Ga0307411_103290921 322
108 3300044712 Ga0453684_0310240 Ga0453684_0310240_64_1077 322
109 3300061734 Ga0530510_0024037 Ga0530510_0024037_1693_2667 322
110 3300005331 Ga0070670_100007520 Ga0070670_1000075207 323
111 3300005334 Ga0068869_100147680 Ga0068869_1001476802 323
112 3300005459 Ga0068867_100021218 Ga0068867_1000212184 323
113 3300005544 Ga0070686_100003950 Ga0070686_1000039504 323
114 3300005617 Ga0068859_100012556 Ga0068859_1000125563 323
115 3300006846 Ga0075430_100019144 Ga0075430_1000191445 323
116 3300006846 Ga0075430_100036599 Ga0075430_1000365992 323
117 3300006847 Ga0075431_100054200 Ga0075431_1000542003 323
118 3300006931 Ga0097620_100012556 Ga0097620_1000125564 323
119 3300025940 Ga0207691_10001935 Ga0207691_1000193513 323
120 3300025942 Ga0207689_10010957 Ga0207689_100109572 323
121 3300025942 Ga0207689_10114907 Ga0207689_101149072 323
122 3300025945 Ga0207679_10028898 Ga0207679_100288982 323
123 3300025960 Ga0207651_10044793 Ga0207651_100447932 323
124 3300026088 Ga0207641_10113238 Ga0207641_101132382 323
125 3300031235 Ga0265330_10000474 Ga0265330_1000047418 323
126 3300031344 Ga0265316_10146274 Ga0265316_101462742 323
127 3300031712 Ga0265342_10012057 Ga0265342_100120572 323
128 3300031995 Ga0307409_100558848 Ga0307409_1005588481 323
129 3300041512 Ga0451853_0562678 Ga0451853_0562678_93_1196 323
130 3300049583 Ga0501067_0020781 Ga0501067_0020781_2498_3502 323
131 3300050510 nmdc:mga06r32_15153_c1 nmdc:mga06r32_15153_c1_3939_5000 323
132 3300005518 Ga0070699_100265706 Ga0070699_1002657061 324
133 3300005548 Ga0070665_100084631 Ga0070665_1000846313 324
134 3300005718 Ga0068866_10025158 Ga0068866_100251582 324
135 3300006844 Ga0075428_100079394 Ga0075428_1000793942 324
136 3300006846 Ga0075430_100017324 Ga0075430_1000173246 324
137 3300006847 Ga0075431_100173019 Ga0075431_1001730192 324
138 3300006852 Ga0075433_10125837 Ga0075433_101258372 324
139 3300006871 Ga0075434_100000441 Ga0075434_1000004415 324
140 3300006880 Ga0075429_100011510 Ga0075429_1000115106 324
141 3300009094 Ga0111539_10068746 Ga0111539_100687462 324
142 3300009147 Ga0114129_10025742 Ga0114129_100257423 324
143 3300031903 Ga0307407_10244722 Ga0307407_102447222 324
144 3300031995 Ga0307409_100028834 Ga0307409_1000288346 324
145 3300032004 Ga0307414_10077680 Ga0307414_100776802 324
146 3300037471 Ga0395905_0425715 Ga0395905_0425715_67_1089 324
147 3300045051 Ga0451576_0110012 Ga0451576_0110012_739_1830 324
148 3300049575 Ga0501039_0050374 Ga0501039_0050374_1443_2435 324
149 3300050508 nmdc:mga09592_12873_c1 nmdc:mga09592_12873_c1_4763_5866 324
150 3300050509 nmdc:mga0qj67_53069_c1 nmdc:mga0qj67_53069_c1_1596_2699 324
151 3300050510 nmdc:mga06r32_111973_c1 nmdc:mga06r32_111973_c1_79_1182 324
152 3300050511 nmdc:mga08y16_62820_c1 nmdc:mga08y16_62820_c1_2685_3785 324
153 3300050512 nmdc:mga0n895_1377_c1 nmdc:mga0n895_1377_c1_6504_7604 324
154 3300050515 nmdc:mga0a205_18537_c1 nmdc:mga0a205_18537_c1_5117_6217 324
155 3300005295 Ga0065707_10193484 Ga0065707_101934842 325
156 3300005328 Ga0070676_10021460 Ga0070676_100214602 325
157 3300005329 Ga0070683_100010419 Ga0070683_1000104191 325
158 3300005329 Ga0070683_100044419 Ga0070683_1000444192 325
159 3300005331 Ga0070670_100006672 Ga0070670_1000066724 325
160 3300005331 Ga0070670_100057696 Ga0070670_1000576961 325
161 3300005331 Ga0070670_100142518 Ga0070670_1001425182 325
162 3300005334 Ga0068869_100002830 Ga0068869_1000028304 325
163 3300005336 Ga0070680_100055337 Ga0070680_1000553373 325
164 3300005336 Ga0070680_100143803 Ga0070680_1001438031 325
165 3300005339 Ga0070660_100009918 Ga0070660_1000099185 325
166 3300005340 Ga0070689_100011476 Ga0070689_1000114764 325
167 3300005343 Ga0070687_100002802 Ga0070687_1000028023 325
168 3300005344 Ga0070661_100001380 Ga0070661_1000013806 325
169 3300005344 Ga0070661_100001650 Ga0070661_1000016503 325
170 3300005344 Ga0070661_100001753 Ga0070661_1000017532 325
171 3300005344 Ga0070661_100134466 Ga0070661_1001344662 325
172 3300005345 Ga0070692_10160205 Ga0070692_101602051 325
173 3300005347 Ga0070668_100016200 Ga0070668_1000162003 325
174 3300005353 Ga0070669_100005733 Ga0070669_1000057337 325
175 3300005354 Ga0070675_100007851 Ga0070675_1000078516 325
176 3300005355 Ga0070671_100075658 Ga0070671_1000756582 325
177 3300005355 Ga0070671_100221223 Ga0070671_1002212232 325
178 3300005356 Ga0070674_100022759 Ga0070674_1000227592 325
179 3300005356 Ga0070674_100043495 Ga0070674_1000434953 325
180 3300005356 Ga0070674_100233762 Ga0070674_1002337621 325
181 3300005365 Ga0070688_100001100 Ga0070688_1000011008 325
182 3300005366 Ga0070659_100015433 Ga0070659_1000154332 325
183 3300005366 Ga0070659_100046383 Ga0070659_1000463832 325
184 3300005366 Ga0070659_100153477 Ga0070659_1001534771 325
185 3300005367 Ga0070667_100035682 Ga0070667_1000356822 325
186 3300005438 Ga0070701_10014005 Ga0070701_100140053 325
187 3300005438 Ga0070701_10184527 Ga0070701_101845271 325
188 3300005444 Ga0070694_100046250 Ga0070694_1000462503 325
189 3300005457 Ga0070662_100017772 Ga0070662_1000177724 325
190 3300005457 Ga0070662_100041888 Ga0070662_1000418882 325
191 3300005457 Ga0070662_100073287 Ga0070662_1000732872 325
192 3300005458 Ga0070681_10002336 Ga0070681_1000233613 325
193 3300005458 Ga0070681_10011743 Ga0070681_100117437 325
194 3300005459 Ga0068867_100096989 Ga0068867_1000969892 325
195 3300005530 Ga0070679_100036816 Ga0070679_1000368163 325
196 3300005535 Ga0070684_100031067 Ga0070684_1000310674 325
197 3300005535 Ga0070684_100058581 Ga0070684_1000585811 325
198 3300005539 Ga0068853_100029524 Ga0068853_1000295242 325
199 3300005543 Ga0070672_100042960 Ga0070672_1000429603 325
200 3300005543 Ga0070672_100276300 Ga0070672_1002763002 325
201 3300005548 Ga0070665_100031811 Ga0070665_1000318114 325
202 3300005564 Ga0070664_100002164 Ga0070664_10000216413 325
203 3300005564 Ga0070664_100006386 Ga0070664_1000063862 325
204 3300005564 Ga0070664_100058945 Ga0070664_1000589452 325
205 3300005564 Ga0070664_100082206 Ga0070664_1000822062 325
206 3300005577 Ga0068857_100001328 Ga0068857_1000013288 325
207 3300005577 Ga0068857_100028474 Ga0068857_1000284741 325
208 3300005577 Ga0068857_100049018 Ga0068857_1000490183 325
209 3300005616 Ga0068852_100019364 Ga0068852_1000193644 325
210 3300005616 Ga0068852_100203364 Ga0068852_1002033641 325
211 3300005616 Ga0068852_100335761 Ga0068852_1003357612 325
212 3300005617 Ga0068859_100080066 Ga0068859_1000800662 325
213 3300005618 Ga0068864_100018982 Ga0068864_1000189822 325
214 3300005618 Ga0068864_100036078 Ga0068864_1000360784 325
215 3300005719 Ga0068861_100001830 Ga0068861_1000018308 325
216 3300005719 Ga0068861_100113276 Ga0068861_1001132762 325
217 3300005834 Ga0068851_10012153 Ga0068851_100121532 325
218 3300005834 Ga0068851_10041239 Ga0068851_100412392 325
219 3300005841 Ga0068863_100023997 Ga0068863_1000239975 325
220 3300005841 Ga0068863_100118958 Ga0068863_1001189582 325
221 3300005841 Ga0068863_100174143 Ga0068863_1001741431 325
222 3300005842 Ga0068858_100057105 Ga0068858_1000571052 325
223 3300005843 Ga0068860_100023818 Ga0068860_1000238185 325
224 3300005844 Ga0068862_100079081 Ga0068862_1000790812 325
225 3300006358 Ga0068871_100225286 Ga0068871_1002252862 325
226 3300006852 Ga0075433_10068065 Ga0075433_100680652 325
227 3300006871 Ga0075434_100074561 Ga0075434_1000745613 325
228 3300006881 Ga0068865_100035807 Ga0068865_1000358073 325
229 3300006931 Ga0097620_100080067 Ga0097620_1000800673 325
230 3300007076 Ga0075435_100113198 Ga0075435_1001131982 325
231 3300009094 Ga0111539_10063218 Ga0111539_100632182 325
232 3300009098 Ga0105245_10070018 Ga0105245_100700181 325
233 3300009177 Ga0105248_10009393 Ga0105248_100093934 325
234 3300009177 Ga0105248_10289602 Ga0105248_102896021 325
235 3300009177 Ga0105248_10458337 Ga0105248_104583372 325
236 3300009553 Ga0105249_10020876 Ga0105249_100208763 325
237 3300010375 Ga0105239_10071951 Ga0105239_100719512 325
238 3300013102 Ga0157371_10042475 Ga0157371_100424753 325
239 3300013105 Ga0157369_10024561 Ga0157369_100245611 325
240 3300013105 Ga0157369_10140241 Ga0157369_101402412 325
241 3300013306 Ga0163162_10009135 Ga0163162_100091355 325
242 3300013307 Ga0157372_10039716 Ga0157372_100397161 325
243 3300013308 Ga0157375_10026117 Ga0157375_100261172 325
244 3300014325 Ga0163163_10002882 Ga0163163_100028825 325
245 3300014325 Ga0163163_10031877 Ga0163163_100318772 325
246 3300014745 Ga0157377_10007949 Ga0157377_100079494 325
247 3300014968 Ga0157379_10008875 Ga0157379_100088751 325
248 3300017792 Ga0163161_10027267 Ga0163161_100272673 325
249 3300025315 Ga0207697_10002297 Ga0207697_100022973 325
250 3300025899 Ga0207642_10035457 Ga0207642_100354571 325
251 3300025899 Ga0207642_10048134 Ga0207642_100481342 325
252 3300025901 Ga0207688_10026251 Ga0207688_100262512 325
253 3300025907 Ga0207645_10002544 Ga0207645_100025448 325
254 3300025912 Ga0207707_10001590 Ga0207707_100015904 325
255 3300025916 Ga0207663_10012988 Ga0207663_100129883 325
256 3300025917 Ga0207660_10046641 Ga0207660_100466412 325
257 3300025918 Ga0207662_10016087 Ga0207662_100160871 325
258 3300025919 Ga0207657_10036171 Ga0207657_100361711 325
259 3300025919 Ga0207657_10078361 Ga0207657_100783612 325
260 3300025920 Ga0207649_10010220 Ga0207649_100102201 325
261 3300025921 Ga0207652_10016634 Ga0207652_100166343 325
262 3300025921 Ga0207652_10067805 Ga0207652_100678052 325
263 3300025925 Ga0207650_10050762 Ga0207650_100507623 325
264 3300025925 Ga0207650_10125404 Ga0207650_101254042 325
265 3300025926 Ga0207659_10007034 Ga0207659_100070345 325
266 3300025932 Ga0207690_10030864 Ga0207690_100308642 325
267 3300025932 Ga0207690_10138191 Ga0207690_101381912 325
268 3300025932 Ga0207690_10221016 Ga0207690_102210161 325
269 3300025933 Ga0207706_10001301 Ga0207706_1000130115 325
270 3300025933 Ga0207706_10071836 Ga0207706_100718362 325
271 3300025933 Ga0207706_10095859 Ga0207706_100958592 325
272 3300025934 Ga0207686_10043018 Ga0207686_100430181 325
273 3300025937 Ga0207669_10010520 Ga0207669_100105202 325
274 3300025937 Ga0207669_10174749 Ga0207669_101747491 325
275 3300025938 Ga0207704_10009194 Ga0207704_100091942 325
276 3300025940 Ga0207691_10002074 Ga0207691_1000207410 325
277 3300025940 Ga0207691_10010072 Ga0207691_100100723 325
278 3300025941 Ga0207711_10138595 Ga0207711_101385952 325
279 3300025942 Ga0207689_10011499 Ga0207689_100114995 325
280 3300025944 Ga0207661_10037488 Ga0207661_100374883 325
281 3300025944 Ga0207661_10170872 Ga0207661_101708722 325
282 3300025945 Ga0207679_10000881 Ga0207679_100008816 325
283 3300025945 Ga0207679_10008826 Ga0207679_100088263 325
284 3300025945 Ga0207679_10018106 Ga0207679_100181063 325
285 3300025960 Ga0207651_10049354 Ga0207651_100493542 325
286 3300025986 Ga0207658_10100708 Ga0207658_101007082 325
287 3300026023 Ga0207677_10093291 Ga0207677_100932912 325
288 3300026041 Ga0207639_10047643 Ga0207639_100476433 325
289 3300026067 Ga0207678_10033574 Ga0207678_100335743 325
290 3300026089 Ga0207648_10013377 Ga0207648_100133772 325
291 3300026089 Ga0207648_10049473 Ga0207648_100494732 325
292 3300026089 Ga0207648_10101959 Ga0207648_101019592 325
293 3300026095 Ga0207676_10018276 Ga0207676_100182764 325
294 3300026095 Ga0207676_10043846 Ga0207676_100438461 325
295 3300026116 Ga0207674_10000596 Ga0207674_100005966 325
296 3300026116 Ga0207674_10001240 Ga0207674_1000124016 325
297 3300026116 Ga0207674_10005722 Ga0207674_1000572212 325
298 3300026118 Ga0207675_100000146 Ga0207675_10000014644 325
299 3300026118 Ga0207675_100138052 Ga0207675_1001380522 325
300 3300026142 Ga0207698_10052032 Ga0207698_100520321 325
301 3300026142 Ga0207698_10072800 Ga0207698_100728001 325
302 3300026142 Ga0207698_10376217 Ga0207698_103762172 325
303 3300028380 Ga0268265_10036583 Ga0268265_100365831 325
304 3300031727 Ga0316576_10189046 Ga0316576_101890461 325
305 3300031901 Ga0307406_10005298 Ga0307406_100052984 325
306 3300032004 Ga0307414_10120477 Ga0307414_101204772 325
307 3300035171 Ga0373946_0098895 Ga0373946_0098895_71_1174 325
308 3300035691 Ga0373931_0126588 Ga0373931_0126588_245_1348 325
309 3300045051 Ga0451576_0042761 Ga0451576_0042761_3021_4130 325
310 3300048910 Ga0496107_0286002 Ga0496107_0286002_98_1207 325
311 3300048911 Ga0496108_0181724 Ga0496108_0181724_557_1666 325
312 3300048912 Ga0496109_0242231 Ga0496109_0242231_421_1530 325
313 3300048922 Ga0496119_0000128 Ga0496119_0000128_33563_34564 325
314 3300048923 Ga0496120_0000390 Ga0496120_0000390_18889_19890 325
315 3300048927 Ga0496124_0000402 Ga0496124_0000402_22097_23095 325
316 3300050511 nmdc:mga08y16_50237_c1 nmdc:mga08y16_50237_c1_1065_2195 325
317 3300050512 nmdc:mga0n895_156354_c1 nmdc:mga0n895_156354_c1_331_1440 325
318 3300050512 nmdc:mga0n895_865_c1 nmdc:mga0n895_865_c1_13720_14850 325
319 3300050513 nmdc:mga0rr50_202099_c1 nmdc:mga0rr50_202099_c1_332_1441 325
320 3300050515 nmdc:mga0a205_59441_c1 nmdc:mga0a205_59441_c1_569_1699 325
321 iso_pu_bacteria 2524023250 2524611774 325
322 iso_pu_bacteria 3003665799 3003670129 325
323 iso_pu_bacteria 643348564 643603525 325
324 3300004800 Ga0058861_11241329 Ga0058861_112413291 326
325 3300005329 Ga0070683_100012571 Ga0070683_1000125715 326
326 3300005338 Ga0068868_100217222 Ga0068868_1002172222 326
327 3300005340 Ga0070689_100335463 Ga0070689_1003354631 326
328 3300005343 Ga0070687_100173927 Ga0070687_1001739271 326
329 3300005344 Ga0070661_100004650 Ga0070661_1000046506 326
330 3300005354 Ga0070675_100020027 Ga0070675_1000200274 326
331 3300005365 Ga0070688_100262399 Ga0070688_1002623991 326
332 3300005366 Ga0070659_100037463 Ga0070659_1000374632 326
333 3300005366 Ga0070659_100223459 Ga0070659_1002234592 326
334 3300005367 Ga0070667_100051078 Ga0070667_1000510783 326
335 3300005455 Ga0070663_100027018 Ga0070663_1000270182 326
336 3300005457 Ga0070662_100123464 Ga0070662_1001234642 326
337 3300005535 Ga0070684_100001666 Ga0070684_1000016665 326
338 3300005543 Ga0070672_100238952 Ga0070672_1002389522 326
339 3300005563 Ga0068855_100327402 Ga0068855_1003274022 326
340 3300005564 Ga0070664_100005472 Ga0070664_1000054725 326
341 3300005577 Ga0068857_100045538 Ga0068857_1000455382 326
342 3300005616 Ga0068852_100025704 Ga0068852_1000257042 326
343 3300005719 Ga0068861_100105179 Ga0068861_1001051792 326
344 3300005834 Ga0068851_10004209 Ga0068851_100042094 326
345 3300005841 Ga0068863_100071479 Ga0068863_1000714793 326
346 3300005842 Ga0068858_100013755 Ga0068858_1000137551 326
347 3300005843 Ga0068860_100045952 Ga0068860_1000459524 326
348 3300006871 Ga0075434_100051521 Ga0075434_1000515212 326
349 3300009094 Ga0111539_10178094 Ga0111539_101780942 326
350 3300009098 Ga0105245_10542423 Ga0105245_105424231 326
351 3300009147 Ga0114129_10008919 Ga0114129_100089196 326
352 3300009147 Ga0114129_10232261 Ga0114129_102322612 326
353 3300010375 Ga0105239_10286268 Ga0105239_102862682 326
354 3300013102 Ga0157371_10126121 Ga0157371_101261212 326
355 3300013306 Ga0163162_10004681 Ga0163162_1000468112 326
356 3300013308 Ga0157375_10075225 Ga0157375_100752252 326
357 3300013308 Ga0157375_10264128 Ga0157375_102641282 326
358 3300014326 Ga0157380_10010623 Ga0157380_100106233 326
359 3300014968 Ga0157379_10020055 Ga0157379_100200555 326
360 3300025907 Ga0207645_10017279 Ga0207645_100172795 326
361 3300025919 Ga0207657_10082108 Ga0207657_100821082 326
362 3300025920 Ga0207649_10021224 Ga0207649_100212242 326
363 3300025927 Ga0207687_10219092 Ga0207687_102190921 326
364 3300025932 Ga0207690_10046007 Ga0207690_100460072 326
365 3300025933 Ga0207706_10002673 Ga0207706_100026731 326
366 3300025938 Ga0207704_10070303 Ga0207704_100703032 326
367 3300025940 Ga0207691_10010521 Ga0207691_100105217 326
368 3300025945 Ga0207679_10002408 Ga0207679_100024085 326
369 3300025949 Ga0207667_10316237 Ga0207667_103162372 326
370 3300025972 Ga0207668_10081861 Ga0207668_100818612 326
371 3300026035 Ga0207703_10086343 Ga0207703_100863432 326
372 3300026116 Ga0207674_10004407 Ga0207674_100044077 326
373 3300026118 Ga0207675_100065402 Ga0207675_1000654022 326
374 3300028380 Ga0268265_10015262 Ga0268265_100152622 326
375 3300045051 Ga0451576_0017428 Ga0451576_0017428_2832_3944 326
376 3300050507 nmdc:mga05p37_193174_c1 nmdc:mga05p37_193174_c1_1019_2131 326
377 3300050507 nmdc:mga05p37_44584_c1 nmdc:mga05p37_44584_c1_2179_3192 326
378 3300050511 nmdc:mga08y16_43973_c1 nmdc:mga08y16_43973_c1_853_1965 326
379 3300050512 nmdc:mga0n895_45010_c1 nmdc:mga0n895_45010_c1_198_1310 326
380 3300005435 Ga0070714_100193318 Ga0070714_1001933182 327
381 3300025929 Ga0207664_10184483 Ga0207664_101844832 327
382 3300049575 Ga0501039_0304595 Ga0501039_0304595_81_1121 327
383 3300005985 Ga0081539_10006596 Ga0081539_100065965 328
384 3300031548 Ga0307408_100007114 Ga0307408_1000071144 328
385 3300031901 Ga0307406_10139051 Ga0307406_101390512 328
386 3300044673 Ga0453683_0000196 Ga0453683_0000196_46058_47071 328
387 3300009147 Ga0114129_10019059 Ga0114129_100190596 329
388 3300014497 Ga0182008_10024090 Ga0182008_100240902 329
389 3300050507 nmdc:mga05p37_9138_c1 nmdc:mga05p37_9138_c1_9201_10235 329
390 3300037471 Ga0395905_0107922 Ga0395905_0107922_190_1401 330
391 3300046691 Ga0495670_0032433 Ga0495670_0032433_521_1648 330
392 3300047447 Ga0495685_009613 Ga0495685_009613_1712_2839 330
393 3300044673 Ga0453683_0014535 Ga0453683_0014535_2259_3281 331
394 3300003320 rootH2_10063003 rootH2_100630032 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

55

220

0.96

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

54

264

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ekp-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.863 1 312
5eke-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.8603 1 312
5eke-assembly1.cif.gz_B structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.8582 1 312
5ekp-assembly1.cif.gz_B structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.858 1 312
5eke-assembly1.cif.gz_C structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.8461 1 312
ID Description Score Start End Superfamily
af_Q2G2T7_1_208_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9364 6 209 3.90.550.10
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9355 6 193 3.90.550.10
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9164 6 193 3.90.550.10
af_P9WMX5_1_216_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9163 5 223 3.90.550.10
af_Q2G2T7_1_208_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9148 6 209 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2N2SBJ6-F1-model_v4 Glycosyltransferase 0.9736 10 189 GO:0005886
GO:0016757
AF-A0A381VHB4-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9656 4 167 GO:0005886
GO:0016757
AF-A0A355UMR9-F1-model_v4 Glycosyltransferase 0.9654 4 199 GO:0005886
GO:0016757
AF-A0A7C4KIH1-F1-model_v4 Glycosyltransferase 0.9634 2 123 GO:0005886
GO:0016757
AF-A0A3M0WV41-F1-model_v4 Glycosyltransferase 0.9614 2 177 GO:0005886
GO:0016757

Feature Viewer

pLDDT pTM Quality
81.8 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map