F432723

General Info

Members Datasets Scaffolds Average Seq Length
393 202 786 199

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0578894|Ga0501069_0578894_19_576
Length 185
Sequence VLEVGGVGLELQCTPDTLAGLRTGTEATLPTSMVVREDSLTLFGFADDDEKQMFELVQTASGVGPKLAQAMLAVHRPEALRRAVSSDDVKTLTTVPGIGQKGAQRIILELRDRIGPPGSAATPAPQAAAARPDWQGQVQAGLVGLGWSTKEADRAIGEVAPEAEQMATPDVARLLRSALRTLSKA

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
182 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
186 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
199 2643221576 Nocardioides sp. Root614 Isolate Unclassified
200 2643221590 Nocardioides sp. Root682 Isolate Unclassified
201 2643221604 Nocardioides sp. Root190 Isolate Unclassified
202 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 0.25
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.18
Nodule 0
Rhizoplane 8.65
Rhizosphere 80.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0578894 3300049585 Bacteria 673
2 JGI24740J21852_10016152 3300001979 Bacteria 2704
3 JGI24735J21928_10012534 3300002067 Bacteria 2678
4 Ga0070658_10189965 3300005327 Bacteria 1731
5 Ga0070658_10934800 3300005327 Bacteria 754
6 Ga0070683_100004167 3300005329 Bacteria 11841
7 Ga0070683_100048365 3300005329 Bacteria 3932
8 Ga0070683_100434861 3300005329 Bacteria 1252
9 Ga0070690_100066580 3300005330 Bacteria 2332
10 Ga0068869_100678123 3300005334 Bacteria 877
11 Ga0070680_100094728 3300005336 Bacteria 2475
12 Ga0070682_100028653 3300005337 Bacteria 3351
13 Ga0070682_100348655 3300005337 Bacteria 1103
14 Ga0068868_100023578 3300005338 Bacteria 4659
15 Ga0070660_100013258 3300005339 Bacteria 5908
16 Ga0070660_100026501 3300005339 Bacteria 4316
17 Ga0070692_10081144 3300005345 Bacteria 1747
18 Ga0070692_10442215 3300005345 Bacteria 830
19 Ga0070668_101104928 3300005347 Bacteria 716
20 Ga0070671_100497043 3300005355 Bacteria 1049
21 Ga0070673_101312230 3300005364 Bacteria 680
22 Ga0070659_100015412 3300005366 Bacteria 5725
23 Ga0070659_100672011 3300005366 Bacteria 894
24 Ga0070667_100221103 3300005367 Bacteria 1686
25 Ga0070667_100336726 3300005367 Bacteria 1364
26 Ga0070678_100176775 3300005456 Bacteria 1744
27 Ga0070662_100968019 3300005457 Bacteria 728
28 Ga0070681_10445416 3300005458 Bacteria 1207
29 Ga0070685_10296174 3300005466 Bacteria 1089
30 Ga0070685_10297821 3300005466 Bacteria 1086
31 Ga0070679_100007194 3300005530 Bacteria 10395
32 Ga0070684_100063387 3300005535 Bacteria 3240
33 Ga0070672_100458756 3300005543 Bacteria 1098
34 Ga0070686_100894744 3300005544 Bacteria 722
35 Ga0070693_100141920 3300005547 Bacteria 1513
36 Ga0070665_100168931 3300005548 Bacteria 2189
37 Ga0068855_100479520 3300005563 Bacteria 1354
38 Ga0070664_100444897 3300005564 Bacteria 1189
39 Ga0068857_100005137 3300005577 Bacteria 11127
40 Ga0068854_100695458 3300005578 Bacteria 877
41 Ga0068856_100456365 3300005614 Bacteria 1299
42 Ga0070702_100113682 3300005615 Bacteria 1683
43 Ga0070702_100690740 3300005615 Bacteria 776
44 Ga0068863_100983821 3300005841 Bacteria 846
45 Ga0068858_100035760 3300005842 Bacteria 4606
46 Ga0068860_100074521 3300005843 Bacteria 3228
47 Ga0068862_100387833 3300005844 Bacteria 1304
48 Ga0075365_10073823 3300006038 Bacteria 2300
49 Ga0075365_10135084 3300006038 Bacteria 1709
50 Ga0075365_10310392 3300006038 Bacteria 1110
51 Ga0075368_10002252 3300006042 Bacteria 6272
52 Ga0075363_100007065 3300006048 Bacteria 5134
53 Ga0075363_100016386 3300006048 Bacteria 3660
54 Ga0075363_100051692 3300006048 Bacteria 2192
55 Ga0075364_10104739 3300006051 Bacteria 1885
56 Ga0075364_10118764 3300006051 Bacteria 1769
57 Ga0075364_10120438 3300006051 Bacteria 1756
58 Ga0075364_10197205 3300006051 Bacteria 1364
59 Ga0075364_10217181 3300006051 Bacteria 1297
60 Ga0075364_10222289 3300006051 Bacteria 1282
61 Ga0075362_10003255 3300006177 Bacteria 5641
62 Ga0075367_10004839 3300006178 Bacteria 6637
63 Ga0075367_10076079 3300006178 Bacteria 2025
64 Ga0097621_100523890 3300006237 Bacteria 1076
65 Ga0075370_10004715 3300006353 Bacteria 6661
66 Ga0075428_100013613 3300006844 Bacteria 9058
67 Ga0075430_100225124 3300006846 Bacteria 1556
68 Ga0075431_100068576 3300006847 Bacteria 3660
69 Ga0075433_10064587 3300006852 Bacteria 3209
70 Ga0075429_100299253 3300006880 Bacteria 1408
71 Ga0068865_100022741 3300006881 Bacteria 4095
72 Ga0111539_10005975 3300009094 Bacteria 15725
73 Ga0111539_11203404 3300009094 Bacteria 880
74 Ga0105245_10016426 3300009098 Bacteria 6457
75 Ga0105245_10493694 3300009098 Bacteria 1239
76 Ga0105245_10742357 3300009098 Bacteria 1017
77 Ga0105247_10235208 3300009101 Bacteria 1246
78 Ga0114129_11412031 3300009147 Bacteria 859
79 Ga0105243_10135757 3300009148 Bacteria 2092
80 Ga0105243_10610629 3300009148 Bacteria 1051
81 Ga0105243_11462966 3300009148 Bacteria 706
82 Ga0105248_10189304 3300009177 Bacteria 2319
83 Ga0105237_10735033 3300009545 Bacteria 993
84 Ga0105238_10518046 3300009551 Bacteria 1195
85 Ga0105238_11386257 3300009551 Bacteria 730
86 Ga0105249_10081436 3300009553 Bacteria 3009
87 Ga0105239_10011816 3300010375 Bacteria 9745
88 Ga0105246_10081040 3300011119 Bacteria 2312
89 Ga0157371_10126049 3300013102 Bacteria 1821
90 Ga0157369_10219128 3300013105 Bacteria 1992
91 Ga0163162_10653164 3300013306 Bacteria 1175
92 Ga0157372_10005055 3300013307 Bacteria 14014
93 Ga0157372_10161470 3300013307 Bacteria 2590
94 Ga0157375_10034477 3300013308 Bacteria 4823
95 Ga0157375_10362929 3300013308 Bacteria 1615
96 Ga0163163_10178988 3300014325 Bacteria 2167
97 Ga0157377_10157331 3300014745 Bacteria 1410
98 Ga0157379_10010491 3300014968 Bacteria 8076
99 Ga0157376_11069681 3300014969 Bacteria 831
100 Ga0163161_10119717 3300017792 Bacteria 1977
101 Ga0206353_10714521 3300020082 Bacteria 1536
102 Ga0207688_10038489 3300025901 Bacteria 2655
103 Ga0207688_10214817 3300025901 Bacteria 1157
104 Ga0207688_10399702 3300025901 Bacteria 852
105 Ga0207647_10012660 3300025904 Bacteria 5864
106 Ga0207647_10014779 3300025904 Bacteria 5370
107 Ga0207647_10045328 3300025904 Bacteria 2744
108 Ga0207705_10060942 3300025909 Bacteria 2726
109 Ga0207705_10071961 3300025909 Bacteria 2507
110 Ga0207705_10698258 3300025909 Bacteria 789
111 Ga0207660_10344006 3300025917 Bacteria 1194
112 Ga0207657_10075165 3300025919 Bacteria 2852
113 Ga0207657_10093245 3300025919 Bacteria 2508
114 Ga0207652_10127302 3300025921 Bacteria 2269
115 Ga0207694_10412564 3300025924 Bacteria 1124
116 Ga0207659_10350921 3300025926 Bacteria 1224
117 Ga0207687_10023071 3300025927 Bacteria 4145
118 Ga0207687_10437400 3300025927 Bacteria 1082
119 Ga0207644_10384114 3300025931 Bacteria 1146
120 Ga0207690_10071642 3300025932 Bacteria 2391
121 Ga0207706_10316362 3300025933 Bacteria 1359
122 Ga0207686_10640539 3300025934 Bacteria 840
123 Ga0207709_10456118 3300025935 Bacteria 989
124 Ga0207704_10018933 3300025938 Bacteria 3606
125 Ga0207704_10133107 3300025938 Bacteria 1726
126 Ga0207691_10496554 3300025940 Bacteria 1037
127 Ga0207689_10104330 3300025942 Bacteria 2329
128 Ga0207661_10015295 3300025944 Bacteria 5642
129 Ga0207661_10035323 3300025944 Bacteria 3894
130 Ga0207679_10294952 3300025945 Bacteria 1395
131 Ga0207667_10174354 3300025949 Bacteria 2210
132 Ga0207712_10053648 3300025961 Bacteria 2829
133 Ga0207712_10459634 3300025961 Bacteria 1081
134 Ga0207668_10114554 3300025972 Bacteria 2030
135 Ga0207640_10251743 3300025981 Bacteria 1371
136 Ga0207658_10103482 3300025986 Bacteria 2235
137 Ga0207677_10039530 3300026023 Bacteria 3103
138 Ga0207703_10281408 3300026035 Bacteria 1511
139 Ga0207678_10397538 3300026067 Bacteria 1193
140 Ga0207676_10716174 3300026095 Bacteria 971
141 Ga0207674_10007885 3300026116 Bacteria 12370
142 Ga0207683_10232952 3300026121 Bacteria 1680
143 Ga0207698_11033236 3300026142 Bacteria 833
144 Ga0209813_10001259 3300027866 Bacteria 5644
145 Ga0209813_10036494 3300027866 Bacteria 1477
146 Ga0207428_10026441 3300027907 Bacteria 4844
147 Ga0268266_10133734 3300028379 Bacteria 2220
148 Ga0268265_10167135 3300028380 Bacteria 1876
149 Ga0268265_10862660 3300028380 Bacteria 887
150 Ga0268264_10180516 3300028381 Bacteria 1916
151 Ga0307408_100946085 3300031548 Bacteria 791
152 Ga0307405_10182869 3300031731 Bacteria 1507
153 Ga0307409_100141685 3300031995 Bacteria 2073
154 Ga0307416_100190479 3300032002 Bacteria 1934
155 Ga0307414_11013230 3300032004 Bacteria 765
156 Ga0316583_10135820 3300032133 Bacteria 857
157 Ga0395899_0068476 3300037312 Bacteria 2602
158 Ga0395900_0161478 3300037418 Bacteria 2285
159 Ga0395900_0166868 3300037418 Bacteria 2243
160 Ga0395898_0167546 3300037466 Bacteria 2100
161 Ga0395898_1425711 3300037466 Bacteria 620
162 Ga0395905_0544197 3300037471 Bacteria 1062
163 Ga0395901_0037698 3300038443 Bacteria 4999
164 Ga0395901_0682426 3300038443 Bacteria 1027
165 Ga0395901_0844226 3300038443 Bacteria 902
166 Ga0439459_0079888 3300042438 Bacteria 770
167 Ga0466969_0040479 3300044656 Bacteria 2335
168 Ga0466972_0047584 3300044658 Bacteria 2074
169 Ga0466972_0057067 3300044658 Bacteria 1876
170 Ga0466965_0068512 3300044683 Bacteria 1782
171 Ga0466965_0110744 3300044683 Bacteria 1411
172 Ga0466965_0316544 3300044683 Bacteria 849
173 Ga0466966_0039877 3300044684 Bacteria 3023
174 Ga0466966_0110684 3300044684 Bacteria 1693
175 Ga0466966_0217407 3300044684 Bacteria 1154
176 Ga0466966_0363378 3300044684 Bacteria 869
177 Ga0466961_0054488 3300044693 Bacteria 2550
178 Ga0466963_0014925 3300044694 Bacteria 4800
179 Ga0466963_0038310 3300044694 Bacteria 3134
180 Ga0466963_0052744 3300044694 Bacteria 2699
181 Ga0466963_0055948 3300044694 Bacteria 2624
182 Ga0466963_0103205 3300044694 Bacteria 1953
183 Ga0466963_0250723 3300044694 Bacteria 1242
184 Ga0466964_0092427 3300044706 Bacteria 1319
185 Ga0466971_0085652 3300044719 Bacteria 1440
186 Ga0466971_0390622 3300044719 Bacteria 677
187 Ga0466970_0006267 3300044765 Bacteria 5938
188 Ga0466970_0027445 3300044765 Bacteria 2988
189 Ga0466970_0450013 3300044765 Bacteria 738
190 Ga0466957_0015381 3300044842 Bacteria 4470
191 Ga0466957_0071957 3300044842 Bacteria 2140
192 Ga0466957_0100014 3300044842 Bacteria 1827
193 Ga0466957_0140858 3300044842 Bacteria 1553
194 Ga0466960_0041225 3300044901 Bacteria 2187
195 Ga0466958_0035228 3300045836 Bacteria 2990
196 Ga0466967_0016500 3300045976 Bacteria 5827
197 Ga0466967_0032685 3300045976 Bacteria 4396
198 Ga0466967_0245783 3300045976 Bacteria 1707
199 Ga0466967_0302529 3300045976 Bacteria 1539
200 Ga0466967_0619632 3300045976 Bacteria 1069
201 Ga0466967_0706714 3300045976 Bacteria 998
202 Ga0466967_0738154 3300045976 Bacteria 976
203 Ga0496100_0188084 3300048903 Bacteria 1497
204 Ga0496101_0323911 3300048904 Bacteria 1209
205 Ga0496102_0006010 3300048905 Bacteria 10336
206 Ga0496102_0077779 3300048905 Bacteria 3053
207 Ga0496102_0365063 3300048905 Bacteria 1359
208 Ga0496102_0408523 3300048905 Bacteria 1276
209 Ga0496102_0734535 3300048905 Bacteria 910
210 Ga0496104_0001924 3300048907 Bacteria 17991
211 Ga0496105_0006703 3300048908 Bacteria 8863
212 Ga0496106_0021861 3300048909 Bacteria 4752
213 Ga0496106_0586437 3300048909 Bacteria 893
214 Ga0496107_0214502 3300048910 Bacteria 1431
215 Ga0496108_0107240 3300048911 Bacteria 2385
216 Ga0496108_0109188 3300048911 Bacteria 2364
217 Ga0496108_0336719 3300048911 Bacteria 1316
218 Ga0496108_0561687 3300048911 Bacteria 995
219 Ga0496109_0015523 3300048912 Bacteria 6639
220 Ga0496109_0054581 3300048912 Bacteria 3645
221 Ga0496109_0074061 3300048912 Bacteria 3130
222 Ga0496110_0119688 3300048913 Bacteria 2372
223 Ga0496110_0346766 3300048913 Bacteria 1353
224 Ga0496110_0464892 3300048913 Bacteria 1153
225 Ga0496111_0025305 3300048914 Bacteria 4188
226 Ga0496113_0229730 3300048916 Bacteria 1479
227 Ga0496113_0256571 3300048916 Bacteria 1396
228 Ga0496113_0960391 3300048916 Bacteria 674
229 Ga0496114_0004325 3300048917 Bacteria 10993
230 Ga0496114_0016698 3300048917 Bacteria 5919
231 Ga0496114_0036408 3300048917 Bacteria 4068
232 Ga0496114_0057464 3300048917 Bacteria 3248
233 Ga0496114_0184087 3300048917 Bacteria 1825
234 Ga0496114_0631101 3300048917 Bacteria 943
235 Ga0496115_0002147 3300048918 Bacteria 14097
236 Ga0496115_0023465 3300048918 Bacteria 4788
237 Ga0501031_0001642 3300049568 Bacteria 14030
238 Ga0501031_0064346 3300049568 Bacteria 2388
239 Ga0501032_0006927 3300049569 Bacteria 8310
240 Ga0501032_0094440 3300049569 Bacteria 1983
241 Ga0501032_0131667 3300049569 Bacteria 1650
242 Ga0501032_0435214 3300049569 Bacteria 841
243 Ga0501033_0007518 3300049570 Bacteria 8479
244 Ga0501033_0295848 3300049570 Bacteria 1141
245 Ga0501034_0038785 3300049571 Bacteria 4825
246 Ga0501034_0047187 3300049571 Bacteria 4351
247 Ga0501034_0175894 3300049571 Bacteria 2106
248 Ga0501034_0180685 3300049571 Bacteria 2074
249 Ga0501036_0000932 3300049572 Bacteria 21959
250 Ga0501036_0015691 3300049572 Bacteria 6326
251 Ga0501036_0033374 3300049572 Bacteria 4353
252 Ga0501036_0033623 3300049572 Bacteria 4335
253 Ga0501036_0222871 3300049572 Bacteria 1583
254 Ga0501036_0424120 3300049572 Bacteria 1109
255 Ga0501037_0007343 3300049573 Bacteria 8059
256 Ga0501037_0042587 3300049573 Bacteria 3336
257 Ga0501037_0076456 3300049573 Bacteria 2431
258 Ga0501038_0004339 3300049574 Bacteria 13191
259 Ga0501038_0059666 3300049574 Bacteria 3267
260 Ga0501038_0081060 3300049574 Bacteria 2734
261 Ga0501038_0305211 3300049574 Bacteria 1248
262 Ga0501039_0029590 3300049575 Bacteria 4218
263 Ga0501039_0259366 3300049575 Bacteria 1366
264 Ga0501039_0598219 3300049575 Bacteria 864
265 Ga0501040_0205074 3300049576 Bacteria 1400
266 Ga0501041_0072446 3300049577 Bacteria 2117
267 Ga0501042_0004821 3300049578 Bacteria 8620
268 Ga0501042_0028849 3300049578 Bacteria 3913
269 Ga0501042_0066578 3300049578 Bacteria 2575
270 Ga0501042_0112533 3300049578 Bacteria 1960
271 Ga0501043_0014184 3300049579 Bacteria 6235
272 Ga0501043_0096215 3300049579 Bacteria 2327
273 Ga0501043_0106823 3300049579 Bacteria 2198
274 Ga0501043_0511058 3300049579 Bacteria 896
275 Ga0501046_0004200 3300049580 Bacteria 13114
276 Ga0501046_0008169 3300049580 Bacteria 9142
277 Ga0501046_0057009 3300049580 Bacteria 3065
278 Ga0501047_0107534 3300049581 Bacteria 2670
279 Ga0501047_0119068 3300049581 Bacteria 2523
280 Ga0501047_0193434 3300049581 Bacteria 1897
281 Ga0501047_0404587 3300049581 Bacteria 1197
282 Ga0501048_0006990 3300049582 Bacteria 8574
283 Ga0501048_0064967 3300049582 Bacteria 2580
284 Ga0501048_0223473 3300049582 Bacteria 1336
285 Ga0501067_0001156 3300049583 Bacteria 14320
286 Ga0501067_0006725 3300049583 Bacteria 6378
287 Ga0501067_0065393 3300049583 Bacteria 2013
288 Ga0501067_0072492 3300049583 Bacteria 1908
289 Ga0501068_0012603 3300049584 Bacteria 4797
290 Ga0501068_0041671 3300049584 Bacteria 2760
291 Ga0501068_0277450 3300049584 Bacteria 1071
292 Ga0501069_0023452 3300049585 Bacteria 3365
293 Ga0501069_0043680 3300049585 Bacteria 2481
294 Ga0501069_0075596 3300049585 Bacteria 1892
295 Ga0501069_0123185 3300049585 Bacteria 1481
296 Ga0501069_0223285 3300049585 Bacteria 1095
297 Ga0501070_0000763 3300049586 Bacteria 29376
298 Ga0501070_0005883 3300049586 Bacteria 10461
299 Ga0501070_0010991 3300049586 Bacteria 7642
300 Ga0501070_0064255 3300049586 Bacteria 3039
301 Ga0501070_0176996 3300049586 Bacteria 1756
302 Ga0501070_0293711 3300049586 Bacteria 1324
303 Ga0501070_0331595 3300049586 Bacteria 1237
304 Ga0501071_0023004 3300049587 Bacteria 4349
305 Ga0501071_0029379 3300049587 Bacteria 3879
306 Ga0501071_0065698 3300049587 Bacteria 2634
307 Ga0501071_0699507 3300049587 Bacteria 780
308 Ga0501072_0005676 3300049588 Bacteria 9503
309 Ga0501072_0046965 3300049588 Bacteria 3400
310 Ga0501072_0091170 3300049588 Bacteria 2420
311 Ga0501072_0098165 3300049588 Bacteria 2328
312 Ga0501072_0158279 3300049588 Bacteria 1806
313 Ga0501073_0013695 3300049589 Bacteria 5899
314 Ga0501073_0072192 3300049589 Bacteria 2404
315 Ga0501073_0072512 3300049589 Bacteria 2398
316 Ga0501073_0342290 3300049589 Bacteria 1032
317 Ga0501073_0359106 3300049589 Bacteria 1006
318 Ga0501074_0002380 3300049590 Bacteria 13109
319 Ga0501074_0029652 3300049590 Bacteria 3963
320 Ga0501074_0030826 3300049590 Bacteria 3885
321 Ga0501074_0060525 3300049590 Bacteria 2728
322 Ga0501074_0073957 3300049590 Bacteria 2447
323 Ga0501075_0358377 3300049591 Bacteria 1112
324 Ga0501076_0006688 3300049592 Bacteria 8366
325 Ga0501076_0372633 3300049592 Bacteria 1173
326 Ga0501077_0029045 3300049593 Bacteria 3515
327 Ga0501077_0164599 3300049593 Bacteria 1408
328 Ga0501079_0054564 3300049741 Bacteria 3082
329 Ga0501079_0071594 3300049741 Bacteria 2679
330 Ga0501079_0079245 3300049741 Bacteria 2540
331 Ga0501079_0086540 3300049741 Bacteria 2426
332 Ga0501080_0003278 3300049742 Bacteria 14297
333 Ga0501080_0035557 3300049742 Bacteria 4649
334 Ga0501080_0041655 3300049742 Bacteria 4278
335 Ga0501080_0065231 3300049742 Bacteria 3387
336 Ga0501081_0060548 3300049743 Bacteria 2623
337 Ga0501081_0136448 3300049743 Bacteria 1756
338 Ga0501083_0001818 3300049744 Bacteria 14626
339 Ga0501083_0112798 3300049744 Bacteria 1786
340 Ga0501083_0145644 3300049744 Bacteria 1551
341 Ga0501035_0004929 3300049822 Bacteria 12668
342 Ga0501035_0013556 3300049822 Bacteria 7524
343 Ga0501035_0127689 3300049822 Bacteria 2219
344 Ga0501035_0199089 3300049822 Bacteria 1719
345 Ga0501044_0012752 3300049823 Bacteria 9101
346 Ga0501044_0384663 3300049823 Bacteria 1318
347 Ga0501044_0430834 3300049823 Bacteria 1228
348 Ga0501045_0005967 3300049824 Bacteria 8429
349 Ga0501045_0119914 3300049824 Bacteria 1953
350 Ga0501045_0144732 3300049824 Bacteria 1768
351 nmdc:mga03683_56976_c1 3300050489 Bacteria 1644
352 nmdc:mga03n38_1506_c1 3300050490 Bacteria 6725
353 nmdc:mga03n38_16627_c1 3300050490 Bacteria 2866
354 nmdc:mga03n38_70011_c1 3300050490 Bacteria 1621
355 nmdc:mga00v17_133435_c1 3300050491 Bacteria 1588
356 nmdc:mga00v17_15826_c1 3300050491 Bacteria 4241
357 nmdc:mga00v17_167477_c1 3300050491 Bacteria 1416
358 nmdc:mga00v17_24837_c1 3300050491 Bacteria 3478
359 nmdc:mga00v17_333007_c1 3300050491 Bacteria 986
360 nmdc:mga00v17_64541_c1 3300050491 Bacteria 2257
361 nmdc:mga0yw44_120394_c1 3300050492 Bacteria 1690
362 nmdc:mga0yw44_278434_c1 3300050492 Bacteria 1118
363 nmdc:mga0yw44_479_c1 3300050492 Bacteria 14195
364 nmdc:mga06z11_133007_c1 3300050494 Bacteria 1399
365 nmdc:mga06z11_212969_c1 3300050494 Bacteria 1127
366 nmdc:mga06z11_31816_c1 3300050494 Bacteria 2567
367 nmdc:mga04h51_46695_c1 3300050495 Bacteria 1436
368 nmdc:mga04h51_865_c1 3300050495 Bacteria 6980
369 nmdc:mga07m45_46496_c1 3300050496 Bacteria 2439
370 nmdc:mga07m45_75402_c1 3300050496 Bacteria 1922
371 nmdc:mga05p37_997_c1 3300050507 Bacteria 32250
372 nmdc:mga09592_1183_c1 3300050508 Bacteria 20832
373 nmdc:mga0qj67_344598_c1 3300050509 Bacteria 1205
374 nmdc:mga06r32_751_c1 3300050510 Bacteria 28489
375 nmdc:mga08y16_10418_c1 3300050511 Bacteria 9751
376 nmdc:mga0a205_53885_c1 3300050515 Bacteria 3882
377 Ga0500644_0009258 3300053088 Bacteria 2629
378 Ga0501084_0009712 3300054114 Bacteria 7957
379 Ga0501084_0030191 3300054114 Bacteria 4533
380 Ga0501084_0207158 3300054114 Bacteria 1655
381 Ga0501082_0020495 3300060353 Bacteria 5701
382 Ga0501082_0081274 3300060353 Bacteria 2796
383 Ga0501082_0083959 3300060353 Bacteria 2748
384 Ga0501082_0167586 3300060353 Bacteria 1909
385 Ga0501082_0399421 3300060353 Bacteria 1200
386 Ga0501082_0407219 3300060353 Bacteria 1187
387 Ga0466962_0237973 3300061719 Bacteria 893
388 Ga0530510_0086120 3300061734 Bacteria 2289
389 Ga0530510_0317703 3300061734 Bacteria 1167
390 2643891628 2643221576 Bacteria 5214352
391 2643960676 2643221590 Bacteria 5214697
392 2644035808 2643221604 Bacteria 5014917
393 2812333189 2811994874 Bacteria 5367947
394 Ga0501069_0578894
395 JGI24740J21852_10016152
396 JGI24735J21928_10012534
397 Ga0070658_10189965
398 Ga0070658_10934800
399 Ga0070683_100004167
400 Ga0070683_100048365
401 Ga0070683_100434861
402 Ga0070690_100066580
403 Ga0068869_100678123
404 Ga0070680_100094728
405 Ga0070682_100028653
406 Ga0070682_100348655
407 Ga0068868_100023578
408 Ga0070660_100013258
409 Ga0070660_100026501
410 Ga0070692_10081144
411 Ga0070692_10442215
412 Ga0070668_101104928
413 Ga0070671_100497043
414 Ga0070673_101312230
415 Ga0070659_100015412
416 Ga0070659_100672011
417 Ga0070667_100221103
418 Ga0070667_100336726
419 Ga0070678_100176775
420 Ga0070662_100968019
421 Ga0070681_10445416
422 Ga0070685_10296174
423 Ga0070685_10297821
424 Ga0070679_100007194
425 Ga0070684_100063387
426 Ga0070672_100458756
427 Ga0070686_100894744
428 Ga0070693_100141920
429 Ga0070665_100168931
430 Ga0068855_100479520
431 Ga0070664_100444897
432 Ga0068857_100005137
433 Ga0068854_100695458
434 Ga0068856_100456365
435 Ga0070702_100113682
436 Ga0070702_100690740
437 Ga0068863_100983821
438 Ga0068858_100035760
439 Ga0068860_100074521
440 Ga0068862_100387833
441 Ga0075365_10073823
442 Ga0075365_10135084
443 Ga0075365_10310392
444 Ga0075368_10002252
445 Ga0075363_100007065
446 Ga0075363_100016386
447 Ga0075363_100051692
448 Ga0075364_10104739
449 Ga0075364_10118764
450 Ga0075364_10120438
451 Ga0075364_10197205
452 Ga0075364_10217181
453 Ga0075364_10222289
454 Ga0075362_10003255
455 Ga0075367_10004839
456 Ga0075367_10076079
457 Ga0097621_100523890
458 Ga0075370_10004715
459 Ga0075428_100013613
460 Ga0075430_100225124
461 Ga0075431_100068576
462 Ga0075433_10064587
463 Ga0075429_100299253
464 Ga0068865_100022741
465 Ga0111539_10005975
466 Ga0111539_11203404
467 Ga0105245_10016426
468 Ga0105245_10493694
469 Ga0105245_10742357
470 Ga0105247_10235208
471 Ga0114129_11412031
472 Ga0105243_10135757
473 Ga0105243_10610629
474 Ga0105243_11462966
475 Ga0105248_10189304
476 Ga0105237_10735033
477 Ga0105238_10518046
478 Ga0105238_11386257
479 Ga0105249_10081436
480 Ga0105239_10011816
481 Ga0105246_10081040
482 Ga0157371_10126049
483 Ga0157369_10219128
484 Ga0163162_10653164
485 Ga0157372_10005055
486 Ga0157372_10161470
487 Ga0157375_10034477
488 Ga0157375_10362929
489 Ga0163163_10178988
490 Ga0157377_10157331
491 Ga0157379_10010491
492 Ga0157376_11069681
493 Ga0163161_10119717
494 Ga0206353_10714521
495 Ga0207688_10038489
496 Ga0207688_10214817
497 Ga0207688_10399702
498 Ga0207647_10012660
499 Ga0207647_10014779
500 Ga0207647_10045328
501 Ga0207705_10060942
502 Ga0207705_10071961
503 Ga0207705_10698258
504 Ga0207660_10344006
505 Ga0207657_10075165
506 Ga0207657_10093245
507 Ga0207652_10127302
508 Ga0207694_10412564
509 Ga0207659_10350921
510 Ga0207687_10023071
511 Ga0207687_10437400
512 Ga0207644_10384114
513 Ga0207690_10071642
514 Ga0207706_10316362
515 Ga0207686_10640539
516 Ga0207709_10456118
517 Ga0207704_10018933
518 Ga0207704_10133107
519 Ga0207691_10496554
520 Ga0207689_10104330
521 Ga0207661_10015295
522 Ga0207661_10035323
523 Ga0207679_10294952
524 Ga0207667_10174354
525 Ga0207712_10053648
526 Ga0207712_10459634
527 Ga0207668_10114554
528 Ga0207640_10251743
529 Ga0207658_10103482
530 Ga0207677_10039530
531 Ga0207703_10281408
532 Ga0207678_10397538
533 Ga0207676_10716174
534 Ga0207674_10007885
535 Ga0207683_10232952
536 Ga0207698_11033236
537 Ga0209813_10001259
538 Ga0209813_10036494
539 Ga0207428_10026441
540 Ga0268266_10133734
541 Ga0268265_10167135
542 Ga0268265_10862660
543 Ga0268264_10180516
544 Ga0307408_100946085
545 Ga0307405_10182869
546 Ga0307409_100141685
547 Ga0307416_100190479
548 Ga0307414_11013230
549 Ga0316583_10135820
550 Ga0395899_0068476
551 Ga0395900_0161478
552 Ga0395900_0166868
553 Ga0395898_0167546
554 Ga0395898_1425711
555 Ga0395905_0544197
556 Ga0395901_0037698
557 Ga0395901_0682426
558 Ga0395901_0844226
559 Ga0439459_0079888
560 Ga0466969_0040479
561 Ga0466972_0047584
562 Ga0466972_0057067
563 Ga0466965_0068512
564 Ga0466965_0110744
565 Ga0466965_0316544
566 Ga0466966_0039877
567 Ga0466966_0110684
568 Ga0466966_0217407
569 Ga0466966_0363378
570 Ga0466961_0054488
571 Ga0466963_0014925
572 Ga0466963_0038310
573 Ga0466963_0052744
574 Ga0466963_0055948
575 Ga0466963_0103205
576 Ga0466963_0250723
577 Ga0466964_0092427
578 Ga0466971_0085652
579 Ga0466971_0390622
580 Ga0466970_0006267
581 Ga0466970_0027445
582 Ga0466970_0450013
583 Ga0466957_0015381
584 Ga0466957_0071957
585 Ga0466957_0100014
586 Ga0466957_0140858
587 Ga0466960_0041225
588 Ga0466958_0035228
589 Ga0466967_0016500
590 Ga0466967_0032685
591 Ga0466967_0245783
592 Ga0466967_0302529
593 Ga0466967_0619632
594 Ga0466967_0706714
595 Ga0466967_0738154
596 Ga0496100_0188084
597 Ga0496101_0323911
598 Ga0496102_0006010
599 Ga0496102_0077779
600 Ga0496102_0365063
601 Ga0496102_0408523
602 Ga0496102_0734535
603 Ga0496104_0001924
604 Ga0496105_0006703
605 Ga0496106_0021861
606 Ga0496106_0586437
607 Ga0496107_0214502
608 Ga0496108_0107240
609 Ga0496108_0109188
610 Ga0496108_0336719
611 Ga0496108_0561687
612 Ga0496109_0015523
613 Ga0496109_0054581
614 Ga0496109_0074061
615 Ga0496110_0119688
616 Ga0496110_0346766
617 Ga0496110_0464892
618 Ga0496111_0025305
619 Ga0496113_0229730
620 Ga0496113_0256571
621 Ga0496113_0960391
622 Ga0496114_0004325
623 Ga0496114_0016698
624 Ga0496114_0036408
625 Ga0496114_0057464
626 Ga0496114_0184087
627 Ga0496114_0631101
628 Ga0496115_0002147
629 Ga0496115_0023465
630 Ga0501031_0001642
631 Ga0501031_0064346
632 Ga0501032_0006927
633 Ga0501032_0094440
634 Ga0501032_0131667
635 Ga0501032_0435214
636 Ga0501033_0007518
637 Ga0501033_0295848
638 Ga0501034_0038785
639 Ga0501034_0047187
640 Ga0501034_0175894
641 Ga0501034_0180685
642 Ga0501036_0000932
643 Ga0501036_0015691
644 Ga0501036_0033374
645 Ga0501036_0033623
646 Ga0501036_0222871
647 Ga0501036_0424120
648 Ga0501037_0007343
649 Ga0501037_0042587
650 Ga0501037_0076456
651 Ga0501038_0004339
652 Ga0501038_0059666
653 Ga0501038_0081060
654 Ga0501038_0305211
655 Ga0501039_0029590
656 Ga0501039_0259366
657 Ga0501039_0598219
658 Ga0501040_0205074
659 Ga0501041_0072446
660 Ga0501042_0004821
661 Ga0501042_0028849
662 Ga0501042_0066578
663 Ga0501042_0112533
664 Ga0501043_0014184
665 Ga0501043_0096215
666 Ga0501043_0106823
667 Ga0501043_0511058
668 Ga0501046_0004200
669 Ga0501046_0008169
670 Ga0501046_0057009
671 Ga0501047_0107534
672 Ga0501047_0119068
673 Ga0501047_0193434
674 Ga0501047_0404587
675 Ga0501048_0006990
676 Ga0501048_0064967
677 Ga0501048_0223473
678 Ga0501067_0001156
679 Ga0501067_0006725
680 Ga0501067_0065393
681 Ga0501067_0072492
682 Ga0501068_0012603
683 Ga0501068_0041671
684 Ga0501068_0277450
685 Ga0501069_0023452
686 Ga0501069_0043680
687 Ga0501069_0075596
688 Ga0501069_0123185
689 Ga0501069_0223285
690 Ga0501070_0000763
691 Ga0501070_0005883
692 Ga0501070_0010991
693 Ga0501070_0064255
694 Ga0501070_0176996
695 Ga0501070_0293711
696 Ga0501070_0331595
697 Ga0501071_0023004
698 Ga0501071_0029379
699 Ga0501071_0065698
700 Ga0501071_0699507
701 Ga0501072_0005676
702 Ga0501072_0046965
703 Ga0501072_0091170
704 Ga0501072_0098165
705 Ga0501072_0158279
706 Ga0501073_0013695
707 Ga0501073_0072192
708 Ga0501073_0072512
709 Ga0501073_0342290
710 Ga0501073_0359106
711 Ga0501074_0002380
712 Ga0501074_0029652
713 Ga0501074_0030826
714 Ga0501074_0060525
715 Ga0501074_0073957
716 Ga0501075_0358377
717 Ga0501076_0006688
718 Ga0501076_0372633
719 Ga0501077_0029045
720 Ga0501077_0164599
721 Ga0501079_0054564
722 Ga0501079_0071594
723 Ga0501079_0079245
724 Ga0501079_0086540
725 Ga0501080_0003278
726 Ga0501080_0035557
727 Ga0501080_0041655
728 Ga0501080_0065231
729 Ga0501081_0060548
730 Ga0501081_0136448
731 Ga0501083_0001818
732 Ga0501083_0112798
733 Ga0501083_0145644
734 Ga0501035_0004929
735 Ga0501035_0013556
736 Ga0501035_0127689
737 Ga0501035_0199089
738 Ga0501044_0012752
739 Ga0501044_0384663
740 Ga0501044_0430834
741 Ga0501045_0005967
742 Ga0501045_0119914
743 Ga0501045_0144732
744 nmdc:mga03683_56976_c1
745 nmdc:mga03n38_1506_c1
746 nmdc:mga03n38_16627_c1
747 nmdc:mga03n38_70011_c1
748 nmdc:mga00v17_133435_c1
749 nmdc:mga00v17_15826_c1
750 nmdc:mga00v17_167477_c1
751 nmdc:mga00v17_24837_c1
752 nmdc:mga00v17_333007_c1
753 nmdc:mga00v17_64541_c1
754 nmdc:mga0yw44_120394_c1
755 nmdc:mga0yw44_278434_c1
756 nmdc:mga0yw44_479_c1
757 nmdc:mga06z11_133007_c1
758 nmdc:mga06z11_212969_c1
759 nmdc:mga06z11_31816_c1
760 nmdc:mga04h51_46695_c1
761 nmdc:mga04h51_865_c1
762 nmdc:mga07m45_46496_c1
763 nmdc:mga07m45_75402_c1
764 nmdc:mga05p37_997_c1
765 nmdc:mga09592_1183_c1
766 nmdc:mga0qj67_344598_c1
767 nmdc:mga06r32_751_c1
768 nmdc:mga08y16_10418_c1
769 nmdc:mga0a205_53885_c1
770 Ga0500644_0009258
771 Ga0501084_0009712
772 Ga0501084_0030191
773 Ga0501084_0207158
774 Ga0501082_0020495
775 Ga0501082_0081274
776 Ga0501082_0083959
777 Ga0501082_0167586
778 Ga0501082_0399421
779 Ga0501082_0407219
780 Ga0466962_0237973
781 Ga0530510_0086120
782 Ga0530510_0317703
783 2643891628
784 2643960676
785 2644035808
786 2812333189

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01330

RuvA_N

RuvA N terminal domain

1

44

0.99

PF14520

HHH_5

Helix-hairpin-helix domain

54

112

0.96

PF07499

RuvA_C

RuvA, C-terminal domain

133

183

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zte-assembly1.cif.gz_A mtruva form iv 0.981 1 130
1d8l-assembly1.cif.gz_A e. coli holliday junction binding protein ruva nh2 region lacking domain iii 0.9737 1 130
7pbu-assembly1.cif.gz_F ruvab branch migration motor complexed to the holliday junction - ruva-hj core [t2 dataset] 0.9617 1 132
7x7q-assembly1.cif.gz_G cryoem structure of ruva-ruvb-holliday junction complex 0.9538 1 130
2zte-assembly1.cif.gz_A mtruva form iv 0.9522 1 130
ID Description Score Start End Superfamily
2ztdA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9779 1 64 2.40.50.140
1d8lB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9738 1 64 2.40.50.140
2zteA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9694 64 130 1.10.150.20
2h5xD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9621 66 132 1.10.150.20
2h5xB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9588 66 132 1.10.150.20
ID Description Score Start End GO Terms
AF-A0A355BKX3-F1-model_v4 Holliday junction branch migration protein RuvA 0.9961 1 62 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-W1V4X5-F1-model_v4 Holliday junction ATP-dependent DNA helicase RuvA 0.9936 1 66 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A349AWV7-F1-model_v4 Holliday junction branch migration protein RuvA 0.9858 1 103 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
AF-A0A505VC93-F1-model_v4 deleted 0.9835 1 64
AF-A0A7V2NQE7-F1-model_v4 Holliday junction branch migration protein RuvA (EC 3.6.4.12) 0.9808 1 132 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518

Map