F432749

General Info

Members Datasets Scaffolds Average Seq Length
393 193 786 319

Family's Representative Sequence

Representative Sequence 3300059426|Ga0590077_007922|Ga0590077_007922_389_1387
Length 332
Sequence VILVIAEQREGKLNRASWEAIAAAQQLSGLRAEASANAGGMPIKIAILGGTTGNVANDLAVASVAEVVVAENPALEPYTPDAFVMALHGLIEQQKPQFVVLAHTYQTRDFAPMLAARLRKALVTDITAIKGSGTAATFTRPMFQGKLTAEVKPQGDAPHLLSFQIGAFRADAAQKGSAAAPVSKASVPVDASKIRQKPEAPFQEAKAAVDLSQAERIVAVGRGIKSQENLALAEKLARALGAEVAASRPICDNGWLPMERQIGSSGQTVAPKLYVALGISGAIQHLVGMKGSRTIVAVNKDADAPIFEVADYGIVGDLFEIAPALTTELEKG

Samples

Sample ID Description Type Environment
1 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
139 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
140 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
141 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
142 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
143 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
144 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.29
Nodule 0
Rhizoplane 5.6
Rhizosphere 92.11
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590077_007922 3300059426 Bacteria 2173
2 JGI24746J21847_1000972 3300001977 Bacteria 4496
3 JGI25406J46586_10000430 3300003203 Bacteria 19367
4 Ga0065712_10000273 3300005290 Bacteria 24212
5 Ga0065712_10009119 3300005290 Bacteria 3816
6 Ga0065712_10069288 3300005290 Bacteria 7585
7 Ga0065715_10096502 3300005293 Bacteria 3868
8 Ga0065715_10097322 3300005293 Bacteria 3724
9 Ga0065715_10120620 3300005293 Bacteria 2253
10 Ga0065707_10131544 3300005295 Bacteria 1912
11 Ga0070676_10001880 3300005328 Bacteria 10669
12 Ga0070676_10058936 3300005328 Bacteria 2277
13 Ga0070690_100006362 3300005330 Bacteria 6696
14 Ga0070670_100029530 3300005331 Bacteria 4720
15 Ga0070677_10015859 3300005333 Bacteria 2674
16 Ga0070677_10022618 3300005333 Bacteria 2318
17 Ga0068869_100039926 3300005334 Bacteria 3353
18 Ga0070666_10177780 3300005335 Bacteria 1492
19 Ga0070680_100131606 3300005336 Bacteria 2093
20 Ga0068868_100094575 3300005338 Bacteria 2411
21 Ga0070689_100061949 3300005340 Bacteria 2909
22 Ga0070689_100066265 3300005340 Bacteria 2814
23 Ga0070689_100151111 3300005340 Bacteria 1873
24 Ga0070691_10091181 3300005341 Bacteria 1503
25 Ga0070668_100056826 3300005347 Bacteria 3023
26 Ga0070669_100033827 3300005353 Bacteria 3698
27 Ga0070669_100061941 3300005353 Bacteria 2750
28 Ga0070669_100146448 3300005353 Bacteria 1825
29 Ga0070669_100181641 3300005353 Bacteria 1646
30 Ga0070669_100190956 3300005353 Bacteria 1607
31 Ga0070675_100015549 3300005354 Bacteria 6019
32 Ga0070675_100022458 3300005354 Bacteria 5042
33 Ga0070675_100043925 3300005354 Bacteria 3655
34 Ga0070675_100488411 3300005354 Bacteria 1108
35 Ga0070671_100011997 3300005355 Bacteria 6970
36 Ga0070674_100000386 3300005356 Bacteria 22108
37 Ga0070674_100134968 3300005356 Bacteria 1845
38 Ga0070674_100180391 3300005356 Bacteria 1617
39 Ga0070688_100012646 3300005365 Bacteria 4734
40 Ga0070688_100024259 3300005365 Bacteria 3576
41 Ga0070667_100401868 3300005367 Bacteria 1247
42 Ga0070667_100436394 3300005367 Bacteria 1195
43 Ga0070701_10008137 3300005438 Bacteria 4517
44 Ga0070701_10103707 3300005438 Bacteria 1579
45 Ga0070700_100005037 3300005441 Bacteria 6968
46 Ga0070700_100016438 3300005441 Bacteria 4214
47 Ga0070700_100188599 3300005441 Bacteria 1440
48 Ga0070694_100098749 3300005444 Bacteria 2062
49 Ga0070708_100013463 3300005445 Bacteria 6700
50 Ga0070662_100091908 3300005457 Bacteria 2280
51 Ga0070662_100162909 3300005457 Bacteria 1746
52 Ga0070681_10445394 3300005458 Bacteria 1207
53 Ga0068867_100055080 3300005459 Bacteria 2939
54 Ga0068867_100183947 3300005459 Bacteria 1663
55 Ga0070685_10299065 3300005466 Bacteria 1084
56 Ga0070672_100048745 3300005543 Bacteria 3293
57 Ga0070686_100077634 3300005544 Bacteria 2190
58 Ga0070695_100056169 3300005545 Bacteria 2540
59 Ga0070693_100232526 3300005547 Bacteria 1213
60 Ga0070665_100009850 3300005548 Bacteria 9659
61 Ga0070665_100014988 3300005548 Bacteria 7781
62 Ga0070665_100116719 3300005548 Bacteria 2672
63 Ga0070665_100292851 3300005548 Bacteria 1630
64 Ga0070665_100440991 3300005548 Bacteria 1311
65 Ga0070704_100032572 3300005549 Bacteria 3517
66 Ga0070704_100039770 3300005549 Bacteria 3231
67 Ga0070704_100294882 3300005549 Bacteria 1349
68 Ga0068855_100130136 3300005563 Bacteria 2875
69 Ga0070664_100006166 3300005564 Bacteria 9693
70 Ga0070664_100082631 3300005564 Bacteria 2770
71 Ga0070664_100167031 3300005564 Bacteria 1950
72 Ga0070664_100280578 3300005564 Bacteria 1502
73 Ga0068857_100425861 3300005577 Bacteria 1238
74 Ga0068854_100090244 3300005578 Bacteria 2278
75 Ga0068852_100303331 3300005616 Bacteria 1546
76 Ga0068859_100020972 3300005617 Bacteria 6559
77 Ga0068859_100082241 3300005617 Bacteria 3263
78 Ga0068859_100110669 3300005617 Bacteria 2808
79 Ga0068864_100003876 3300005618 Bacteria 12315
80 Ga0068864_100277635 3300005618 Bacteria 1563
81 Ga0068861_100011750 3300005719 Bacteria 6094
82 Ga0068861_100118459 3300005719 Bacteria 2133
83 Ga0068858_100003783 3300005842 Bacteria 14961
84 Ga0068858_100156676 3300005842 Bacteria 2143
85 Ga0068860_100465727 3300005843 Bacteria 1258
86 Ga0068862_100079683 3300005844 Bacteria 2839
87 Ga0081455_10174198 3300005937 Bacteria 1635
88 Ga0081539_10000122 3300005985 Bacteria 183393
89 Ga0081539_10000251 3300005985 Bacteria 125220
90 Ga0075365_10118644 3300006038 Bacteria 1823
91 Ga0075364_10007707 3300006051 Bacteria 6407
92 Ga0075364_10056595 3300006051 Bacteria 2568
93 Ga0075367_10008629 3300006178 Bacteria 5286
94 Ga0075369_10071135 3300006186 Bacteria 1531
95 Ga0097621_100012994 3300006237 Bacteria 6189
96 Ga0097621_100014668 3300006237 Bacteria 5871
97 Ga0097621_100312257 3300006237 Bacteria 1391
98 Ga0075370_10023374 3300006353 Bacteria 3404
99 Ga0068871_100004154 3300006358 Bacteria 10024
100 Ga0068871_100389108 3300006358 Bacteria 1240
101 Ga0075428_100001700 3300006844 Bacteria 23477
102 Ga0075428_100002392 3300006844 Bacteria 20368
103 Ga0075428_100102785 3300006844 Bacteria 3116
104 Ga0075428_100370172 3300006844 Bacteria 1537
105 Ga0075430_100001828 3300006846 Bacteria 17416
106 Ga0075430_100004671 3300006846 Bacteria 11517
107 Ga0075430_100010664 3300006846 Bacteria 7787
108 Ga0075430_100087673 3300006846 Bacteria 2604
109 Ga0075430_100198039 3300006846 Bacteria 1668
110 Ga0075431_100007672 3300006847 Bacteria 10744
111 Ga0075431_100010533 3300006847 Bacteria 9295
112 Ga0075431_100044009 3300006847 Bacteria 4604
113 Ga0075431_100057806 3300006847 Bacteria 4000
114 Ga0075431_100112436 3300006847 Bacteria 2811
115 Ga0075433_10188483 3300006852 Bacteria 1835
116 Ga0075433_10440569 3300006852 Bacteria 1148
117 Ga0075429_100003269 3300006880 Bacteria 13813
118 Ga0075429_100005311 3300006880 Bacteria 11084
119 Ga0075429_100006346 3300006880 Bacteria 10233
120 Ga0075429_100080191 3300006880 Bacteria 2845
121 Ga0075429_100169772 3300006880 Bacteria 1911
122 Ga0068865_100010654 3300006881 Bacteria 5731
123 Ga0068865_100026310 3300006881 Bacteria 3835
124 Ga0068865_100122852 3300006881 Bacteria 1934
125 Ga0097620_100020966 3300006931 Bacteria 6559
126 Ga0097620_100082241 3300006931 Bacteria 3263
127 Ga0097620_100110660 3300006931 Bacteria 2808
128 Ga0075435_100001069 3300007076 Bacteria 17407
129 Ga0105240_10095096 3300009093 Bacteria 3633
130 Ga0105240_10178600 3300009093 Bacteria 2507
131 Ga0111539_10000058 3300009094 Bacteria 114638
132 Ga0111539_10000325 3300009094 Bacteria 58382
133 Ga0111539_10001176 3300009094 Bacteria 34725
134 Ga0111539_10003731 3300009094 Bacteria 20043
135 Ga0111539_10019902 3300009094 Bacteria 8267
136 Ga0111539_10031656 3300009094 Bacteria 6426
137 Ga0111539_10120280 3300009094 Bacteria 3077
138 Ga0105245_10139493 3300009098 Bacteria 2281
139 Ga0105245_10260281 3300009098 Bacteria 1688
140 Ga0114129_10000086 3300009147 Bacteria 86772
141 Ga0114129_10002137 3300009147 Bacteria 27257
142 Ga0114129_10049092 3300009147 Bacteria 5931
143 Ga0114129_10055894 3300009147 Bacteria 5531
144 Ga0114129_10070173 3300009147 Bacteria 4885
145 Ga0114129_10249306 3300009147 Bacteria 2384
146 Ga0105243_10031813 3300009148 Bacteria 4070
147 Ga0105242_10003161 3300009176 Bacteria 12860
148 Ga0105242_10076035 3300009176 Bacteria 2798
149 Ga0105242_10158396 3300009176 Bacteria 1980
150 Ga0105242_10249154 3300009176 Bacteria 1600
151 Ga0105248_10005921 3300009177 Bacteria 13440
152 Ga0105248_10030706 3300009177 Bacteria 6001
153 Ga0105248_10075804 3300009177 Bacteria 3780
154 Ga0105248_10076830 3300009177 Bacteria 3753
155 Ga0105248_10317310 3300009177 Bacteria 1755
156 Ga0105249_10018205 3300009553 Bacteria 6244
157 Ga0105249_10459960 3300009553 Bacteria 1312
158 Ga0105239_10096159 3300010375 Bacteria 3272
159 Ga0157370_10380045 3300013104 Bacteria 1301
160 Ga0163162_10124131 3300013306 Bacteria 2687
161 Ga0163162_10392706 3300013306 Bacteria 1520
162 Ga0157375_10027101 3300013308 Bacteria 5352
163 Ga0163163_10180429 3300014325 Bacteria 2158
164 Ga0163163_10372914 3300014325 Bacteria 1484
165 Ga0163163_10551754 3300014325 Bacteria 1215
166 Ga0157380_10000695 3300014326 Bacteria 20946
167 Ga0157380_10272969 3300014326 Bacteria 1543
168 Ga0157377_10009794 3300014745 Bacteria 4720
169 Ga0157379_10139710 3300014968 Bacteria 2183
170 Ga0157376_10043220 3300014969 Bacteria 3697
171 Ga0163161_10009807 3300017792 Bacteria 6635
172 Ga0163161_10092912 3300017792 Bacteria 2235
173 Ga0207697_10108192 3300025315 Bacteria 1189
174 Ga0207682_10003448 3300025893 Bacteria 6869
175 Ga0207688_10026108 3300025901 Bacteria 3210
176 Ga0207647_10106582 3300025904 Bacteria 1659
177 Ga0207645_10052839 3300025907 Bacteria 2597
178 Ga0207643_10008924 3300025908 Bacteria 5385
179 Ga0207643_10129276 3300025908 Bacteria 1501
180 Ga0207684_10181401 3300025910 Bacteria 1815
181 Ga0207660_10078796 3300025917 Bacteria 2415
182 Ga0207660_10214691 3300025917 Bacteria 1508
183 Ga0207662_10000667 3300025918 Bacteria 15601
184 Ga0207662_10039739 3300025918 Bacteria 2761
185 Ga0207649_10265153 3300025920 Bacteria 1243
186 Ga0207681_10045540 3300025923 Bacteria 2946
187 Ga0207681_10105305 3300025923 Bacteria 2042
188 Ga0207681_10112359 3300025923 Bacteria 1984
189 Ga0207681_10145155 3300025923 Bacteria 1772
190 Ga0207650_10021976 3300025925 Bacteria 4514
191 Ga0207650_10092300 3300025925 Bacteria 2315
192 Ga0207659_10016317 3300025926 Bacteria 4831
193 Ga0207659_10035454 3300025926 Bacteria 3448
194 Ga0207659_10037549 3300025926 Bacteria 3364
195 Ga0207687_10046339 3300025927 Bacteria 3009
196 Ga0207687_10238429 3300025927 Bacteria 1440
197 Ga0207706_10085717 3300025933 Bacteria 2770
198 Ga0207706_10105552 3300025933 Bacteria 2479
199 Ga0207706_10113890 3300025933 Bacteria 2379
200 Ga0207686_10080176 3300025934 Bacteria 2127
201 Ga0207686_10259080 3300025934 Bacteria 1274
202 Ga0207670_10031007 3300025936 Bacteria 3420
203 Ga0207669_10002127 3300025937 Bacteria 8393
204 Ga0207669_10077793 3300025937 Bacteria 2111
205 Ga0207704_10021520 3300025938 Bacteria 3437
206 Ga0207704_10042304 3300025938 Bacteria 2681
207 Ga0207704_10116446 3300025938 Bacteria 1819
208 Ga0207691_10003520 3300025940 Bacteria 15234
209 Ga0207691_10073527 3300025940 Bacteria 3083
210 Ga0207711_10062936 3300025941 Bacteria 3202
211 Ga0207711_10093008 3300025941 Bacteria 2655
212 Ga0207711_10142336 3300025941 Bacteria 2158
213 Ga0207689_10049733 3300025942 Bacteria 3458
214 Ga0207679_10201734 3300025945 Bacteria 1662
215 Ga0207667_10223251 3300025949 Bacteria 1930
216 Ga0207651_10090650 3300025960 Bacteria 2235
217 Ga0207651_10284785 3300025960 Bacteria 1367
218 Ga0207640_10038090 3300025981 Bacteria 3031
219 Ga0207658_10141616 3300025986 Bacteria 1947
220 Ga0207658_10258901 3300025986 Bacteria 1482
221 Ga0207677_10098380 3300026023 Bacteria 2146
222 Ga0207703_10137310 3300026035 Bacteria 2118
223 Ga0207703_10147238 3300026035 Bacteria 2050
224 Ga0207708_10005176 3300026075 Bacteria 9620
225 Ga0207708_10014291 3300026075 Bacteria 5938
226 Ga0207708_10132048 3300026075 Bacteria 1953
227 Ga0207648_10020822 3300026089 Bacteria 5905
228 Ga0207648_10045247 3300026089 Bacteria 3860
229 Ga0207648_10070904 3300026089 Bacteria 3038
230 Ga0207648_10274929 3300026089 Bacteria 1505
231 Ga0207676_10412948 3300026095 Bacteria 1264
232 Ga0207674_10440552 3300026116 Bacteria 1259
233 Ga0207675_100095741 3300026118 Bacteria 2794
234 Ga0207683_10033178 3300026121 Bacteria 4484
235 Ga0207683_10088099 3300026121 Bacteria 2761
236 Ga0207683_10323721 3300026121 Bacteria 1412
237 Ga0207698_10068371 3300026142 Bacteria 2804
238 Ga0209998_10006116 3300027717 Bacteria 2504
239 Ga0209974_10028683 3300027876 Bacteria 1843
240 Ga0207428_10000236 3300027907 Bacteria 75764
241 Ga0207428_10001147 3300027907 Bacteria 28680
242 Ga0207428_10001565 3300027907 Bacteria 23885
243 Ga0207428_10006422 3300027907 Bacteria 10858
244 Ga0207428_10016635 3300027907 Bacteria 6324
245 Ga0207428_10026301 3300027907 Bacteria 4857
246 Ga0207428_10107456 3300027907 Bacteria 2150
247 Ga0268266_10004415 3300028379 Bacteria 13477
248 Ga0268266_10004511 3300028379 Bacteria 13309
249 Ga0268266_10142850 3300028379 Bacteria 2149
250 Ga0268266_10288159 3300028379 Bacteria 1529
251 Ga0268265_10084343 3300028380 Bacteria 2518
252 Ga0268265_10104857 3300028380 Bacteria 2293
253 Ga0268265_10223416 3300028380 Bacteria 1650
254 Ga0307408_100007431 3300031548 Bacteria 7249
255 Ga0307408_100008468 3300031548 Bacteria 6792
256 Ga0307405_10001249 3300031731 Bacteria 10587
257 Ga0307413_10249291 3300031824 Bacteria 1316
258 Ga0307410_10017382 3300031852 Bacteria 4318
259 Ga0307410_10061215 3300031852 Bacteria 2575
260 Ga0307410_10077488 3300031852 Bacteria 2324
261 Ga0307410_10449954 3300031852 Bacteria 1050
262 Ga0307406_10004313 3300031901 Bacteria 7737
263 Ga0307406_10044187 3300031901 Bacteria 2791
264 Ga0307407_10000665 3300031903 Bacteria 11072
265 Ga0307407_10003887 3300031903 Bacteria 6228
266 Ga0307407_10011072 3300031903 Bacteria 4279
267 Ga0307407_10097003 3300031903 Bacteria 1821
268 Ga0307412_10007442 3300031911 Bacteria 6210
269 Ga0307412_10153593 3300031911 Unclassified 1702
270 Ga0307409_100007012 3300031995 Bacteria 6697
271 Ga0307409_100020605 3300031995 Bacteria 4499
272 Ga0307409_100103834 3300031995 Bacteria 2365
273 Ga0307409_100163000 3300031995 Bacteria 1952
274 Ga0307409_100661852 3300031995 Bacteria 1039
275 Ga0307416_100004973 3300032002 Bacteria 8105
276 Ga0307416_100007243 3300032002 Bacteria 7029
277 Ga0307416_100034233 3300032002 Bacteria 3863
278 Ga0307416_100122132 3300032002 Bacteria 2324
279 Ga0307416_100222735 3300032002 Bacteria 1811
280 Ga0307416_100342986 3300032002 Bacteria 1508
281 Ga0307414_10201643 3300032004 Bacteria 1619
282 Ga0307411_10075743 3300032005 Bacteria 2298
283 Ga0307411_10168664 3300032005 Bacteria 1648
284 Ga0307411_10170032 3300032005 Bacteria 1642
285 Ga0307411_10170993 3300032005 Bacteria 1638
286 Ga0307411_10187645 3300032005 Bacteria 1575
287 Ga0307415_100011725 3300032126 Bacteria 5032
288 Ga0373925_0127861 3300037068 Bacteria 1979
289 Ga0439433_0001326 3300041999 Bacteria 5087
290 Ga0450920_031169 3300042122 Bacteria 1050
291 Ga0450894_001081 3300042131 Bacteria 4118
292 Ga0450896_002116 3300042133 Bacteria 2537
293 Ga0439446_0001124 3300042156 Bacteria 5925
294 Ga0439435_0024934 3300042436 Bacteria 1582
295 Ga0439440_0034751 3300042993 Bacteria 1207
296 Ga0495643_0001737 3300046522 Bacteria 18806
297 Ga0495598_0049976 3300046537 Bacteria 1255
298 Ga0495621_0076155 3300046539 Bacteria 1244
299 Ga0495634_0091215 3300046642 Bacteria 1978
300 Ga0495658_0136426 3300046683 Bacteria 1497
301 Ga0496101_0084326 3300048904 Bacteria 2353
302 Ga0496104_0038382 3300048907 Bacteria 4481
303 Ga0496104_0050696 3300048907 Bacteria 3917
304 Ga0496104_0121757 3300048907 Bacteria 2505
305 Ga0496105_0030828 3300048908 Bacteria 4396
306 Ga0496106_0294528 3300048909 Bacteria 1301
307 Ga0496107_0035031 3300048910 Bacteria 3599
308 Ga0496108_0038184 3300048911 Bacteria 4001
309 Ga0496108_0087935 3300048911 Bacteria 2640
310 Ga0496109_0001043 3300048912 Bacteria 22931
311 Ga0496109_0139623 3300048912 Bacteria 2266
312 Ga0496109_0289456 3300048912 Bacteria 1544
313 Ga0496110_0006861 3300048913 Bacteria 9050
314 Ga0496110_0037747 3300048913 Bacteria 4200
315 Ga0496110_0109063 3300048913 Bacteria 2486
316 Ga0496112_0001272 3300048915 Bacteria 19131
317 Ga0496112_0130221 3300048915 Bacteria 2487
318 Ga0496112_0342614 3300048915 Bacteria 1438
319 Ga0496113_0161323 3300048916 Bacteria 1772
320 Ga0496114_0082445 3300048917 Bacteria 2718
321 Ga0496114_0120401 3300048917 Bacteria 2257
322 Ga0496115_0019137 3300048918 Bacteria 5267
323 Ga0501034_0008628 3300049571 Bacteria 10753
324 Ga0501034_0016523 3300049571 Bacteria 7570
325 Ga0501039_0197614 3300049575 Bacteria 1581
326 Ga0501042_0028458 3300049578 Bacteria 3937
327 Ga0501042_0242612 3300049578 Bacteria 1300
328 Ga0501042_0379015 3300049578 Bacteria 1024
329 Ga0501046_0046019 3300049580 Bacteria 3464
330 Ga0501047_0042786 3300049581 Bacteria 4376
331 Ga0501071_0010122 3300049587 Bacteria 6308
332 Ga0501072_0110877 3300049588 Bacteria 2184
333 Ga0501073_0033223 3300049589 Bacteria 3674
334 Ga0501074_0046634 3300049590 Bacteria 3133
335 Ga0501075_0049058 3300049591 Bacteria 3173
336 Ga0501075_0242406 3300049591 Bacteria 1374
337 Ga0501076_0022045 3300049592 Bacteria 4892
338 Ga0501076_0156717 3300049592 Bacteria 1854
339 Ga0501076_0290193 3300049592 Bacteria 1340
340 Ga0501079_0010902 3300049741 Bacteria 6923
341 Ga0501079_0049641 3300049741 Bacteria 3239
342 Ga0501081_0005698 3300049743 Bacteria 8061
343 Ga0501081_0256176 3300049743 Bacteria 1278
344 Ga0501083_0057176 3300049744 Bacteria 2612
345 Ga0501044_0016786 3300049823 Bacteria 7858
346 Ga0501045_0101892 3300049824 Bacteria 2126
347 Ga0501045_0121421 3300049824 Bacteria 1940
348 Ga0501045_0273433 3300049824 Bacteria 1258
349 nmdc:mga00v17_110609_c1 3300050491 Bacteria 1743
350 nmdc:mga06z11_217224_c1 3300050494 Bacteria 1116
351 nmdc:mga07m45_37864_c1 3300050496 Bacteria 2691
352 nmdc:mga05p37_107097_c1 3300050507 Bacteria 3439
353 nmdc:mga05p37_168709_c1 3300050507 Bacteria 2670
354 nmdc:mga05p37_287260_c1 3300050507 Bacteria 1959
355 nmdc:mga05p37_31514_c1 3300050507 Bacteria 6476
356 nmdc:mga05p37_961_c1 3300050507 Bacteria 32612
357 nmdc:mga09592_12297_c1 3300050508 Bacteria 6969
358 nmdc:mga09592_138349_c1 3300050508 Bacteria 2098
359 nmdc:mga09592_342750_c1 3300050508 Bacteria 1294
360 nmdc:mga09592_36427_c1 3300050508 Bacteria 4121
361 nmdc:mga09592_4292_c1 3300050508 Bacteria 11514
362 nmdc:mga09592_73487_c1 3300050508 Bacteria 2905
363 nmdc:mga09592_7427_c1 3300050508 Bacteria 8908
364 nmdc:mga0qj67_150303_c1 3300050509 Bacteria 1889
365 nmdc:mga0qj67_16959_c1 3300050509 Bacteria 5532
366 nmdc:mga0qj67_239336_c1 3300050509 Bacteria 1473
367 nmdc:mga0qj67_6995_c1 3300050509 Bacteria 8312
368 nmdc:mga0qj67_82899_c1 3300050509 Bacteria 2571
369 nmdc:mga06r32_167529_c1 3300050510 Bacteria 2180
370 nmdc:mga06r32_20318_c1 3300050510 Bacteria 6113
371 nmdc:mga06r32_252050_c1 3300050510 Bacteria 1753
372 nmdc:mga06r32_5018_c1 3300050510 Bacteria 11916
373 nmdc:mga08y16_106870_c1 3300050511 Bacteria 2913
374 nmdc:mga08y16_11479_c1 3300050511 Bacteria 9307
375 nmdc:mga08y16_118080_c1 3300050511 Bacteria 2760
376 nmdc:mga08y16_1558_c1 3300050511 Bacteria 23104
377 nmdc:mga08y16_178430_c1 3300050511 Bacteria 2206
378 nmdc:mga08y16_18352_c1 3300050511 Bacteria 7373
379 nmdc:mga08y16_19507_c1 3300050511 Bacteria 7149
380 nmdc:mga08y16_2185_c1 3300050511 Bacteria 20065
381 nmdc:mga08y16_2369_c1 3300050511 Bacteria 19358
382 nmdc:mga08y16_337105_c1 3300050511 Bacteria 1550
383 nmdc:mga08y16_635_c1 3300050511 Bacteria 32952
384 nmdc:mga08y16_6486_c1 3300050511 Bacteria 12278
385 nmdc:mga0a205_471121_c1 3300050515 Bacteria 1115
386 Ga0495601_0006207 3300053077 Bacteria 6980
387 Ga0495601_0226907 3300053077 Bacteria 1220
388 Ga0495612_0056886 3300053078 Bacteria 1615
389 Ga0495619_0003773 3300053085 Bacteria 9744
390 Ga0501084_0111474 3300054114 Bacteria 2299
391 Ga0590071_001035 3300059421 Bacteria 7553
392 Ga0590074_002029 3300059423 Bacteria 3316
393 Ga0501082_0111195 3300060353 Bacteria 2371
394 Ga0590077_007922
395 JGI24746J21847_1000972
396 JGI25406J46586_10000430
397 Ga0065712_10000273
398 Ga0065712_10009119
399 Ga0065712_10069288
400 Ga0065715_10096502
401 Ga0065715_10097322
402 Ga0065715_10120620
403 Ga0065707_10131544
404 Ga0070676_10001880
405 Ga0070676_10058936
406 Ga0070690_100006362
407 Ga0070670_100029530
408 Ga0070677_10015859
409 Ga0070677_10022618
410 Ga0068869_100039926
411 Ga0070666_10177780
412 Ga0070680_100131606
413 Ga0068868_100094575
414 Ga0070689_100061949
415 Ga0070689_100066265
416 Ga0070689_100151111
417 Ga0070691_10091181
418 Ga0070668_100056826
419 Ga0070669_100033827
420 Ga0070669_100061941
421 Ga0070669_100146448
422 Ga0070669_100181641
423 Ga0070669_100190956
424 Ga0070675_100015549
425 Ga0070675_100022458
426 Ga0070675_100043925
427 Ga0070675_100488411
428 Ga0070671_100011997
429 Ga0070674_100000386
430 Ga0070674_100134968
431 Ga0070674_100180391
432 Ga0070688_100012646
433 Ga0070688_100024259
434 Ga0070667_100401868
435 Ga0070667_100436394
436 Ga0070701_10008137
437 Ga0070701_10103707
438 Ga0070700_100005037
439 Ga0070700_100016438
440 Ga0070700_100188599
441 Ga0070694_100098749
442 Ga0070708_100013463
443 Ga0070662_100091908
444 Ga0070662_100162909
445 Ga0070681_10445394
446 Ga0068867_100055080
447 Ga0068867_100183947
448 Ga0070685_10299065
449 Ga0070672_100048745
450 Ga0070686_100077634
451 Ga0070695_100056169
452 Ga0070693_100232526
453 Ga0070665_100009850
454 Ga0070665_100014988
455 Ga0070665_100116719
456 Ga0070665_100292851
457 Ga0070665_100440991
458 Ga0070704_100032572
459 Ga0070704_100039770
460 Ga0070704_100294882
461 Ga0068855_100130136
462 Ga0070664_100006166
463 Ga0070664_100082631
464 Ga0070664_100167031
465 Ga0070664_100280578
466 Ga0068857_100425861
467 Ga0068854_100090244
468 Ga0068852_100303331
469 Ga0068859_100020972
470 Ga0068859_100082241
471 Ga0068859_100110669
472 Ga0068864_100003876
473 Ga0068864_100277635
474 Ga0068861_100011750
475 Ga0068861_100118459
476 Ga0068858_100003783
477 Ga0068858_100156676
478 Ga0068860_100465727
479 Ga0068862_100079683
480 Ga0081455_10174198
481 Ga0081539_10000122
482 Ga0081539_10000251
483 Ga0075365_10118644
484 Ga0075364_10007707
485 Ga0075364_10056595
486 Ga0075367_10008629
487 Ga0075369_10071135
488 Ga0097621_100012994
489 Ga0097621_100014668
490 Ga0097621_100312257
491 Ga0075370_10023374
492 Ga0068871_100004154
493 Ga0068871_100389108
494 Ga0075428_100001700
495 Ga0075428_100002392
496 Ga0075428_100102785
497 Ga0075428_100370172
498 Ga0075430_100001828
499 Ga0075430_100004671
500 Ga0075430_100010664
501 Ga0075430_100087673
502 Ga0075430_100198039
503 Ga0075431_100007672
504 Ga0075431_100010533
505 Ga0075431_100044009
506 Ga0075431_100057806
507 Ga0075431_100112436
508 Ga0075433_10188483
509 Ga0075433_10440569
510 Ga0075429_100003269
511 Ga0075429_100005311
512 Ga0075429_100006346
513 Ga0075429_100080191
514 Ga0075429_100169772
515 Ga0068865_100010654
516 Ga0068865_100026310
517 Ga0068865_100122852
518 Ga0097620_100020966
519 Ga0097620_100082241
520 Ga0097620_100110660
521 Ga0075435_100001069
522 Ga0105240_10095096
523 Ga0105240_10178600
524 Ga0111539_10000058
525 Ga0111539_10000325
526 Ga0111539_10001176
527 Ga0111539_10003731
528 Ga0111539_10019902
529 Ga0111539_10031656
530 Ga0111539_10120280
531 Ga0105245_10139493
532 Ga0105245_10260281
533 Ga0114129_10000086
534 Ga0114129_10002137
535 Ga0114129_10049092
536 Ga0114129_10055894
537 Ga0114129_10070173
538 Ga0114129_10249306
539 Ga0105243_10031813
540 Ga0105242_10003161
541 Ga0105242_10076035
542 Ga0105242_10158396
543 Ga0105242_10249154
544 Ga0105248_10005921
545 Ga0105248_10030706
546 Ga0105248_10075804
547 Ga0105248_10076830
548 Ga0105248_10317310
549 Ga0105249_10018205
550 Ga0105249_10459960
551 Ga0105239_10096159
552 Ga0157370_10380045
553 Ga0163162_10124131
554 Ga0163162_10392706
555 Ga0157375_10027101
556 Ga0163163_10180429
557 Ga0163163_10372914
558 Ga0163163_10551754
559 Ga0157380_10000695
560 Ga0157380_10272969
561 Ga0157377_10009794
562 Ga0157379_10139710
563 Ga0157376_10043220
564 Ga0163161_10009807
565 Ga0163161_10092912
566 Ga0207697_10108192
567 Ga0207682_10003448
568 Ga0207688_10026108
569 Ga0207647_10106582
570 Ga0207645_10052839
571 Ga0207643_10008924
572 Ga0207643_10129276
573 Ga0207684_10181401
574 Ga0207660_10078796
575 Ga0207660_10214691
576 Ga0207662_10000667
577 Ga0207662_10039739
578 Ga0207649_10265153
579 Ga0207681_10045540
580 Ga0207681_10105305
581 Ga0207681_10112359
582 Ga0207681_10145155
583 Ga0207650_10021976
584 Ga0207650_10092300
585 Ga0207659_10016317
586 Ga0207659_10035454
587 Ga0207659_10037549
588 Ga0207687_10046339
589 Ga0207687_10238429
590 Ga0207706_10085717
591 Ga0207706_10105552
592 Ga0207706_10113890
593 Ga0207686_10080176
594 Ga0207686_10259080
595 Ga0207670_10031007
596 Ga0207669_10002127
597 Ga0207669_10077793
598 Ga0207704_10021520
599 Ga0207704_10042304
600 Ga0207704_10116446
601 Ga0207691_10003520
602 Ga0207691_10073527
603 Ga0207711_10062936
604 Ga0207711_10093008
605 Ga0207711_10142336
606 Ga0207689_10049733
607 Ga0207679_10201734
608 Ga0207667_10223251
609 Ga0207651_10090650
610 Ga0207651_10284785
611 Ga0207640_10038090
612 Ga0207658_10141616
613 Ga0207658_10258901
614 Ga0207677_10098380
615 Ga0207703_10137310
616 Ga0207703_10147238
617 Ga0207708_10005176
618 Ga0207708_10014291
619 Ga0207708_10132048
620 Ga0207648_10020822
621 Ga0207648_10045247
622 Ga0207648_10070904
623 Ga0207648_10274929
624 Ga0207676_10412948
625 Ga0207674_10440552
626 Ga0207675_100095741
627 Ga0207683_10033178
628 Ga0207683_10088099
629 Ga0207683_10323721
630 Ga0207698_10068371
631 Ga0209998_10006116
632 Ga0209974_10028683
633 Ga0207428_10000236
634 Ga0207428_10001147
635 Ga0207428_10001565
636 Ga0207428_10006422
637 Ga0207428_10016635
638 Ga0207428_10026301
639 Ga0207428_10107456
640 Ga0268266_10004415
641 Ga0268266_10004511
642 Ga0268266_10142850
643 Ga0268266_10288159
644 Ga0268265_10084343
645 Ga0268265_10104857
646 Ga0268265_10223416
647 Ga0307408_100007431
648 Ga0307408_100008468
649 Ga0307405_10001249
650 Ga0307413_10249291
651 Ga0307410_10017382
652 Ga0307410_10061215
653 Ga0307410_10077488
654 Ga0307410_10449954
655 Ga0307406_10004313
656 Ga0307406_10044187
657 Ga0307407_10000665
658 Ga0307407_10003887
659 Ga0307407_10011072
660 Ga0307407_10097003
661 Ga0307412_10007442
662 Ga0307412_10153593
663 Ga0307409_100007012
664 Ga0307409_100020605
665 Ga0307409_100103834
666 Ga0307409_100163000
667 Ga0307409_100661852
668 Ga0307416_100004973
669 Ga0307416_100007243
670 Ga0307416_100034233
671 Ga0307416_100122132
672 Ga0307416_100222735
673 Ga0307416_100342986
674 Ga0307414_10201643
675 Ga0307411_10075743
676 Ga0307411_10168664
677 Ga0307411_10170032
678 Ga0307411_10170993
679 Ga0307411_10187645
680 Ga0307415_100011725
681 Ga0373925_0127861
682 Ga0439433_0001326
683 Ga0450920_031169
684 Ga0450894_001081
685 Ga0450896_002116
686 Ga0439446_0001124
687 Ga0439435_0024934
688 Ga0439440_0034751
689 Ga0495643_0001737
690 Ga0495598_0049976
691 Ga0495621_0076155
692 Ga0495634_0091215
693 Ga0495658_0136426
694 Ga0496101_0084326
695 Ga0496104_0038382
696 Ga0496104_0050696
697 Ga0496104_0121757
698 Ga0496105_0030828
699 Ga0496106_0294528
700 Ga0496107_0035031
701 Ga0496108_0038184
702 Ga0496108_0087935
703 Ga0496109_0001043
704 Ga0496109_0139623
705 Ga0496109_0289456
706 Ga0496110_0006861
707 Ga0496110_0037747
708 Ga0496110_0109063
709 Ga0496112_0001272
710 Ga0496112_0130221
711 Ga0496112_0342614
712 Ga0496113_0161323
713 Ga0496114_0082445
714 Ga0496114_0120401
715 Ga0496115_0019137
716 Ga0501034_0008628
717 Ga0501034_0016523
718 Ga0501039_0197614
719 Ga0501042_0028458
720 Ga0501042_0242612
721 Ga0501042_0379015
722 Ga0501046_0046019
723 Ga0501047_0042786
724 Ga0501071_0010122
725 Ga0501072_0110877
726 Ga0501073_0033223
727 Ga0501074_0046634
728 Ga0501075_0049058
729 Ga0501075_0242406
730 Ga0501076_0022045
731 Ga0501076_0156717
732 Ga0501076_0290193
733 Ga0501079_0010902
734 Ga0501079_0049641
735 Ga0501081_0005698
736 Ga0501081_0256176
737 Ga0501083_0057176
738 Ga0501044_0016786
739 Ga0501045_0101892
740 Ga0501045_0121421
741 Ga0501045_0273433
742 nmdc:mga00v17_110609_c1
743 nmdc:mga06z11_217224_c1
744 nmdc:mga07m45_37864_c1
745 nmdc:mga05p37_107097_c1
746 nmdc:mga05p37_168709_c1
747 nmdc:mga05p37_287260_c1
748 nmdc:mga05p37_31514_c1
749 nmdc:mga05p37_961_c1
750 nmdc:mga09592_12297_c1
751 nmdc:mga09592_138349_c1
752 nmdc:mga09592_342750_c1
753 nmdc:mga09592_36427_c1
754 nmdc:mga09592_4292_c1
755 nmdc:mga09592_73487_c1
756 nmdc:mga09592_7427_c1
757 nmdc:mga0qj67_150303_c1
758 nmdc:mga0qj67_16959_c1
759 nmdc:mga0qj67_239336_c1
760 nmdc:mga0qj67_6995_c1
761 nmdc:mga0qj67_82899_c1
762 nmdc:mga06r32_167529_c1
763 nmdc:mga06r32_20318_c1
764 nmdc:mga06r32_252050_c1
765 nmdc:mga06r32_5018_c1
766 nmdc:mga08y16_106870_c1
767 nmdc:mga08y16_11479_c1
768 nmdc:mga08y16_118080_c1
769 nmdc:mga08y16_1558_c1
770 nmdc:mga08y16_178430_c1
771 nmdc:mga08y16_18352_c1
772 nmdc:mga08y16_19507_c1
773 nmdc:mga08y16_2185_c1
774 nmdc:mga08y16_2369_c1
775 nmdc:mga08y16_337105_c1
776 nmdc:mga08y16_635_c1
777 nmdc:mga08y16_6486_c1
778 nmdc:mga0a205_471121_c1
779 Ga0495601_0006207
780 Ga0495601_0226907
781 Ga0495612_0056886
782 Ga0495619_0003773
783 Ga0501084_0111474
784 Ga0590071_001035
785 Ga0590074_002029
786 Ga0501082_0111195

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00766

ETF_alpha

Electron transfer flavoprotein FAD-binding domain

210

290

0.99

PF01012

ETF

Electron transfer flavoprotein domain

2

190

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o95-assembly1.cif.gz_F ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.883 2 186
1t9g-assembly1.cif.gz_R structure of the human mcad:etf complex 0.8622 2 188
1o95-assembly1.cif.gz_F ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.8612 2 186
1t9g-assembly1.cif.gz_R structure of the human mcad:etf complex 0.818 2 188
3ih5-assembly1.cif.gz_B crystal structure of electron transfer flavoprotein alpha-subunit from bacteroides thetaiotaomicron 0.8138 2 192
ID Description Score Start End Superfamily
1efpC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9111 1 184 3.40.50.620
af_P9WNG9_2_185_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.893 2 178 3.40.50.620
4l2iA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8851 2 184 3.40.50.620
1efpC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8826 1 184 3.40.50.620
1o97D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8776 2 186 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A382AUL2-F1-model_v4 Electron transfer flavoprotein alpha/beta-subunit N-terminal domain-containing protein 0.9625 2 170 GO:0009055
GO:0033539
GO:0050660
AF-A0A2J6MYZ6-F1-model_v4 Electron transfer flavoprotein subunit alpha 0.9467 2 158 GO:0009055
GO:0033539
GO:0050660
AF-A0A3M1SAI3-F1-model_v4 Electron transfer flavoprotein subunit alpha/FixB family protein 0.9449 1 185 GO:0009055
GO:0033539
GO:0050660
AF-A0A661P8J6-F1-model_v4 Electron transfer flavoprotein subunit alpha/FixB family protein 0.9431 2 159 GO:0009055
GO:0033539
GO:0050660
AF-A0A7C1LQG0-F1-model_v4 Electron transfer flavoprotein subunit alpha/FixB family protein 0.9427 1 152 GO:0009055
GO:0033539
GO:0050660

Map