F432793

General Info

Members Datasets Scaffolds Average Seq Length
394 172 732 335

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10002660|Ga0065712_100026602
Length 381
Sequence MGRIVRIIIAGFMLVGLASGSSVWAQSLDELHKAAAKEGALNFYATLAQINAEIVLPTFEKRFPGIKINHVDATSDKLVARAVSEARGGKTLADVLQVPLENVLQVHDQGLLLDASFPEAAAYPEGLKGSFWVASDLQYFIAAWNTSLVKKEEEPKSYDDFTQPRWKNRLIAEPRDLEMLLAFAKYRFKSDEKAIEYWKKVAANNVEFHKGHSQLAELLVAGXAAACLTCYSHHYPIRVKKGAPVNYLLSEGVASINGTAIFKNSPHPNAALLYARWVASQEGQKAMAQGGRNPAHPKVDPTDKTKTEKTYFYHGGRFERVPQVREDLEGDLQAALKIVRFRSCLYKGEVWRHSQSLAAPAPLCRRFAIPRYSYRWSARAF

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.52
Rhizosphere 98.48
Stem 0
Stem Tuber 0
Unclassified 24.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10002660 3300005290 Bacteria 6187
2 Ga0065712_10079824 3300005290 Unclassified 3159
3 Ga0065712_10080621 3300005290 Bacteria 3087
4 Ga0065712_10098411 3300005290 Bacteria 2120
5 Ga0065715_10005730 3300005293 Bacteria 4194
6 Ga0065715_10103304 3300005293 Bacteria 3043
7 Ga0065715_10113112 3300005293 Bacteria 2503
8 Ga0065707_10001720 3300005295 Bacteria 12087
9 Ga0065707_10120333 3300005295 Bacteria 2137
10 Ga0065707_10239890 3300005295 Unclassified 1159
11 Ga0070658_10111424 3300005327 Bacteria 2268
12 Ga0070676_10015933 3300005328 Bacteria 4148
13 Ga0070690_100130887 3300005330 Unclassified 1694
14 Ga0070670_100023386 3300005331 Bacteria 5319
15 Ga0070670_100111956 3300005331 Unclassified 2352
16 Ga0070666_10109011 3300005335 Bacteria 1913
17 Ga0070666_10115710 3300005335 Unclassified 1857
18 Ga0070680_100017497 3300005336 Bacteria 5652
19 Ga0070680_100051191 3300005336 Unclassified 3369
20 Ga0068868_100021932 3300005338 Bacteria 4814
21 Ga0070660_100045571 3300005339 Bacteria 3358
22 Ga0070689_100124548 3300005340 Unclassified 2061
23 Ga0070691_10029529 3300005341 Unclassified 2565
24 Ga0070661_100007916 3300005344 Bacteria 7340
25 Ga0070661_100016995 3300005344 Bacteria 5153
26 Ga0070661_100101234 3300005344 Bacteria 2143
27 Ga0070692_10037779 3300005345 Bacteria 2457
28 Ga0070668_100032283 3300005347 Unclassified 3985
29 Ga0070669_100003408 3300005353 Bacteria 11442
30 Ga0070669_100037226 3300005353 Bacteria 3529
31 Ga0070675_100012664 3300005354 Bacteria 6616
32 Ga0070671_100018158 3300005355 Bacteria 5711
33 Ga0070671_100063764 3300005355 Unclassified 3069
34 Ga0070671_100090308 3300005355 Bacteria 2564
35 Ga0070674_100023604 3300005356 Unclassified 3982
36 Ga0070674_100027670 3300005356 Unclassified 3717
37 Ga0070674_100298015 3300005356 Unclassified 1284
38 Ga0070673_100015451 3300005364 Bacteria 5362
39 Ga0070673_100100038 3300005364 Bacteria 2386
40 Ga0070659_100203456 3300005366 Bacteria 1630
41 Ga0070667_100006273 3300005367 Bacteria 9883
42 Ga0070667_100038290 3300005367 Bacteria 4020
43 Ga0070694_100027753 3300005444 Bacteria 3680
44 Ga0070694_100222751 3300005444 Bacteria 1415
45 Ga0070663_100112503 3300005455 Bacteria 2047
46 Ga0070663_100409035 3300005455 Unclassified 1111
47 Ga0070678_100036566 3300005456 Bacteria 3439
48 Ga0070678_100081201 3300005456 Bacteria 2457
49 Ga0070662_100011251 3300005457 Bacteria 5899
50 Ga0070662_100125984 3300005457 Bacteria 1969
51 Ga0070662_100209713 3300005457 Bacteria 1550
52 Ga0070662_100245894 3300005457 Unclassified 1436
53 Ga0070681_10235389 3300005458 Bacteria 1745
54 Ga0070685_10047614 3300005466 Bacteria 2466
55 Ga0070679_100063846 3300005530 Bacteria 3670
56 Ga0070697_100075366 3300005536 Bacteria 2773
57 Ga0070697_100111221 3300005536 Unclassified 2283
58 Ga0068853_100128159 3300005539 Bacteria 2269
59 Ga0070672_100027305 3300005543 Bacteria 4256
60 Ga0070672_100149173 3300005543 Bacteria 1933
61 Ga0070695_100010539 3300005545 Bacteria 5520
62 Ga0070695_100013182 3300005545 Bacteria 4966
63 Ga0070695_100018722 3300005545 Bacteria 4207
64 Ga0070696_100046064 3300005546 Bacteria 3023
65 Ga0070696_100073741 3300005546 Unclassified 2405
66 Ga0070696_100203058 3300005546 Bacteria 1481
67 Ga0070704_100126942 3300005549 Bacteria 1970
68 Ga0068855_100020698 3300005563 Bacteria 7888
69 Ga0068855_100154856 3300005563 Bacteria 2604
70 Ga0068855_100247703 3300005563 Unclassified 1988
71 Ga0070664_100005233 3300005564 Bacteria 10409
72 Ga0070664_100012373 3300005564 Bacteria 6935
73 Ga0068856_100049161 3300005614 Unclassified 4156
74 Ga0068856_100053078 3300005614 Bacteria 3998
75 Ga0068856_100383569 3300005614 Bacteria 1425
76 Ga0068862_100454655 3300005844 Bacteria 1208
77 Ga0081455_10042556 3300005937 Bacteria 3982
78 Ga0081455_10189125 3300005937 Unclassified 1552
79 Ga0081538_10002612 3300005981 Bacteria 17436
80 Ga0070712_100118804 3300006175 Unclassified 1986
81 Ga0075428_100335856 3300006844 Bacteria 1623
82 Ga0075430_100021580 3300006846 Bacteria 5472
83 Ga0075431_100208921 3300006847 Unclassified 1995
84 Ga0075431_100235118 3300006847 Unclassified 1866
85 Ga0075433_10027015 3300006852 Bacteria 4866
86 Ga0075433_10126459 3300006852 Unclassified 2270
87 Ga0075433_10183858 3300006852 Bacteria 1860
88 Ga0075433_10189121 3300006852 Bacteria 1832
89 Ga0075433_10306558 3300006852 Unclassified 1406
90 Ga0075434_100003707 3300006871 Bacteria 13646
91 Ga0075434_100011406 3300006871 Bacteria 8383
92 Ga0075434_100084729 3300006871 Bacteria 3168
93 Ga0075434_100135056 3300006871 Bacteria 2486
94 Ga0075434_100201226 3300006871 Unclassified 2011
95 Ga0075434_100645728 3300006871 Bacteria 1077
96 Ga0075429_100046356 3300006880 Bacteria 3782
97 Ga0068865_100067719 3300006881 Bacteria 2523
98 Ga0075436_100059345 3300006914 Unclassified 2643
99 Ga0075436_100084286 3300006914 Unclassified 2206
100 Ga0075435_100047527 3300007076 Bacteria 3446
101 Ga0075435_100141215 3300007076 Unclassified 2021
102 Ga0075435_100184459 3300007076 Bacteria 1764
103 Ga0075435_100218569 3300007076 Unclassified 1618
104 Ga0111539_10039018 3300009094 Bacteria 5727
105 Ga0111539_10059880 3300009094 Bacteria 4514
106 Ga0111539_10245136 3300009094 Unclassified 2086
107 Ga0111539_10567683 3300009094 Unclassified 1321
108 Ga0114129_10006717 3300009147 Bacteria 16335
109 Ga0114129_10043200 3300009147 Bacteria 6341
110 Ga0114129_10099069 3300009147 Bacteria 4034
111 Ga0114129_10142917 3300009147 Bacteria 3279
112 Ga0114129_10386689 3300009147 Unclassified 1846
113 Ga0114129_10530139 3300009147 Bacteria 1534
114 Ga0114129_10589040 3300009147 Unclassified 1442
115 Ga0114129_10617050 3300009147 Unclassified 1403
116 Ga0105241_10017880 3300009174 Bacteria 5214
117 Ga0105241_10045168 3300009174 Unclassified 3341
118 Ga0105242_10137145 3300009176 Bacteria 2119
119 Ga0105248_10324925 3300009177 Bacteria 1733
120 Ga0105249_10043133 3300009553 Unclassified 4104
121 Ga0105249_10157815 3300009553 Unclassified 2190
122 Ga0105249_10385598 3300009553 Unclassified 1428
123 Ga0105249_10449067 3300009553 Unclassified 1328
124 Ga0105239_10022099 3300010375 Bacteria 7012
125 Ga0105246_10011045 3300011119 Bacteria 5595
126 Ga0105246_10028225 3300011119 Unclassified 3685
127 Ga0105246_10039086 3300011119 Bacteria 3194
128 Ga0157374_10008278 3300013296 Bacteria 8873
129 Ga0157378_10028575 3300013297 Bacteria 4922
130 Ga0157378_10039737 3300013297 Unclassified 4173
131 Ga0157378_10043880 3300013297 Unclassified 3969
132 Ga0157378_10226153 3300013297 Bacteria 1781
133 Ga0163162_10021342 3300013306 Bacteria 6377
134 Ga0163162_10067955 3300013306 Bacteria 3615
135 Ga0163162_10097138 3300013306 Unclassified 3034
136 Ga0157372_10045350 3300013307 Unclassified 4876
137 Ga0182008_10128093 3300014497 Bacteria 1264
138 Ga0157376_10026533 3300014969 Bacteria 4580
139 Ga0157376_10062560 3300014969 Bacteria 3132
140 Ga0207697_10004220 3300025315 Bacteria 6906
141 Ga0207697_10014040 3300025315 Unclassified 3334
142 Ga0207697_10017757 3300025315 Unclassified 2923
143 Ga0207682_10011354 3300025893 Bacteria 3478
144 Ga0207682_10050868 3300025893 Bacteria 1714
145 Ga0207688_10021490 3300025901 Bacteria 3527
146 Ga0207688_10029016 3300025901 Bacteria 3044
147 Ga0207680_10014345 3300025903 Bacteria 4096
148 Ga0207680_10149027 3300025903 Unclassified 1558
149 Ga0207645_10000674 3300025907 Bacteria 28244
150 Ga0207645_10029579 3300025907 Bacteria 3531
151 Ga0207707_10037775 3300025912 Bacteria 4219
152 Ga0207660_10252694 3300025917 Bacteria 1391
153 Ga0207657_10009977 3300025919 Bacteria 9505
154 Ga0207657_10021372 3300025919 Bacteria 6092
155 Ga0207649_10164850 3300025920 Bacteria 1538
156 Ga0207649_10171618 3300025920 Bacteria 1511
157 Ga0207652_10041109 3300025921 Bacteria 3929
158 Ga0207652_10184770 3300025921 Unclassified 1874
159 Ga0207681_10066021 3300025923 Bacteria 2503
160 Ga0207681_10219765 3300025923 Bacteria 1469
161 Ga0207650_10010075 3300025925 Bacteria 6476
162 Ga0207650_10012878 3300025925 Bacteria 5780
163 Ga0207659_10177423 3300025926 Unclassified 1685
164 Ga0207659_10185046 3300025926 Bacteria 1653
165 Ga0207690_10015115 3300025932 Unclassified 4672
166 Ga0207706_10008575 3300025933 Bacteria 9420
167 Ga0207706_10060214 3300025933 Bacteria 3343
168 Ga0207706_10095774 3300025933 Bacteria 2610
169 Ga0207706_10206601 3300025933 Bacteria 1722
170 Ga0207706_10278111 3300025933 Unclassified 1460
171 Ga0207686_10337186 3300025934 Unclassified 1131
172 Ga0207669_10087575 3300025937 Bacteria 2017
173 Ga0207704_10082310 3300025938 Unclassified 2085
174 Ga0207691_10008379 3300025940 Bacteria 9935
175 Ga0207691_10085660 3300025940 Bacteria 2828
176 Ga0207689_10147996 3300025942 Bacteria 1935
177 Ga0207679_10020406 3300025945 Bacteria 4471
178 Ga0207679_10079614 3300025945 Bacteria 2499
179 Ga0207667_10123331 3300025949 Bacteria 2669
180 Ga0207667_10270172 3300025949 Bacteria 1738
181 Ga0207651_10017827 3300025960 Unclassified 4206
182 Ga0207651_10073890 3300025960 Bacteria 2426
183 Ga0207712_10076370 3300025961 Bacteria 2425
184 Ga0207668_10059303 3300025972 Unclassified 2681
185 Ga0207640_10242531 3300025981 Bacteria 1393
186 Ga0207658_10078110 3300025986 Unclassified 2528
187 Ga0207677_10216979 3300026023 Bacteria 1531
188 Ga0207678_10006572 3300026067 Bacteria 10308
189 Ga0207708_10129408 3300026075 Unclassified 1973
190 Ga0207648_10114774 3300026089 Bacteria 2366
191 Ga0207676_10114944 3300026095 Bacteria 2259
192 Ga0207674_10353166 3300026116 Unclassified 1421
193 Ga0207675_100044154 3300026118 Bacteria 4164
194 Ga0207683_10005245 3300026121 Bacteria 11128
195 Ga0207683_10005805 3300026121 Bacteria 10585
196 Ga0207683_10405725 3300026121 Bacteria 1254
197 Ga0209984_1007393 3300027424 Bacteria 1363
198 Ga0210000_1011755 3300027462 Unclassified 1298
199 Ga0209982_1003197 3300027552 Bacteria 2317
200 Ga0209982_1004343 3300027552 Bacteria 2031
201 Ga0209970_1005178 3300027614 Bacteria 2155
202 Ga0209971_1004434 3300027682 Bacteria 3332
203 Ga0209971_1005541 3300027682 Unclassified 2997
204 Ga0209974_10000911 3300027876 Bacteria 10302
205 Ga0209974_10006064 3300027876 Bacteria 4230
206 Ga0207428_10174466 3300027907 Bacteria 1627
207 Ga0207428_10181420 3300027907 Unclassified 1590
208 Ga0207428_10221562 3300027907 Bacteria 1418
209 Ga0307408_100162674 3300031548 Unclassified 1774
210 Ga0307405_10052665 3300031731 Bacteria 2532
211 Ga0307405_10053630 3300031731 Unclassified 2513
212 Ga0307413_10029148 3300031824 Bacteria 3084
213 Ga0307410_10025010 3300031852 Bacteria 3739
214 Ga0307410_10057433 3300031852 Bacteria 2650
215 Ga0307406_10010667 3300031901 Bacteria 5190
216 Ga0307407_10108640 3300031903 Bacteria 1737
217 Ga0307407_10152054 3300031903 Bacteria 1505
218 Ga0307409_100010772 3300031995 Bacteria 5714
219 Ga0307409_100020430 3300031995 Bacteria 4513
220 Ga0307409_100038447 3300031995 Bacteria 3540
221 Ga0307409_100164260 3300031995 Bacteria 1946
222 Ga0307409_100197175 3300031995 Bacteria 1798
223 Ga0307409_100232520 3300031995 Bacteria 1672
224 Ga0307416_100002902 3300032002 Bacteria 9991
225 Ga0307416_100015780 3300032002 Bacteria 5228
226 Ga0307416_100027035 3300032002 Bacteria 4240
227 Ga0307416_100029517 3300032002 Bacteria 4098
228 Ga0307416_100251574 3300032002 Bacteria 1720
229 Ga0307416_100272800 3300032002 Bacteria 1662
230 Ga0307416_100337268 3300032002 Bacteria 1518
231 Ga0307414_10003955 3300032004 Bacteria 7989
232 Ga0307414_10009709 3300032004 Bacteria 5544
233 Ga0307414_10263416 3300032004 Unclassified 1440
234 Ga0307411_10066358 3300032005 Bacteria 2424
235 Ga0307415_100003141 3300032126 Bacteria 8366
236 Ga0307415_100012192 3300032126 Bacteria 4962
237 Ga0307415_100029584 3300032126 Bacteria 3503
238 Ga0307415_100077231 3300032126 Bacteria 2364
239 Ga0373931_0129250 3300035691 Bacteria 1452
240 Ga0373925_0041152 3300037068 Bacteria 3424
241 Ga0439458_0017503 3300042157 Unclassified 1638
242 Ga0453684_0118602 3300044712 Unclassified 3200
243 Ga0495580_0190084 3300046472 Unclassified 1416
244 Ga0496102_0118044 3300048905 Bacteria 2476
245 Ga0496112_0031762 3300048915 Bacteria 5123
246 Ga0496112_0091318 3300048915 Bacteria 3014
247 Ga0496112_0119189 3300048915 Bacteria 2609
248 Ga0496112_0246542 3300048915 Bacteria 1738
249 Ga0496113_0080034 3300048916 Bacteria 2502
250 Ga0501031_0019750 3300049568 Unclassified 4390
251 Ga0501031_0026726 3300049568 Bacteria 3762
252 Ga0501032_0139546 3300049569 Bacteria 1596
253 Ga0501032_0152661 3300049569 Bacteria 1518
254 Ga0501033_0006804 3300049570 Bacteria 8928
255 Ga0501033_0126079 3300049570 Bacteria 1856
256 Ga0501036_0059732 3300049572 Bacteria 3230
257 Ga0501036_0283778 3300049572 Unclassified 1385
258 Ga0501037_0034063 3300049573 Bacteria 3760
259 Ga0501038_0025337 3300049574 Bacteria 5288
260 Ga0501038_0047824 3300049574 Bacteria 3704
261 Ga0501038_0150912 3300049574 Unclassified 1894
262 Ga0501039_0048081 3300049575 Bacteria 3297
263 Ga0501039_0097602 3300049575 Bacteria 2291
264 Ga0501040_0006663 3300049576 Bacteria 7500
265 Ga0501040_0024638 3300049576 Bacteria 4039
266 Ga0501040_0028411 3300049576 Bacteria 3770
267 Ga0501040_0051461 3300049576 Bacteria 2817
268 Ga0501041_0000069 3300049577 Bacteria 38963
269 Ga0501041_0012702 3300049577 Bacteria 4990
270 Ga0501041_0013879 3300049577 Bacteria 4777
271 Ga0501041_0070562 3300049577 Unclassified 2144
272 Ga0501042_0011705 3300049578 Bacteria 5927
273 Ga0501042_0012783 3300049578 Bacteria 5697
274 Ga0501042_0027492 3300049578 Bacteria 4000
275 Ga0501043_0014940 3300049579 Bacteria 6080
276 Ga0501043_0020091 3300049579 Bacteria 5242
277 Ga0501043_0212111 3300049579 Unclassified 1500
278 Ga0501046_0033332 3300049580 Bacteria 4162
279 Ga0501046_0040926 3300049580 Bacteria 3700
280 Ga0501046_0232789 3300049580 Unclassified 1360
281 Ga0501047_0071294 3300049581 Bacteria 3345
282 Ga0501048_0003630 3300049582 Bacteria 11750
283 Ga0501048_0187237 3300049582 Bacteria 1467
284 Ga0501068_0026039 3300049584 Bacteria 3443
285 Ga0501068_0040496 3300049584 Bacteria 2797
286 Ga0501069_0046705 3300049585 Bacteria 2402
287 Ga0501070_0033907 3300049586 Bacteria 4271
288 Ga0501071_0068653 3300049587 Bacteria 2579
289 Ga0501071_0260195 3300049587 Bacteria 1310
290 Ga0501072_0036183 3300049588 Bacteria 3869
291 Ga0501072_0087566 3300049588 Bacteria 2471
292 Ga0501073_0059414 3300049589 Bacteria 2670
293 Ga0501073_0065567 3300049589 Bacteria 2532
294 Ga0501073_0069696 3300049589 Bacteria 2450
295 Ga0501074_0047689 3300049590 Bacteria 3096
296 Ga0501075_0011268 3300049591 Bacteria 6326
297 Ga0501075_0012906 3300049591 Bacteria 5951
298 Ga0501076_0005823 3300049592 Bacteria 8889
299 Ga0501076_0022796 3300049592 Bacteria 4816
300 Ga0501076_0058518 3300049592 Bacteria 3064
301 Ga0501077_0023524 3300049593 Unclassified 3907
302 Ga0501077_0042343 3300049593 Bacteria 2895
303 Ga0501077_0072895 3300049593 Unclassified 2175
304 Ga0501079_0008776 3300049741 Bacteria 7660
305 Ga0501079_0153069 3300049741 Bacteria 1797
306 Ga0501079_0283439 3300049741 Unclassified 1295
307 Ga0501080_0012384 3300049742 Bacteria 7818
308 Ga0501080_0021417 3300049742 Bacteria 5983
309 Ga0501081_0007345 3300049743 Bacteria 7152
310 Ga0501081_0008939 3300049743 Bacteria 6510
311 Ga0501081_0055642 3300049743 Bacteria 2733
312 Ga0501081_0074825 3300049743 Bacteria 2363
313 Ga0501083_0031626 3300049744 Bacteria 3631
314 Ga0501083_0088497 3300049744 Bacteria 2047
315 Ga0501035_0005762 3300049822 Bacteria 11678
316 Ga0501035_0164029 3300049822 Bacteria 1922
317 Ga0501035_0272370 3300049822 Unclassified 1432
318 Ga0501044_0021905 3300049823 Bacteria 6815
319 Ga0501044_0022201 3300049823 Bacteria 6764
320 Ga0501045_0123381 3300049824 Bacteria 1923
321 nmdc:mga05p37_138287_c1 3300050507 Unclassified 2985
322 nmdc:mga05p37_2036_c1 3300050507 Bacteria 23578
323 nmdc:mga05p37_253487_c1 3300050507 Bacteria 2110
324 nmdc:mga05p37_314154_c1 3300050507 Unclassified 1857
325 nmdc:mga05p37_34823_c1 3300050507 Bacteria 6168
326 nmdc:mga0qj67_121968_c1 3300050509 Bacteria 2109
327 nmdc:mga0qj67_26010_c1 3300050509 Unclassified 4528
328 nmdc:mga0qj67_320734_c1 3300050509 Unclassified 1254
329 nmdc:mga06r32_197910_c1 3300050510 Bacteria 1997
330 nmdc:mga06r32_236053_c1 3300050510 Bacteria 1816
331 nmdc:mga06r32_257799_c1 3300050510 Bacteria 1731
332 nmdc:mga06r32_550511_c1 3300050510 Bacteria 1128
333 nmdc:mga08y16_101791_c1 3300050511 Bacteria 2990
334 nmdc:mga08y16_173486_c1 3300050511 Unclassified 2239
335 nmdc:mga08y16_191735_c1 3300050511 Bacteria 2120
336 nmdc:mga08y16_38402_c1 3300050511 Bacteria 5028
337 nmdc:mga0n895_121712_c1 3300050512 Bacteria 2631
338 nmdc:mga0n895_14325_c1 3300050512 Bacteria 7197
339 nmdc:mga0n895_145326_c1 3300050512 Bacteria 2401
340 nmdc:mga0n895_146012_c1 3300050512 Unclassified 2395
341 nmdc:mga0n895_237691_c1 3300050512 Unclassified 1849
342 nmdc:mga0n895_255973_c1 3300050512 Bacteria 1776
343 nmdc:mga0rr50_116850_c1 3300050513 Bacteria 2118
344 nmdc:mga0rr50_120598_c1 3300050513 Bacteria 2087
345 nmdc:mga0rr50_178814_c1 3300050513 Bacteria 1733
346 nmdc:mga0rr50_64658_c1 3300050513 Unclassified 2768
347 nmdc:mga08x19_130890_c1 3300050514 Unclassified 1687
348 nmdc:mga08x19_243866_c1 3300050514 Unclassified 1239
349 nmdc:mga08x19_49182_c1 3300050514 Unclassified 2703
350 nmdc:mga0a205_144486_c1 3300050515 Unclassified 2279
351 nmdc:mga0a205_145024_c1 3300050515 Bacteria 2274
352 nmdc:mga0a205_205767_c1 3300050515 Bacteria 1857
353 nmdc:mga0a205_59703_c1 3300050515 Bacteria 3684
354 Ga0501084_0131128 3300054114 Bacteria 2110
355 Ga0501084_0166764 3300054114 Unclassified 1858
356 Ga0590071_026082 3300059421 Unclassified 1386
357 Ga0590075_010407 3300059424 Unclassified 2239
358 Ga0590077_009484 3300059426 Unclassified 1997
359 Ga0501082_0005433 3300060353 Bacteria 11059
360 Ga0501082_0059570 3300060353 Bacteria 3290
361 Ga0501082_0329837 3300060353 Bacteria 1329
362 Ga0501082_0335384 3300060353 Unclassified 1317
363 Ga0530510_0015441 3300061734 Bacteria 5395
364 Ga0530510_0017247 3300061734 Bacteria 5115
365 Ga0530510_0044783 3300061734 Unclassified 3198
366 Ga0530510_0400234 3300061734 Unclassified 1035
367 Ga0065712_10002660
368 Ga0065712_10079824
369 Ga0065712_10080621
370 Ga0065712_10098411
371 Ga0065715_10005730
372 Ga0065715_10103304
373 Ga0065715_10113112
374 Ga0065707_10001720
375 Ga0065707_10120333
376 Ga0065707_10239890
377 Ga0070658_10111424
378 Ga0070676_10015933
379 Ga0070690_100130887
380 Ga0070670_100023386
381 Ga0070670_100111956
382 Ga0070666_10109011
383 Ga0070666_10115710
384 Ga0070680_100017497
385 Ga0070680_100051191
386 Ga0068868_100021932
387 Ga0070660_100045571
388 Ga0070689_100124548
389 Ga0070691_10029529
390 Ga0070661_100007916
391 Ga0070661_100016995
392 Ga0070661_100101234
393 Ga0070692_10037779
394 Ga0070668_100032283
395 Ga0070669_100003408
396 Ga0070669_100037226
397 Ga0070675_100012664
398 Ga0070671_100018158
399 Ga0070671_100063764
400 Ga0070671_100090308
401 Ga0070674_100023604
402 Ga0070674_100027670
403 Ga0070674_100298015
404 Ga0070673_100015451
405 Ga0070673_100100038
406 Ga0070659_100203456
407 Ga0070667_100006273
408 Ga0070667_100038290
409 Ga0070694_100027753
410 Ga0070694_100222751
411 Ga0070663_100112503
412 Ga0070663_100409035
413 Ga0070678_100036566
414 Ga0070678_100081201
415 Ga0070662_100011251
416 Ga0070662_100125984
417 Ga0070662_100209713
418 Ga0070662_100245894
419 Ga0070681_10235389
420 Ga0070685_10047614
421 Ga0070679_100063846
422 Ga0070697_100075366
423 Ga0070697_100111221
424 Ga0068853_100128159
425 Ga0070672_100027305
426 Ga0070672_100149173
427 Ga0070695_100010539
428 Ga0070695_100013182
429 Ga0070695_100018722
430 Ga0070696_100046064
431 Ga0070696_100073741
432 Ga0070696_100203058
433 Ga0070704_100126942
434 Ga0068855_100020698
435 Ga0068855_100154856
436 Ga0068855_100247703
437 Ga0070664_100005233
438 Ga0070664_100012373
439 Ga0068856_100049161
440 Ga0068856_100053078
441 Ga0068856_100383569
442 Ga0068862_100454655
443 Ga0081455_10042556
444 Ga0081455_10189125
445 Ga0081538_10002612
446 Ga0070712_100118804
447 Ga0075428_100335856
448 Ga0075430_100021580
449 Ga0075431_100208921
450 Ga0075431_100235118
451 Ga0075433_10027015
452 Ga0075433_10126459
453 Ga0075433_10183858
454 Ga0075433_10189121
455 Ga0075433_10306558
456 Ga0075434_100003707
457 Ga0075434_100011406
458 Ga0075434_100084729
459 Ga0075434_100135056
460 Ga0075434_100201226
461 Ga0075434_100645728
462 Ga0075429_100046356
463 Ga0068865_100067719
464 Ga0075436_100059345
465 Ga0075436_100084286
466 Ga0075435_100047527
467 Ga0075435_100141215
468 Ga0075435_100184459
469 Ga0075435_100218569
470 Ga0111539_10039018
471 Ga0111539_10059880
472 Ga0111539_10245136
473 Ga0111539_10567683
474 Ga0114129_10006717
475 Ga0114129_10043200
476 Ga0114129_10099069
477 Ga0114129_10142917
478 Ga0114129_10386689
479 Ga0114129_10530139
480 Ga0114129_10589040
481 Ga0114129_10617050
482 Ga0105241_10017880
483 Ga0105241_10045168
484 Ga0105242_10137145
485 Ga0105248_10324925
486 Ga0105249_10043133
487 Ga0105249_10157815
488 Ga0105249_10385598
489 Ga0105249_10449067
490 Ga0105239_10022099
491 Ga0105246_10011045
492 Ga0105246_10028225
493 Ga0105246_10039086
494 Ga0157374_10008278
495 Ga0157378_10028575
496 Ga0157378_10039737
497 Ga0157378_10043880
498 Ga0157378_10226153
499 Ga0163162_10021342
500 Ga0163162_10067955
501 Ga0163162_10097138
502 Ga0157372_10045350
503 Ga0182008_10128093
504 Ga0157376_10026533
505 Ga0157376_10062560
506 Ga0207697_10004220
507 Ga0207697_10014040
508 Ga0207697_10017757
509 Ga0207682_10011354
510 Ga0207682_10050868
511 Ga0207688_10021490
512 Ga0207688_10029016
513 Ga0207680_10014345
514 Ga0207680_10149027
515 Ga0207645_10000674
516 Ga0207645_10029579
517 Ga0207707_10037775
518 Ga0207660_10252694
519 Ga0207657_10009977
520 Ga0207657_10021372
521 Ga0207649_10164850
522 Ga0207649_10171618
523 Ga0207652_10041109
524 Ga0207652_10184770
525 Ga0207681_10066021
526 Ga0207681_10219765
527 Ga0207650_10010075
528 Ga0207650_10012878
529 Ga0207659_10177423
530 Ga0207659_10185046
531 Ga0207690_10015115
532 Ga0207706_10008575
533 Ga0207706_10060214
534 Ga0207706_10095774
535 Ga0207706_10206601
536 Ga0207706_10278111
537 Ga0207686_10337186
538 Ga0207669_10087575
539 Ga0207704_10082310
540 Ga0207691_10008379
541 Ga0207691_10085660
542 Ga0207689_10147996
543 Ga0207679_10020406
544 Ga0207679_10079614
545 Ga0207667_10123331
546 Ga0207667_10270172
547 Ga0207651_10017827
548 Ga0207651_10073890
549 Ga0207712_10076370
550 Ga0207668_10059303
551 Ga0207640_10242531
552 Ga0207658_10078110
553 Ga0207677_10216979
554 Ga0207678_10006572
555 Ga0207708_10129408
556 Ga0207648_10114774
557 Ga0207676_10114944
558 Ga0207674_10353166
559 Ga0207675_100044154
560 Ga0207683_10005245
561 Ga0207683_10005805
562 Ga0207683_10405725
563 Ga0209984_1007393
564 Ga0210000_1011755
565 Ga0209982_1003197
566 Ga0209982_1004343
567 Ga0209970_1005178
568 Ga0209971_1004434
569 Ga0209971_1005541
570 Ga0209974_10000911
571 Ga0209974_10006064
572 Ga0207428_10174466
573 Ga0207428_10181420
574 Ga0207428_10221562
575 Ga0307408_100162674
576 Ga0307405_10052665
577 Ga0307405_10053630
578 Ga0307413_10029148
579 Ga0307410_10025010
580 Ga0307410_10057433
581 Ga0307406_10010667
582 Ga0307407_10108640
583 Ga0307407_10152054
584 Ga0307409_100010772
585 Ga0307409_100020430
586 Ga0307409_100038447
587 Ga0307409_100164260
588 Ga0307409_100197175
589 Ga0307409_100232520
590 Ga0307416_100002902
591 Ga0307416_100015780
592 Ga0307416_100027035
593 Ga0307416_100029517
594 Ga0307416_100251574
595 Ga0307416_100272800
596 Ga0307416_100337268
597 Ga0307414_10003955
598 Ga0307414_10009709
599 Ga0307414_10263416
600 Ga0307411_10066358
601 Ga0307415_100003141
602 Ga0307415_100012192
603 Ga0307415_100029584
604 Ga0307415_100077231
605 Ga0373931_0129250
606 Ga0373925_0041152
607 Ga0439458_0017503
608 Ga0453684_0118602
609 Ga0495580_0190084
610 Ga0496102_0118044
611 Ga0496112_0031762
612 Ga0496112_0091318
613 Ga0496112_0119189
614 Ga0496112_0246542
615 Ga0496113_0080034
616 Ga0501031_0019750
617 Ga0501031_0026726
618 Ga0501032_0139546
619 Ga0501032_0152661
620 Ga0501033_0006804
621 Ga0501033_0126079
622 Ga0501036_0059732
623 Ga0501036_0283778
624 Ga0501037_0034063
625 Ga0501038_0025337
626 Ga0501038_0047824
627 Ga0501038_0150912
628 Ga0501039_0048081
629 Ga0501039_0097602
630 Ga0501040_0006663
631 Ga0501040_0024638
632 Ga0501040_0028411
633 Ga0501040_0051461
634 Ga0501041_0000069
635 Ga0501041_0012702
636 Ga0501041_0013879
637 Ga0501041_0070562
638 Ga0501042_0011705
639 Ga0501042_0012783
640 Ga0501042_0027492
641 Ga0501043_0014940
642 Ga0501043_0020091
643 Ga0501043_0212111
644 Ga0501046_0033332
645 Ga0501046_0040926
646 Ga0501046_0232789
647 Ga0501047_0071294
648 Ga0501048_0003630
649 Ga0501048_0187237
650 Ga0501068_0026039
651 Ga0501068_0040496
652 Ga0501069_0046705
653 Ga0501070_0033907
654 Ga0501071_0068653
655 Ga0501071_0260195
656 Ga0501072_0036183
657 Ga0501072_0087566
658 Ga0501073_0059414
659 Ga0501073_0065567
660 Ga0501073_0069696
661 Ga0501074_0047689
662 Ga0501075_0011268
663 Ga0501075_0012906
664 Ga0501076_0005823
665 Ga0501076_0022796
666 Ga0501076_0058518
667 Ga0501077_0023524
668 Ga0501077_0042343
669 Ga0501077_0072895
670 Ga0501079_0008776
671 Ga0501079_0153069
672 Ga0501079_0283439
673 Ga0501080_0012384
674 Ga0501080_0021417
675 Ga0501081_0007345
676 Ga0501081_0008939
677 Ga0501081_0055642
678 Ga0501081_0074825
679 Ga0501083_0031626
680 Ga0501083_0088497
681 Ga0501035_0005762
682 Ga0501035_0164029
683 Ga0501035_0272370
684 Ga0501044_0021905
685 Ga0501044_0022201
686 Ga0501045_0123381
687 nmdc:mga05p37_138287_c1
688 nmdc:mga05p37_2036_c1
689 nmdc:mga05p37_253487_c1
690 nmdc:mga05p37_314154_c1
691 nmdc:mga05p37_34823_c1
692 nmdc:mga0qj67_121968_c1
693 nmdc:mga0qj67_26010_c1
694 nmdc:mga0qj67_320734_c1
695 nmdc:mga06r32_197910_c1
696 nmdc:mga06r32_236053_c1
697 nmdc:mga06r32_257799_c1
698 nmdc:mga06r32_550511_c1
699 nmdc:mga08y16_101791_c1
700 nmdc:mga08y16_173486_c1
701 nmdc:mga08y16_191735_c1
702 nmdc:mga08y16_38402_c1
703 nmdc:mga0n895_121712_c1
704 nmdc:mga0n895_14325_c1
705 nmdc:mga0n895_145326_c1
706 nmdc:mga0n895_146012_c1
707 nmdc:mga0n895_237691_c1
708 nmdc:mga0n895_255973_c1
709 nmdc:mga0rr50_116850_c1
710 nmdc:mga0rr50_120598_c1
711 nmdc:mga0rr50_178814_c1
712 nmdc:mga0rr50_64658_c1
713 nmdc:mga08x19_130890_c1
714 nmdc:mga08x19_243866_c1
715 nmdc:mga08x19_49182_c1
716 nmdc:mga0a205_144486_c1
717 nmdc:mga0a205_145024_c1
718 nmdc:mga0a205_205767_c1
719 nmdc:mga0a205_59703_c1
720 Ga0501084_0131128
721 Ga0501084_0166764
722 Ga0590071_026082
723 Ga0590075_010407
724 Ga0590077_009484
725 Ga0501082_0005433
726 Ga0501082_0059570
727 Ga0501082_0329837
728 Ga0501082_0335384
729 Ga0530510_0015441
730 Ga0530510_0017247
731 Ga0530510_0044783
732 Ga0530510_0400234

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

101

313

0.87

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

56

312

0.84

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

44

285

0.78

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

41

293

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f6q-assembly1.cif.gz_A crystal structure of metal-citrate-binding mutant (s79a) protein (mcta) of abc transporter in apo state 0.8236 25 324
7f6t-assembly1.cif.gz_A crystal structure of metal-citrate-binding mutant (y221f) protein (mcta) of abc transporter in apo state 0.8202 22 324
7f6r-assembly1.cif.gz_A crystal structure of metal-citrate-binding mutant (s164a) protein (mcta) of abc transporter in apo state 0.8196 22 324
2o68-assembly1.cif.gz_A crystal structure of haemophilus influenzae q58l mutant fbpa 0.8172 41 313
3pu5-assembly1.cif.gz_A the crystal structure of a putative extracellular solute-binding protein from bordetella parapertussis 0.81 37 330
ID Description Score Start End Superfamily
3c9hA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8572 35 305 3.40.190.10
4kd5C01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.843 40 113 3.40.190.10
4elqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.831 40 300 3.40.190.10
3tyhC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.825 41 302 3.40.190.10
4r6yA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8222 38 304 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A534UYS2-F1-model_v4 Extracellular solute-binding protein 0.9663 25 325
AF-A0A534SXM8-F1-model_v4 ABC transporter substrate-binding protein 0.9614 25 325
AF-A0A7C3NSY2-F1-model_v4 Extracellular solute-binding protein 0.9574 25 325 GO:0016020
AF-A0A534UKC1-F1-model_v4 Extracellular solute-binding protein 0.9328 57 325
AF-A0A7C3JSJ8-F1-model_v4 Extracellular solute-binding protein 0.9324 25 289 GO:0016020

Map