F432827

General Info

Members Datasets Scaffolds Average Seq Length
394 186 788 250

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100002526|Ga0070700_10000252610
Length 285
Sequence VIGTWGVTLVCRCFLCLNVETPENISMTLRRRDFCAFLASSALSTLTACRLTGSSTILNGGRISARPHQGVKTTATGRIPLGLDSGGRDAILHLPKSESPLPLLVMLHGATQNAEDMFWYLGSAHEEAGVAVLAPNSRDTTWDAIGGSFGPDVDFLNRSLERIFESAAIDPARICVGGFSDGASYAIGLGLLNTDLFTSVAAFSPGFVPEAGAAQADLLASTKPRFFISHGTHDHILPINSCGRRIAQALEGRGYEVTFREFDGDHEIPADVAREGMRWVSTKRS

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
153 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
154 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
166 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
167 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
168 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
169 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
170 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
171 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
172 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
173 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
174 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
175 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
176 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
177 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
178 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
179 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.54
Rhizosphere 96.95
Stem 0
Stem Tuber 0
Unclassified 29.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_100002526 3300005441 Bacteria 9333
2 SwRhRL3b_contig_4461740 2162886006 Bacteria 908
3 SwRhRL2b_contig_1565438 2162886007 Bacteria 3245
4 MRS1b_contig_1870433 2162886011 Bacteria 2399
5 MBSR1b_contig_1833070 2162886012 Bacteria 3821
6 JGI24751J29686_10000007 3300002459 Bacteria 129562
7 rootH2_10166342 3300003320 Bacteria 4275
8 rootL2_10176206 3300003322 Unclassified 1046
9 Ga0065714_10064426 3300005288 Bacteria 186606
10 Ga0065704_10011158 3300005289 Bacteria 2964
11 Ga0065704_10073417 3300005289 Bacteria 7191
12 Ga0065712_10067761 3300005290 Bacteria 50583
13 Ga0065712_10072126 3300005290 Bacteria 4895
14 Ga0065715_10027546 3300005293 Unclassified 2080
15 Ga0065715_10088939 3300005293 Bacteria 22796
16 Ga0065715_10176259 3300005293 Unclassified 1509
17 Ga0065715_10178530 3300005293 Bacteria 1493
18 Ga0065707_10001283 3300005295 Bacteria 8757
19 Ga0065707_10144231 3300005295 Bacteria 1733
20 Ga0070690_100002971 3300005330 Bacteria 9176
21 Ga0070690_100017292 3300005330 Unclassified 4334
22 Ga0070670_100000197 3300005331 Bacteria 55774
23 Ga0070670_100008470 3300005331 Bacteria 8771
24 Ga0070670_100253251 3300005331 Unclassified 1534
25 Ga0070670_100380929 3300005331 Unclassified 1243
26 Ga0068869_100012945 3300005334 Bacteria 5528
27 Ga0068869_100033328 3300005334 Bacteria 3636
28 Ga0068869_100037861 3300005334 Unclassified 3432
29 Ga0068869_100157679 3300005334 Bacteria 1765
30 Ga0068869_100160659 3300005334 Bacteria 1749
31 Ga0070682_100020109 3300005337 Bacteria 3924
32 Ga0070682_100090802 3300005337 Bacteria 1998
33 Ga0070689_100001101 3300005340 Bacteria 16980
34 Ga0070661_100042418 3300005344 Unclassified 3321
35 Ga0070692_10033387 3300005345 Unclassified 2593
36 Ga0070692_10033760 3300005345 Bacteria 2579
37 Ga0070669_100008973 3300005353 Bacteria 7138
38 Ga0070669_100020720 3300005353 Bacteria 4697
39 Ga0070675_100161012 3300005354 Bacteria 1930
40 Ga0070675_100564916 3300005354 Unclassified 1030
41 Ga0070671_100029597 3300005355 Bacteria 4516
42 Ga0070671_100041088 3300005355 Unclassified 3843
43 Ga0070674_100145057 3300005356 Bacteria 1786
44 Ga0070673_100054787 3300005364 Unclassified 3139
45 Ga0070673_100151500 3300005364 Bacteria 1964
46 Ga0070667_100081624 3300005367 Bacteria 2767
47 Ga0070705_100052522 3300005440 Bacteria 2382
48 Ga0070705_100107973 3300005440 Bacteria 1772
49 Ga0070700_100056268 3300005441 Unclassified 2465
50 Ga0070700_100140543 3300005441 Unclassified 1640
51 Ga0070694_100003902 3300005444 Bacteria 8915
52 Ga0070694_100020724 3300005444 Bacteria 4194
53 Ga0070694_100111213 3300005444 Unclassified 1952
54 Ga0070694_100121535 3300005444 Bacteria 1874
55 Ga0070694_100338796 3300005444 Bacteria 1162
56 Ga0070694_100524439 3300005444 Bacteria 945
57 Ga0070708_100336602 3300005445 Bacteria 1422
58 Ga0070663_100093867 3300005455 Bacteria 2227
59 Ga0070662_100066288 3300005457 Unclassified 2649
60 Ga0070662_100078522 3300005457 Unclassified 2452
61 Ga0070681_10027013 3300005458 Bacteria 5771
62 Ga0070681_10030552 3300005458 Bacteria 5405
63 Ga0068867_100024360 3300005459 Bacteria 4336
64 Ga0068867_100025355 3300005459 Bacteria 4254
65 Ga0070685_10022698 3300005466 Unclassified 3425
66 Ga0070706_100000031 3300005467 Bacteria 153504
67 Ga0070706_100179760 3300005467 Bacteria 1975
68 Ga0070706_100421326 3300005467 Unclassified 1242
69 Ga0070707_100264877 3300005468 Unclassified 1672
70 Ga0070707_100381150 3300005468 Bacteria 1370
71 Ga0070698_100098547 3300005471 Bacteria 2896
72 Ga0070698_100120952 3300005471 Unclassified 2578
73 Ga0070698_100218867 3300005471 Unclassified 1838
74 Ga0070699_100081480 3300005518 Unclassified 2821
75 Ga0070679_100726099 3300005530 Unclassified 936
76 Ga0070684_100001013 3300005535 Bacteria 20032
77 Ga0070697_100238603 3300005536 Bacteria 1552
78 Ga0068853_100412324 3300005539 Bacteria 1266
79 Ga0068853_100504422 3300005539 Unclassified 1142
80 Ga0068853_100504688 3300005539 Unclassified 1142
81 Ga0070686_100044055 3300005544 Bacteria 2802
82 Ga0070686_100077657 3300005544 Bacteria 2190
83 Ga0070686_100132641 3300005544 Bacteria 1724
84 Ga0070695_100047738 3300005545 Bacteria 2736
85 Ga0070695_100071426 3300005545 Bacteria 2273
86 Ga0070695_100126077 3300005545 Bacteria 1758
87 Ga0070696_100016044 3300005546 Bacteria 5038
88 Ga0070696_100133158 3300005546 Unclassified 1811
89 Ga0070693_100013547 3300005547 Bacteria 4156
90 Ga0070693_100071148 3300005547 Unclassified 2049
91 Ga0070693_100106269 3300005547 Bacteria 1718
92 Ga0070693_100233200 3300005547 Bacteria 1212
93 Ga0070704_100070092 3300005549 Unclassified 2543
94 Ga0070704_100217368 3300005549 Bacteria 1552
95 Ga0068855_100141484 3300005563 Bacteria 2742
96 Ga0070664_100002610 3300005564 Bacteria 14542
97 Ga0068857_100093994 3300005577 Unclassified 2685
98 Ga0068854_100286233 3300005578 Unclassified 1329
99 Ga0068856_100025652 3300005614 Bacteria 5747
100 Ga0070702_100003518 3300005615 Bacteria 7017
101 Ga0070702_100028503 3300005615 Unclassified 3027
102 Ga0070702_100116203 3300005615 Bacteria 1668
103 Ga0070702_100226419 3300005615 Bacteria 1253
104 Ga0068859_100001572 3300005617 Bacteria 23265
105 Ga0068859_100007582 3300005617 Bacteria 11026
106 Ga0068859_100012569 3300005617 Bacteria 8517
107 Ga0068859_100026576 3300005617 Bacteria 5804
108 Ga0068859_100033892 3300005617 Bacteria 5126
109 Ga0068859_100034553 3300005617 Bacteria 5073
110 Ga0068859_100037272 3300005617 Bacteria 4880
111 Ga0068859_100130887 3300005617 Bacteria 2580
112 Ga0068864_100017445 3300005618 Bacteria 5985
113 Ga0068864_100458606 3300005618 Bacteria 1220
114 Ga0068864_100627789 3300005618 Bacteria 1045
115 Ga0068861_100022641 3300005719 Bacteria 4529
116 Ga0068861_100025710 3300005719 Unclassified 4273
117 Ga0068861_100036039 3300005719 Unclassified 3669
118 Ga0068861_100205693 3300005719 Bacteria 1655
119 Ga0068861_100329830 3300005719 Bacteria 1332
120 Ga0068861_100801470 3300005719 Bacteria 884
121 Ga0068851_10010683 3300005834 Bacteria 4289
122 Ga0068870_10050961 3300005840 Unclassified 2189
123 Ga0068863_100055078 3300005841 Bacteria 3767
124 Ga0068863_100170574 3300005841 Bacteria 2087
125 Ga0068863_100239137 3300005841 Bacteria 1753
126 Ga0068863_100270136 3300005841 Bacteria 1646
127 Ga0068863_100301456 3300005841 Unclassified 1554
128 Ga0068858_100054616 3300005842 Bacteria 3693
129 Ga0068858_100097042 3300005842 Bacteria 2747
130 Ga0068858_100138817 3300005842 Bacteria 2282
131 Ga0068858_100160294 3300005842 Bacteria 2118
132 Ga0068858_100617177 3300005842 Unclassified 1053
133 Ga0068860_100029658 3300005843 Bacteria 5263
134 Ga0068860_100038622 3300005843 Bacteria 4567
135 Ga0068860_100054201 3300005843 Bacteria 3812
136 Ga0068860_100385912 3300005843 Bacteria 1383
137 Ga0068860_100873775 3300005843 Bacteria 914
138 Ga0068860_101183508 3300005843 Unclassified 784
139 Ga0068862_100030235 3300005844 Unclassified 4564
140 Ga0068862_100095038 3300005844 Bacteria 2600
141 Ga0068862_100370331 3300005844 Bacteria 1333
142 Ga0068862_100545972 3300005844 Bacteria 1106
143 Ga0081539_10001952 3300005985 Bacteria 31511
144 Ga0081539_10002213 3300005985 Bacteria 28360
145 Ga0081539_10025261 3300005985 Bacteria 3832
146 Ga0070716_100012152 3300006173 Bacteria 4357
147 Ga0097621_100196623 3300006237 Bacteria 1749
148 Ga0068871_100025780 3300006358 Bacteria 4579
149 Ga0075428_100203998 3300006844 Unclassified 2137
150 Ga0075430_100235819 3300006846 Unclassified 1516
151 Ga0075431_100053198 3300006847 Unclassified 4174
152 Ga0075433_10033881 3300006852 Unclassified 4381
153 Ga0075433_10055369 3300006852 Bacteria 3462
154 Ga0075433_10072505 3300006852 Bacteria 3028
155 Ga0075433_10075098 3300006852 Bacteria 2974
156 Ga0075433_10109009 3300006852 Unclassified 2456
157 Ga0075433_10207622 3300006852 Bacteria 1741
158 Ga0075433_10270086 3300006852 Unclassified 1507
159 Ga0075434_100046061 3300006871 Unclassified 4328
160 Ga0075434_100378387 3300006871 Unclassified 1436
161 Ga0075429_100143554 3300006880 Bacteria 2089
162 Ga0068865_100574902 3300006881 Bacteria 949
163 Ga0075436_100009648 3300006914 Bacteria 6606
164 Ga0075436_100540605 3300006914 Unclassified 855
165 Ga0097620_100001572 3300006931 Bacteria 23265
166 Ga0097620_100007581 3300006931 Bacteria 11026
167 Ga0097620_100012569 3300006931 Bacteria 8517
168 Ga0097620_100026577 3300006931 Bacteria 5804
169 Ga0097620_100033890 3300006931 Bacteria 5126
170 Ga0097620_100034551 3300006931 Bacteria 5073
171 Ga0097620_100037270 3300006931 Bacteria 4880
172 Ga0097620_100130893 3300006931 Bacteria 2580
173 Ga0075435_100013129 3300007076 Bacteria 6153
174 Ga0075435_100178896 3300007076 Unclassified 1792
175 Ga0111539_10003553 3300009094 Bacteria 20560
176 Ga0111539_10035934 3300009094 Bacteria 5997
177 Ga0111539_10056957 3300009094 Bacteria 4643
178 Ga0111539_10201058 3300009094 Bacteria 2324
179 Ga0111539_10342471 3300009094 Bacteria 1740
180 Ga0105245_10213704 3300009098 Unclassified 1858
181 Ga0105247_10001999 3300009101 Bacteria 14129
182 Ga0105247_10198939 3300009101 Unclassified 1345
183 Ga0114129_10035712 3300009147 Bacteria 7021
184 Ga0114129_10070734 3300009147 Unclassified 4865
185 Ga0114129_10081569 3300009147 Bacteria 4496
186 Ga0114129_10088722 3300009147 Bacteria 4287
187 Ga0114129_10346395 3300009147 Unclassified 1969
188 Ga0114129_10630698 3300009147 Unclassified 1385
189 Ga0105243_10004567 3300009148 Bacteria 10934
190 Ga0105243_10144392 3300009148 Unclassified 2034
191 Ga0105243_10337622 3300009148 Bacteria 1379
192 Ga0105241_10014636 3300009174 Bacteria 5744
193 Ga0105241_10064496 3300009174 Bacteria 2828
194 Ga0105242_10358323 3300009176 Unclassified 1349
195 Ga0105242_10392258 3300009176 Bacteria 1293
196 Ga0105248_10007857 3300009177 Bacteria 11716
197 Ga0105248_10084150 3300009177 Bacteria 3578
198 Ga0105237_10002177 3300009545 Bacteria 24586
199 Ga0105237_10065845 3300009545 Bacteria 3618
200 Ga0105237_10433345 3300009545 Unclassified 1320
201 Ga0105237_10993075 3300009545 Bacteria 846
202 Ga0105238_10013304 3300009551 Bacteria 8301
203 Ga0105238_10025531 3300009551 Bacteria 6024
204 Ga0105238_10792946 3300009551 Bacteria 963
205 Ga0105249_10016066 3300009553 Bacteria 6635
206 Ga0105249_10035339 3300009553 Bacteria 4533
207 Ga0105239_10094220 3300010375 Bacteria 3307
208 Ga0105239_10388887 3300010375 Bacteria 1578
209 Ga0105239_10618189 3300010375 Bacteria 1236
210 Ga0105239_10864392 3300010375 Unclassified 1037
211 Ga0105246_10057831 3300011119 Unclassified 2685
212 Ga0105246_10101935 3300011119 Bacteria 2092
213 Ga0105246_10750320 3300011119 Unclassified 861
214 Ga0157373_10037049 3300013100 Bacteria 3499
215 Ga0157373_10363974 3300013100 Unclassified 1033
216 Ga0157374_10038350 3300013296 Bacteria 4404
217 Ga0157378_10047578 3300013297 Bacteria 3813
218 Ga0157378_10159018 3300013297 Bacteria 2112
219 Ga0157378_10447249 3300013297 Bacteria 1282
220 Ga0163162_10053489 3300013306 Bacteria 4058
221 Ga0163162_10200646 3300013306 Unclassified 2123
222 Ga0163162_10421672 3300013306 Bacteria 1467
223 Ga0163162_10672320 3300013306 Unclassified 1158
224 Ga0157372_10007212 3300013307 Bacteria 11837
225 Ga0157372_10061558 3300013307 Bacteria 4203
226 Ga0157372_10346080 3300013307 Bacteria 1732
227 Ga0157375_10111034 3300013308 Bacteria 2840
228 Ga0157375_10407911 3300013308 Unclassified 1525
229 Ga0157375_10711510 3300013308 Bacteria 1157
230 Ga0163163_10000238 3300014325 Bacteria 56166
231 Ga0157380_10001046 3300014326 Bacteria 17695
232 Ga0157379_10114295 3300014968 Unclassified 2426
233 Ga0157379_10125671 3300014968 Unclassified 2308
234 Ga0207656_10022573 3300025321 Bacteria 2526
235 Ga0207653_10022790 3300025885 Unclassified 1992
236 Ga0207710_10001050 3300025900 Bacteria 14265
237 Ga0207647_10000577 3300025904 Bacteria 28647
238 Ga0207647_10047170 3300025904 Unclassified 2681
239 Ga0207643_10005015 3300025908 Bacteria 7090
240 Ga0207643_10173401 3300025908 Unclassified 1303
241 Ga0207684_10165197 3300025910 Bacteria 1907
242 Ga0207654_10111767 3300025911 Bacteria 1701
243 Ga0207654_10190798 3300025911 Bacteria 1343
244 Ga0207671_10001273 3300025914 Bacteria 29705
245 Ga0207671_10114439 3300025914 Unclassified 2056
246 Ga0207660_10308754 3300025917 Bacteria 1261
247 Ga0207662_10007178 3300025918 Bacteria 6061
248 Ga0207662_10096131 3300025918 Unclassified 1829
249 Ga0207649_10079296 3300025920 Bacteria 2121
250 Ga0207652_10547061 3300025921 Bacteria 1041
251 Ga0207646_10363541 3300025922 Bacteria 1307
252 Ga0207681_10029571 3300025923 Bacteria 3561
253 Ga0207694_10001169 3300025924 Bacteria 22734
254 Ga0207694_10071945 3300025924 Bacteria 2703
255 Ga0207650_10000009 3300025925 Bacteria 483583
256 Ga0207650_10052724 3300025925 Bacteria 3013
257 Ga0207650_10166615 3300025925 Unclassified 1749
258 Ga0207650_10187908 3300025925 Unclassified 1649
259 Ga0207650_10428113 3300025925 Bacteria 1099
260 Ga0207650_10504401 3300025925 Unclassified 1011
261 Ga0207644_10014442 3300025931 Bacteria 5282
262 Ga0207706_10098564 3300025933 Bacteria 2571
263 Ga0207706_10171739 3300025933 Unclassified 1905
264 Ga0207706_10604230 3300025933 Unclassified 942
265 Ga0207709_10047285 3300025935 Unclassified 2615
266 Ga0207670_10003705 3300025936 Bacteria 8107
267 Ga0207670_10457366 3300025936 Unclassified 1030
268 Ga0207669_10115344 3300025937 Bacteria 1810
269 Ga0207704_10278329 3300025938 Bacteria 1271
270 Ga0207704_10733319 3300025938 Unclassified 820
271 Ga0207665_10144069 3300025939 Unclassified 1702
272 Ga0207711_10013926 3300025941 Bacteria 6678
273 Ga0207711_10032141 3300025941 Bacteria 4437
274 Ga0207711_10152906 3300025941 Unclassified 2083
275 Ga0207711_10162664 3300025941 Unclassified 2021
276 Ga0207689_10043981 3300025942 Bacteria 3692
277 Ga0207689_10114422 3300025942 Bacteria 2217
278 Ga0207689_10256075 3300025942 Bacteria 1448
279 Ga0207689_10542488 3300025942 Unclassified 976
280 Ga0207679_10014275 3300025945 Bacteria 5217
281 Ga0207667_10172774 3300025949 Bacteria 2221
282 Ga0207712_10018612 3300025961 Bacteria 4527
283 Ga0207712_10044244 3300025961 Bacteria 3076
284 Ga0207640_10058177 3300025981 Unclassified 2546
285 Ga0207677_10479456 3300026023 Bacteria 1071
286 Ga0207703_10100038 3300026035 Bacteria 2456
287 Ga0207703_10102291 3300026035 Unclassified 2431
288 Ga0207703_10888155 3300026035 Unclassified 853
289 Ga0207639_10353299 3300026041 Bacteria 1313
290 Ga0207639_10497410 3300026041 Unclassified 1113
291 Ga0207639_10849582 3300026041 Unclassified 852
292 Ga0207708_10005474 3300026075 Bacteria 9368
293 Ga0207708_10005819 3300026075 Bacteria 9120
294 Ga0207708_10084278 3300026075 Bacteria 2444
295 Ga0207708_10085300 3300026075 Bacteria 2429
296 Ga0207708_10301490 3300026075 Unclassified 1303
297 Ga0207708_10338926 3300026075 Unclassified 1231
298 Ga0207641_10012612 3300026088 Bacteria 6931
299 Ga0207641_10100100 3300026088 Bacteria 2552
300 Ga0207641_10223890 3300026088 Bacteria 1746
301 Ga0207641_10339203 3300026088 Unclassified 1430
302 Ga0207648_10012075 3300026089 Bacteria 8101
303 Ga0207648_10068986 3300026089 Bacteria 3081
304 Ga0207648_10125672 3300026089 Bacteria 2256
305 Ga0207676_10043953 3300026095 Bacteria 3443
306 Ga0207676_10404061 3300026095 Bacteria 1277
307 Ga0207676_10413989 3300026095 Unclassified 1263
308 Ga0207674_10035970 3300026116 Bacteria 5165
309 Ga0207674_10090764 3300026116 Bacteria 3046
310 Ga0207674_10121462 3300026116 Bacteria 2580
311 Ga0207674_10201839 3300026116 Bacteria 1938
312 Ga0207674_10740651 3300026116 Unclassified 949
313 Ga0207675_100046001 3300026118 Bacteria 4077
314 Ga0207675_100060439 3300026118 Unclassified 3538
315 Ga0207675_100072656 3300026118 Unclassified 3218
316 Ga0207675_100214854 3300026118 Bacteria 1851
317 Ga0207675_100376966 3300026118 Bacteria 1394
318 Ga0207675_100569321 3300026118 Bacteria 1133
319 Ga0207428_10010707 3300027907 Bacteria 8178
320 Ga0207428_10104923 3300027907 Bacteria 2180
321 Ga0268265_10043354 3300028380 Unclassified 3344
322 Ga0268265_10059937 3300028380 Bacteria 2915
323 Ga0268265_10128964 3300028380 Bacteria 2098
324 Ga0268265_10168944 3300028380 Bacteria 1867
325 Ga0268264_10008555 3300028381 Bacteria 8507
326 Ga0268264_10075009 3300028381 Bacteria 2875
327 Ga0268264_10166818 3300028381 Bacteria 1988
328 Ga0268264_10232271 3300028381 Bacteria 1704
329 Ga0268264_10279779 3300028381 Bacteria 1562
330 Ga0268264_10394345 3300028381 Bacteria 1329
331 Ga0307413_10093448 3300031824 Bacteria 1966
332 Ga0307412_10103699 3300031911 Bacteria 2016
333 Ga0307409_100170402 3300031995 Bacteria 1916
334 Ga0307416_100084353 3300032002 Unclassified 2699
335 Ga0307416_100741429 3300032002 Bacteria 1074
336 Ga0307415_100146979 3300032126 Bacteria 1809
337 Ga0373951_0002649 3300035091 Bacteria 4491
338 Ga0373932_0022703 3300035112 Bacteria 1670
339 Ga0373942_0006258 3300035207 Unclassified 2746
340 Ga0373931_0344068 3300035691 Bacteria 932
341 Ga0395898_0108992 3300037466 Bacteria 2655
342 Ga0242420_003330 3300038996 Bacteria 2369
343 Ga0439448_0042811 3300042005 Unclassified 1469
344 Ga0439455_0033674 3300042012 Unclassified 1286
345 Ga0439458_0009672 3300042157 Unclassified 2148
346 Ga0439435_0099912 3300042436 Bacteria 891
347 Ga0451576_0381362 3300045051 Bacteria 1478
348 Ga0495672_0197854 3300047320 Unclassified 1007
349 Ga0496104_0003194 3300048907 Bacteria 14091
350 Ga0496104_0150682 3300048907 Bacteria 2233
351 Ga0496104_0869394 3300048907 Unclassified 807
352 Ga0496105_0017232 3300048908 Bacteria 5787
353 Ga0496106_0032310 3300048909 Unclassified 3902
354 Ga0496109_0003016 3300048912 Bacteria 14051
355 Ga0496110_0011643 3300048913 Bacteria 7212
356 Ga0496111_0012248 3300048914 Bacteria 5802
357 Ga0496112_0007913 3300048915 Bacteria 9469
358 Ga0496113_0452694 3300048916 Unclassified 1031
359 Ga0501292_021352 3300049515 Bacteria 1048
360 Ga0501198_002734 3300049649 Bacteria 2388
361 Ga0501202_001734 3300049652 Unclassified 3547
362 Ga0501207_002502 3300049654 Unclassified 2380
363 Ga0501217_002437 3300049661 Unclassified 3664
364 Ga0501223_003753 3300049663 Unclassified 3282
365 Ga0501224_007779 3300049664 Bacteria 1560
366 Ga0501235_006249 3300049669 Bacteria 2595
367 Ga0501240_001670 3300049673 Bacteria 2213
368 Ga0501242_005719 3300049674 Bacteria 1406
369 Ga0501243_003863 3300049675 Bacteria 2235
370 Ga0501256_009187 3300049685 Bacteria 930
371 Ga0501221_015999 3300049704 Bacteria 1414
372 Ga0501225_0008091 3300049705 Unclassified 3025
373 Ga0501225_0012780 3300049705 Bacteria 2355
374 Ga0501226_002121 3300049853 Unclassified 2462
375 nmdc:mga05p37_103543_c1 3300050507 Unclassified 3503
376 nmdc:mga05p37_235225_c1 3300050507 Bacteria 2205
377 nmdc:mga05p37_242350_c1 3300050507 Archaea 2167
378 nmdc:mga05p37_273478_c1 3300050507 Bacteria 2017
379 nmdc:mga09592_259073_c1 3300050508 Bacteria 1508
380 nmdc:mga08y16_137273_c1 3300050511 Unclassified 2542
381 nmdc:mga08y16_209305_c1 3300050511 Bacteria 2020
382 nmdc:mga08y16_2757_c1 3300050511 Bacteria 17999
383 nmdc:mga08y16_98898_c1 3300050511 Bacteria 3038
384 nmdc:mga0n895_175669_c1 3300050512 Bacteria 2172
385 nmdc:mga0n895_956695_c1 3300050512 Unclassified 839
386 nmdc:mga0n895_99415_c1 3300050512 Bacteria 2917
387 nmdc:mga0rr50_229366_c1 3300050513 Unclassified 1536
388 nmdc:mga0a205_122811_c1 3300050515 Bacteria 2496
389 nmdc:mga0a205_16962_c1 3300050515 Bacteria 6817
390 nmdc:mga0a205_292386_c1 3300050515 Bacteria 1503
391 nmdc:mga0a205_33707_c2 3300050515 Bacteria 3915
392 nmdc:mga0a205_345132_c1 3300050515 Bacteria 1357
393 nmdc:mga0a205_530456_c1 3300050515 Bacteria 1033
394 Ga0530510_0064221 3300061734 Bacteria 2659
395 Ga0070700_100002526
396 SwRhRL3b_contig_4461740
397 SwRhRL2b_contig_1565438
398 MRS1b_contig_1870433
399 MBSR1b_contig_1833070
400 JGI24751J29686_10000007
401 rootH2_10166342
402 rootL2_10176206
403 Ga0065714_10064426
404 Ga0065704_10011158
405 Ga0065704_10073417
406 Ga0065712_10067761
407 Ga0065712_10072126
408 Ga0065715_10027546
409 Ga0065715_10088939
410 Ga0065715_10176259
411 Ga0065715_10178530
412 Ga0065707_10001283
413 Ga0065707_10144231
414 Ga0070690_100002971
415 Ga0070690_100017292
416 Ga0070670_100000197
417 Ga0070670_100008470
418 Ga0070670_100253251
419 Ga0070670_100380929
420 Ga0068869_100012945
421 Ga0068869_100033328
422 Ga0068869_100037861
423 Ga0068869_100157679
424 Ga0068869_100160659
425 Ga0070682_100020109
426 Ga0070682_100090802
427 Ga0070689_100001101
428 Ga0070661_100042418
429 Ga0070692_10033387
430 Ga0070692_10033760
431 Ga0070669_100008973
432 Ga0070669_100020720
433 Ga0070675_100161012
434 Ga0070675_100564916
435 Ga0070671_100029597
436 Ga0070671_100041088
437 Ga0070674_100145057
438 Ga0070673_100054787
439 Ga0070673_100151500
440 Ga0070667_100081624
441 Ga0070705_100052522
442 Ga0070705_100107973
443 Ga0070700_100056268
444 Ga0070700_100140543
445 Ga0070694_100003902
446 Ga0070694_100020724
447 Ga0070694_100111213
448 Ga0070694_100121535
449 Ga0070694_100338796
450 Ga0070694_100524439
451 Ga0070708_100336602
452 Ga0070663_100093867
453 Ga0070662_100066288
454 Ga0070662_100078522
455 Ga0070681_10027013
456 Ga0070681_10030552
457 Ga0068867_100024360
458 Ga0068867_100025355
459 Ga0070685_10022698
460 Ga0070706_100000031
461 Ga0070706_100179760
462 Ga0070706_100421326
463 Ga0070707_100264877
464 Ga0070707_100381150
465 Ga0070698_100098547
466 Ga0070698_100120952
467 Ga0070698_100218867
468 Ga0070699_100081480
469 Ga0070679_100726099
470 Ga0070684_100001013
471 Ga0070697_100238603
472 Ga0068853_100412324
473 Ga0068853_100504422
474 Ga0068853_100504688
475 Ga0070686_100044055
476 Ga0070686_100077657
477 Ga0070686_100132641
478 Ga0070695_100047738
479 Ga0070695_100071426
480 Ga0070695_100126077
481 Ga0070696_100016044
482 Ga0070696_100133158
483 Ga0070693_100013547
484 Ga0070693_100071148
485 Ga0070693_100106269
486 Ga0070693_100233200
487 Ga0070704_100070092
488 Ga0070704_100217368
489 Ga0068855_100141484
490 Ga0070664_100002610
491 Ga0068857_100093994
492 Ga0068854_100286233
493 Ga0068856_100025652
494 Ga0070702_100003518
495 Ga0070702_100028503
496 Ga0070702_100116203
497 Ga0070702_100226419
498 Ga0068859_100001572
499 Ga0068859_100007582
500 Ga0068859_100012569
501 Ga0068859_100026576
502 Ga0068859_100033892
503 Ga0068859_100034553
504 Ga0068859_100037272
505 Ga0068859_100130887
506 Ga0068864_100017445
507 Ga0068864_100458606
508 Ga0068864_100627789
509 Ga0068861_100022641
510 Ga0068861_100025710
511 Ga0068861_100036039
512 Ga0068861_100205693
513 Ga0068861_100329830
514 Ga0068861_100801470
515 Ga0068851_10010683
516 Ga0068870_10050961
517 Ga0068863_100055078
518 Ga0068863_100170574
519 Ga0068863_100239137
520 Ga0068863_100270136
521 Ga0068863_100301456
522 Ga0068858_100054616
523 Ga0068858_100097042
524 Ga0068858_100138817
525 Ga0068858_100160294
526 Ga0068858_100617177
527 Ga0068860_100029658
528 Ga0068860_100038622
529 Ga0068860_100054201
530 Ga0068860_100385912
531 Ga0068860_100873775
532 Ga0068860_101183508
533 Ga0068862_100030235
534 Ga0068862_100095038
535 Ga0068862_100370331
536 Ga0068862_100545972
537 Ga0081539_10001952
538 Ga0081539_10002213
539 Ga0081539_10025261
540 Ga0070716_100012152
541 Ga0097621_100196623
542 Ga0068871_100025780
543 Ga0075428_100203998
544 Ga0075430_100235819
545 Ga0075431_100053198
546 Ga0075433_10033881
547 Ga0075433_10055369
548 Ga0075433_10072505
549 Ga0075433_10075098
550 Ga0075433_10109009
551 Ga0075433_10207622
552 Ga0075433_10270086
553 Ga0075434_100046061
554 Ga0075434_100378387
555 Ga0075429_100143554
556 Ga0068865_100574902
557 Ga0075436_100009648
558 Ga0075436_100540605
559 Ga0097620_100001572
560 Ga0097620_100007581
561 Ga0097620_100012569
562 Ga0097620_100026577
563 Ga0097620_100033890
564 Ga0097620_100034551
565 Ga0097620_100037270
566 Ga0097620_100130893
567 Ga0075435_100013129
568 Ga0075435_100178896
569 Ga0111539_10003553
570 Ga0111539_10035934
571 Ga0111539_10056957
572 Ga0111539_10201058
573 Ga0111539_10342471
574 Ga0105245_10213704
575 Ga0105247_10001999
576 Ga0105247_10198939
577 Ga0114129_10035712
578 Ga0114129_10070734
579 Ga0114129_10081569
580 Ga0114129_10088722
581 Ga0114129_10346395
582 Ga0114129_10630698
583 Ga0105243_10004567
584 Ga0105243_10144392
585 Ga0105243_10337622
586 Ga0105241_10014636
587 Ga0105241_10064496
588 Ga0105242_10358323
589 Ga0105242_10392258
590 Ga0105248_10007857
591 Ga0105248_10084150
592 Ga0105237_10002177
593 Ga0105237_10065845
594 Ga0105237_10433345
595 Ga0105237_10993075
596 Ga0105238_10013304
597 Ga0105238_10025531
598 Ga0105238_10792946
599 Ga0105249_10016066
600 Ga0105249_10035339
601 Ga0105239_10094220
602 Ga0105239_10388887
603 Ga0105239_10618189
604 Ga0105239_10864392
605 Ga0105246_10057831
606 Ga0105246_10101935
607 Ga0105246_10750320
608 Ga0157373_10037049
609 Ga0157373_10363974
610 Ga0157374_10038350
611 Ga0157378_10047578
612 Ga0157378_10159018
613 Ga0157378_10447249
614 Ga0163162_10053489
615 Ga0163162_10200646
616 Ga0163162_10421672
617 Ga0163162_10672320
618 Ga0157372_10007212
619 Ga0157372_10061558
620 Ga0157372_10346080
621 Ga0157375_10111034
622 Ga0157375_10407911
623 Ga0157375_10711510
624 Ga0163163_10000238
625 Ga0157380_10001046
626 Ga0157379_10114295
627 Ga0157379_10125671
628 Ga0207656_10022573
629 Ga0207653_10022790
630 Ga0207710_10001050
631 Ga0207647_10000577
632 Ga0207647_10047170
633 Ga0207643_10005015
634 Ga0207643_10173401
635 Ga0207684_10165197
636 Ga0207654_10111767
637 Ga0207654_10190798
638 Ga0207671_10001273
639 Ga0207671_10114439
640 Ga0207660_10308754
641 Ga0207662_10007178
642 Ga0207662_10096131
643 Ga0207649_10079296
644 Ga0207652_10547061
645 Ga0207646_10363541
646 Ga0207681_10029571
647 Ga0207694_10001169
648 Ga0207694_10071945
649 Ga0207650_10000009
650 Ga0207650_10052724
651 Ga0207650_10166615
652 Ga0207650_10187908
653 Ga0207650_10428113
654 Ga0207650_10504401
655 Ga0207644_10014442
656 Ga0207706_10098564
657 Ga0207706_10171739
658 Ga0207706_10604230
659 Ga0207709_10047285
660 Ga0207670_10003705
661 Ga0207670_10457366
662 Ga0207669_10115344
663 Ga0207704_10278329
664 Ga0207704_10733319
665 Ga0207665_10144069
666 Ga0207711_10013926
667 Ga0207711_10032141
668 Ga0207711_10152906
669 Ga0207711_10162664
670 Ga0207689_10043981
671 Ga0207689_10114422
672 Ga0207689_10256075
673 Ga0207689_10542488
674 Ga0207679_10014275
675 Ga0207667_10172774
676 Ga0207712_10018612
677 Ga0207712_10044244
678 Ga0207640_10058177
679 Ga0207677_10479456
680 Ga0207703_10100038
681 Ga0207703_10102291
682 Ga0207703_10888155
683 Ga0207639_10353299
684 Ga0207639_10497410
685 Ga0207639_10849582
686 Ga0207708_10005474
687 Ga0207708_10005819
688 Ga0207708_10084278
689 Ga0207708_10085300
690 Ga0207708_10301490
691 Ga0207708_10338926
692 Ga0207641_10012612
693 Ga0207641_10100100
694 Ga0207641_10223890
695 Ga0207641_10339203
696 Ga0207648_10012075
697 Ga0207648_10068986
698 Ga0207648_10125672
699 Ga0207676_10043953
700 Ga0207676_10404061
701 Ga0207676_10413989
702 Ga0207674_10035970
703 Ga0207674_10090764
704 Ga0207674_10121462
705 Ga0207674_10201839
706 Ga0207674_10740651
707 Ga0207675_100046001
708 Ga0207675_100060439
709 Ga0207675_100072656
710 Ga0207675_100214854
711 Ga0207675_100376966
712 Ga0207675_100569321
713 Ga0207428_10010707
714 Ga0207428_10104923
715 Ga0268265_10043354
716 Ga0268265_10059937
717 Ga0268265_10128964
718 Ga0268265_10168944
719 Ga0268264_10008555
720 Ga0268264_10075009
721 Ga0268264_10166818
722 Ga0268264_10232271
723 Ga0268264_10279779
724 Ga0268264_10394345
725 Ga0307413_10093448
726 Ga0307412_10103699
727 Ga0307409_100170402
728 Ga0307416_100084353
729 Ga0307416_100741429
730 Ga0307415_100146979
731 Ga0373951_0002649
732 Ga0373932_0022703
733 Ga0373942_0006258
734 Ga0373931_0344068
735 Ga0395898_0108992
736 Ga0242420_003330
737 Ga0439448_0042811
738 Ga0439455_0033674
739 Ga0439458_0009672
740 Ga0439435_0099912
741 Ga0451576_0381362
742 Ga0495672_0197854
743 Ga0496104_0003194
744 Ga0496104_0150682
745 Ga0496104_0869394
746 Ga0496105_0017232
747 Ga0496106_0032310
748 Ga0496109_0003016
749 Ga0496110_0011643
750 Ga0496111_0012248
751 Ga0496112_0007913
752 Ga0496113_0452694
753 Ga0501292_021352
754 Ga0501198_002734
755 Ga0501202_001734
756 Ga0501207_002502
757 Ga0501217_002437
758 Ga0501223_003753
759 Ga0501224_007779
760 Ga0501235_006249
761 Ga0501240_001670
762 Ga0501242_005719
763 Ga0501243_003863
764 Ga0501256_009187
765 Ga0501221_015999
766 Ga0501225_0008091
767 Ga0501225_0012780
768 Ga0501226_002121
769 nmdc:mga05p37_103543_c1
770 nmdc:mga05p37_235225_c1
771 nmdc:mga05p37_242350_c1
772 nmdc:mga05p37_273478_c1
773 nmdc:mga09592_259073_c1
774 nmdc:mga08y16_137273_c1
775 nmdc:mga08y16_209305_c1
776 nmdc:mga08y16_2757_c1
777 nmdc:mga08y16_98898_c1
778 nmdc:mga0n895_175669_c1
779 nmdc:mga0n895_956695_c1
780 nmdc:mga0n895_99415_c1
781 nmdc:mga0rr50_229366_c1
782 nmdc:mga0a205_122811_c1
783 nmdc:mga0a205_16962_c1
784 nmdc:mga0a205_292386_c1
785 nmdc:mga0a205_33707_c2
786 nmdc:mga0a205_345132_c1
787 nmdc:mga0a205_530456_c1
788 Ga0530510_0064221

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02230

Abhydrolase_2

Phospholipase/Carboxylesterase

155

281

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.8097 57 238
8daj-assembly1.cif.gz_A structure and biochemistry of a promiscuous thermophilic polyhydroxybutyrate depolymerase from lihuaxuella thermophilia 0.805 44 210
7l0a-assembly1.cif.gz_B crystal structure of s-formylglutathione hydrolase (frmb) from staphylococcus aureus, apoenzyme 0.7864 57 242
1aur-assembly1.cif.gz_B pmsf-inhibited carboxylesterase from pseudomonas fluorescens 0.786 57 242
7ym9-assembly2.cif.gz_B crystal structure of a pet hydrolase from cryptosporangium aurantiacum 0.786 58 240
ID Description Score Start End Superfamily
af_D4A328_4_184_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8749 144 238 3.40.50.1820
3wydB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8097 57 238 3.40.50.1820
af_Q2FUY3_1_252_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7987 47 242 3.40.50.1820
af_E9AH91_59_277_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7882 68 242 3.40.50.1820
af_Q54T49_3_226_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7858 57 242 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7C1PCJ7-F1-model_v4 Phospholipase 0.9873 138 242 GO:0016787
AF-A0A6J4RCI1-F1-model_v4 Serine esterase, putative 0.9872 145 242
AF-A0A2V5M4C8-F1-model_v4 Phospholipase 0.982 138 242 GO:0016787
AF-A0A6J4S572-F1-model_v4 Serine esterase, putative 0.9764 74 242
AF-A0A7X5WIJ1-F1-model_v4 deleted 0.9735 98 242

Map