F432702

General Info

Members Datasets Scaffolds Average Seq Length
393 232 393 188

Family's Representative Sequence

Representative Sequence 3300047322|Ga0495680_0539112|Ga0495680_0539112_95_766
Length 223
Sequence MQWTRDRARRCLCLATAGRPHHLTVSPHDAKEIPVSHALGTSSATAKPFLTDVKTLRERTRKNLSEGVVTTTYGGDVKRTIEILQSVLATEIVCVLRYTMHAVAATGISSEAIKAEFAEHAREEQEHMMSVAERINQLGGTPNFNPEGLATRSASQYAEGENLVDMIKENLIAERIAVDHYRELIRYFGDDDPATRVMLQGILATEEEHASDMLDLLEAHQGR

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
102 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
115 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
229 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.42
Metatranscriptomes 4.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.33
Nodule 0
Rhizoplane 2.29
Rhizosphere 85.5
Stem 0
Stem Tuber 0
Unclassified 7.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10081408 3300003187 Bacteria 935
2 JGI25153J46596_10001380 3300003215 Bacteria 14525
3 Ga0055524_1014743 3300003775 Bacteria 2881
4 Ga0058861_11383358 3300004800 Bacteria 613
5 Ga0058862_10062104 3300004803 Unclassified 1262
6 Ga0058862_12798699 3300004803 Bacteria 675
7 Ga0065712_10018719 3300005290 Bacteria 2033
8 Ga0065715_10387078 3300005293 Unclassified 883
9 Ga0070658_10010818 3300005327 Bacteria 7314
10 Ga0070683_100202211 3300005329 Bacteria 1886
11 Ga0070683_100263413 3300005329 Unclassified 1640
12 Ga0070690_100250069 3300005330 Bacteria 1253
13 Ga0070670_100311712 3300005331 Bacteria 1377
14 Ga0070666_10057065 3300005335 Bacteria 2638
15 Ga0070666_10095832 3300005335 Unclassified 2042
16 Ga0070666_10387746 3300005335 Bacteria 1003
17 Ga0070680_100009878 3300005336 Bacteria 7346
18 Ga0070680_100121777 3300005336 Unclassified 2178
19 Ga0070682_100000051 3300005337 Bacteria 123476
20 Ga0070682_100075660 3300005337 Bacteria 2166
21 Ga0070660_100154645 3300005339 Bacteria 1846
22 Ga0070660_100914323 3300005339 Bacteria 740
23 Ga0070689_101019727 3300005340 Bacteria 737
24 Ga0070687_100255166 3300005343 Bacteria 1091
25 Ga0070661_100003057 3300005344 Bacteria 11512
26 Ga0070692_10051485 3300005345 Bacteria 2142
27 Ga0070675_100384839 3300005354 Unclassified 1249
28 Ga0070671_100100026 3300005355 Bacteria 2433
29 Ga0070671_100268139 3300005355 Unclassified 1451
30 Ga0070674_100035833 3300005356 Bacteria 3326
31 Ga0070674_100841785 3300005356 Bacteria 795
32 Ga0070673_100251598 3300005364 Bacteria 1540
33 Ga0070673_101199772 3300005364 Bacteria 711
34 Ga0070688_100161552 3300005365 Bacteria 1539
35 Ga0070688_100383932 3300005365 Bacteria 1036
36 Ga0070659_100451906 3300005366 Bacteria 1090
37 Ga0070667_100564765 3300005367 Bacteria 1047
38 Ga0070714_100040876 3300005435 Bacteria 3909
39 Ga0070714_100082989 3300005435 Bacteria 2793
40 Ga0070714_100113434 3300005435 Bacteria 2403
41 Ga0070714_100148804 3300005435 Bacteria 2108
42 Ga0070705_100181230 3300005440 Bacteria 1427
43 Ga0070705_100231305 3300005440 Bacteria 1286
44 Ga0070705_100626277 3300005440 Bacteria 836
45 Ga0070700_100017407 3300005441 Bacteria 4109
46 Ga0070700_100674901 3300005441 Bacteria 818
47 Ga0070663_100339548 3300005455 Bacteria 1213
48 Ga0070678_100162915 3300005456 Bacteria 1809
49 Ga0070678_100772979 3300005456 Bacteria 870
50 Ga0070678_100870718 3300005456 Bacteria 822
51 Ga0070662_100219887 3300005457 Bacteria 1515
52 Ga0070681_10021846 3300005458 Bacteria 6418
53 Ga0070681_10047357 3300005458 Bacteria 4298
54 Ga0070681_10228765 3300005458 Unclassified 1774
55 Ga0070681_10404211 3300005458 Bacteria 1277
56 Ga0068867_100017779 3300005459 Bacteria 5048
57 Ga0070706_100043141 3300005467 Unclassified 4166
58 Ga0070706_100690179 3300005467 Bacteria 947
59 Ga0070707_100356327 3300005468 Bacteria 1421
60 Ga0070699_100156562 3300005518 Bacteria 2016
61 Ga0070679_100053410 3300005530 Bacteria 4022
62 Ga0070679_100069932 3300005530 Bacteria 3502
63 Ga0070684_100066578 3300005535 Bacteria 3162
64 Ga0070684_100101532 3300005535 Bacteria 2570
65 Ga0070697_100594135 3300005536 Bacteria 973
66 Ga0070697_100716360 3300005536 Bacteria 883
67 Ga0068853_100066306 3300005539 Bacteria 3134
68 Ga0068853_100708109 3300005539 Bacteria 961
69 Ga0070672_100434148 3300005543 Bacteria 1129
70 Ga0070686_100112314 3300005544 Bacteria 1858
71 Ga0070695_100043882 3300005545 Bacteria 2844
72 Ga0070695_100072232 3300005545 Bacteria 2262
73 Ga0070696_100006198 3300005546 Bacteria 7999
74 Ga0070693_100092969 3300005547 Bacteria 1822
75 Ga0070693_100102918 3300005547 Bacteria 1743
76 Ga0070665_100178040 3300005548 Bacteria 2127
77 Ga0070665_100285686 3300005548 Bacteria 1652
78 Ga0068855_100214929 3300005563 Bacteria 2159
79 Ga0068855_100236694 3300005563 Bacteria 2042
80 Ga0068855_100540416 3300005563 Bacteria 1262
81 Ga0068855_100838614 3300005563 Archaea 975
82 Ga0068855_101436880 3300005563 Bacteria 710
83 Ga0070664_100005931 3300005564 Bacteria 9868
84 Ga0070664_100661866 3300005564 Unclassified 971
85 Ga0068857_100063545 3300005577 Bacteria 3282
86 Ga0068854_100230434 3300005578 Bacteria 1470
87 Ga0068854_100297718 3300005578 Bacteria 1304
88 Ga0068854_101385572 3300005578 Bacteria 635
89 Ga0068856_100042213 3300005614 Bacteria 4486
90 Ga0068856_100171712 3300005614 Bacteria 2180
91 Ga0070702_100027667 3300005615 Bacteria 3063
92 Ga0068852_100197317 3300005616 Bacteria 1903
93 Ga0068859_100534287 3300005617 Bacteria 1267
94 Ga0068864_100089603 3300005618 Bacteria 2710
95 Ga0068864_100499908 3300005618 Bacteria 1169
96 Ga0068864_100658728 3300005618 Bacteria 1020
97 Ga0068866_10016774 3300005718 Bacteria 3281
98 Ga0068861_100098668 3300005719 Bacteria 2319
99 Ga0068870_10071690 3300005840 Bacteria 1891
100 Ga0068863_100191888 3300005841 Bacteria 1963
101 Ga0068858_100575926 3300005842 Bacteria 1091
102 Ga0068860_100032686 3300005843 Bacteria 4999
103 Ga0068860_100996838 3300005843 Bacteria 855
104 Ga0068862_100550992 3300005844 Bacteria 1101
105 Ga0081539_10100678 3300005985 Bacteria 1473
106 Ga0070717_10104934 3300006028 Bacteria 2405
107 Ga0075364_10474850 3300006051 Bacteria 855
108 Ga0070715_10177020 3300006163 Bacteria 1067
109 Ga0070716_100450971 3300006173 Bacteria 938
110 Ga0070712_100916318 3300006175 Bacteria 756
111 Ga0097621_100062767 3300006237 Bacteria 3051
112 Ga0097621_100741048 3300006237 Bacteria 907
113 Ga0068871_100260577 3300006358 Bacteria 1512
114 Ga0075434_100269786 3300006871 Bacteria 1721
115 Ga0068865_100011598 3300006881 Bacteria 5522
116 Ga0068865_100876889 3300006881 Bacteria 779
117 Ga0075436_100161690 3300006914 Bacteria 1579
118 Ga0097620_100534285 3300006931 Bacteria 1267
119 Ga0105240_10010977 3300009093 Bacteria 12686
120 Ga0105240_10253794 3300009093 Bacteria 2032
121 Ga0105240_10256781 3300009093 Bacteria 2018
122 Ga0105240_10318737 3300009093 Bacteria 1773
123 Ga0105240_10348150 3300009093 Bacteria 1681
124 Ga0105240_10365163 3300009093 Bacteria 1634
125 Ga0105240_10397950 3300009093 Unclassified 1552
126 Ga0105240_10401836 3300009093 Bacteria 1543
127 Ga0105240_10773580 3300009093 Bacteria 1042
128 Ga0111539_11189521 3300009094 Bacteria 885
129 Ga0105243_10009791 3300009148 Bacteria 7296
130 Ga0105243_10516722 3300009148 Bacteria 1135
131 Ga0105241_10146998 3300009174 Bacteria 1924
132 Ga0105241_10181938 3300009174 Bacteria 1744
133 Ga0105242_10002254 3300009176 Bacteria 15218
134 Ga0105242_10069861 3300009176 Bacteria 2910
135 Ga0105242_10787329 3300009176 Bacteria 940
136 Ga0105248_10363312 3300009177 Bacteria 1630
137 Ga0105248_10562201 3300009177 Unclassified 1287
138 Ga0105248_10963662 3300009177 Bacteria 963
139 Ga0105237_10056440 3300009545 Bacteria 3931
140 Ga0105238_10084285 3300009551 Bacteria 3168
141 Ga0105238_10122384 3300009551 Bacteria 2581
142 Ga0105238_10354352 3300009551 Bacteria 1456
143 Ga0105238_10380106 3300009551 Bacteria 1404
144 Ga0105238_10616538 3300009551 Unclassified 1093
145 Ga0105249_10176021 3300009553 Bacteria 2078
146 Ga0105249_10418214 3300009553 Bacteria 1374
147 Ga0105249_10784987 3300009553 Bacteria 1016
148 Ga0099796_10125127 3300010159 Bacteria 992
149 Ga0105239_10072581 3300010375 Bacteria 3784
150 Ga0105239_10361437 3300010375 Bacteria 1640
151 Ga0105239_10720349 3300010375 Bacteria 1141
152 Ga0157373_10474584 3300013100 Unclassified 902
153 Ga0157371_10192342 3300013102 Unclassified 1461
154 Ga0157369_10036464 3300013105 Bacteria 5386
155 Ga0157378_10049903 3300013297 Bacteria 3723
156 Ga0157378_10502863 3300013297 Unclassified 1211
157 Ga0163162_10833729 3300013306 Bacteria 1038
158 Ga0163162_10907950 3300013306 Bacteria 994
159 Ga0157372_10178995 3300013307 Bacteria 2454
160 Ga0157372_10192916 3300013307 Bacteria 2359
161 Ga0157372_10515554 3300013307 Bacteria 1394
162 Ga0157372_11949502 3300013307 Bacteria 675
163 Ga0157375_10160198 3300013308 Bacteria 2392
164 Ga0157375_10713633 3300013308 Bacteria 1156
165 Ga0157375_11465647 3300013308 Unclassified 805
166 Ga0157375_11741620 3300013308 Bacteria 738
167 Ga0163163_10019568 3300014325 Bacteria 6360
168 Ga0163163_10437719 3300014325 Unclassified 1367
169 Ga0157380_10071103 3300014326 Bacteria 2814
170 Ga0157377_10626032 3300014745 Bacteria 771
171 Ga0157379_10000302 3300014968 Bacteria 39090
172 Ga0157376_10025069 3300014969 Bacteria 4693
173 Ga0157376_10305504 3300014969 Bacteria 1507
174 Ga0197907_10516917 3300020069 Bacteria 723
175 Ga0197907_10911782 3300020069 Bacteria 1215
176 Ga0206349_1390521 3300020075 Bacteria 813
177 Ga0206355_1032658 3300020076 Bacteria 635
178 Ga0206355_1550509 3300020076 Bacteria 1872
179 Ga0206351_10013487 3300020077 Bacteria 1186
180 Ga0206352_11155686 3300020078 Unclassified 1035
181 Ga0206350_10613185 3300020080 Archaea 945
182 Ga0206354_10441615 3300020081 Unclassified 1190
183 Ga0206353_11630308 3300020082 Unclassified 793
184 Ga0213873_10003876 3300021358 Bacteria 2740
185 Ga0213873_10057123 3300021358 Bacteria 1047
186 Ga0213872_10002472 3300021361 Bacteria 10833
187 Ga0213872_10025385 3300021361 Bacteria 2724
188 Ga0213874_10000119 3300021377 Bacteria 13057
189 Ga0213874_10020580 3300021377 Bacteria 1810
190 Ga0213874_10029066 3300021377 Bacteria 1584
191 Ga0213874_10193024 3300021377 Bacteria 729
192 Ga0213876_10006268 3300021384 Bacteria 6484
193 Ga0213876_10228507 3300021384 Bacteria 989
194 Ga0213876_10236980 3300021384 Bacteria 970
195 Ga0213875_10000001 3300021388 Bacteria 2793540
196 Ga0213875_10003662 3300021388 Bacteria 8682
197 Ga0213875_10021861 3300021388 Bacteria 3061
198 Ga0213875_10358513 3300021388 Bacteria 693
199 Ga0213871_10008909 3300021441 Bacteria 2229
200 Ga0213871_10043574 3300021441 Bacteria 1211
201 Ga0224712_10052178 3300022467 Bacteria 1596
202 Ga0224712_10274948 3300022467 Bacteria 783
203 Ga0224712_10405814 3300022467 Bacteria 650
204 Ga0224572_1004184 3300024225 Bacteria 2494
205 Ga0209565_1001699 3300025263 Bacteria 9085
206 Ga0209675_1010332 3300025291 Bacteria 3198
207 Ga0209025_1003194 3300025294 Bacteria 15900
208 Ga0209758_1000008 3300025297 Bacteria 1215263
209 Ga0209256_1000905 3300025299 Bacteria 36349
210 Ga0209051_1001616 3300025303 Bacteria 18379
211 Ga0207653_10087637 3300025885 Bacteria 1086
212 Ga0207680_10164896 3300025903 Bacteria 1488
213 Ga0207647_10568477 3300025904 Bacteria 628
214 Ga0207699_10195481 3300025906 Bacteria 1367
215 Ga0207705_10125801 3300025909 Bacteria 1905
216 Ga0207684_10143688 3300025910 Unclassified 2052
217 Ga0207707_10025674 3300025912 Bacteria 5153
218 Ga0207707_10170854 3300025912 Bacteria 1900
219 Ga0207695_10001655 3300025913 Bacteria 35911
220 Ga0207695_10176885 3300025913 Bacteria 2056
221 Ga0207695_10435819 3300025913 Unclassified 1194
222 Ga0207695_10693218 3300025913 Bacteria 899
223 Ga0207695_10768715 3300025913 Bacteria 844
224 Ga0207671_10067003 3300025914 Bacteria 2673
225 Ga0207671_10279324 3300025914 Bacteria 1317
226 Ga0207693_10110747 3300025915 Bacteria 2153
227 Ga0207660_10020944 3300025917 Bacteria 4393
228 Ga0207660_10237950 3300025917 Unclassified 1434
229 Ga0207657_10005146 3300025919 Bacteria 13710
230 Ga0207649_10080104 3300025920 Bacteria 2111
231 Ga0207652_10068061 3300025921 Bacteria 3088
232 Ga0207652_10111209 3300025921 Bacteria 2429
233 Ga0207694_10078411 3300025924 Bacteria 2589
234 Ga0207694_10104864 3300025924 Bacteria 2244
235 Ga0207650_10347522 3300025925 Bacteria 1219
236 Ga0207664_10024463 3300025929 Bacteria 4538
237 Ga0207664_10415809 3300025929 Bacteria 1197
238 Ga0207690_10248942 3300025932 Bacteria 1372
239 Ga0207706_10178624 3300025933 Bacteria 1864
240 Ga0207706_10631365 3300025933 Unclassified 919
241 Ga0207686_10089637 3300025934 Bacteria 2028
242 Ga0207686_10346195 3300025934 Bacteria 1118
243 Ga0207704_10472555 3300025938 Bacteria 1005
244 Ga0207665_10358828 3300025939 Bacteria 1102
245 Ga0207711_10185821 3300025941 Bacteria 1892
246 Ga0207711_10215562 3300025941 Bacteria 1754
247 Ga0207711_10232109 3300025941 Bacteria 1690
248 Ga0207661_10334801 3300025944 Unclassified 1363
249 Ga0207679_10005382 3300025945 Bacteria 8023
250 Ga0207679_10593056 3300025945 Unclassified 998
251 Ga0207667_10739015 3300025949 Bacteria 984
252 Ga0207712_10120159 3300025961 Bacteria 1987
253 Ga0207703_10316499 3300026035 Bacteria 1428
254 Ga0207639_10058420 3300026041 Bacteria 2967
255 Ga0207678_10236391 3300026067 Bacteria 1565
256 Ga0207702_10115282 3300026078 Bacteria 2396
257 Ga0207674_10174075 3300026116 Bacteria 2105
258 Ga0207674_10263093 3300026116 Bacteria 1672
259 Ga0207674_10431892 3300026116 Bacteria 1273
260 Ga0207675_100953425 3300026118 Bacteria 875
261 Ga0207683_10166074 3300026121 Bacteria 1997
262 Ga0207683_10351765 3300026121 Bacteria 1352
263 Ga0207683_11148105 3300026121 Unclassified 720
264 Ga0207698_10146827 3300026142 Bacteria 2041
265 Ga0207428_10319885 3300027907 Bacteria 1146
266 Ga0268266_10181107 3300028379 Bacteria 1918
267 Ga0268266_11257130 3300028379 Bacteria 715
268 Ga0268264_10022213 3300028381 Bacteria 5180
269 Ga0265318_10140842 3300028577 Bacteria 886
270 Ga0265338_10000193 3300028800 Bacteria 115132
271 Ga0265338_10056935 3300028800 Bacteria 3462
272 Ga0265338_10236680 3300028800 Bacteria 1355
273 Ga0265332_10061548 3300031238 Bacteria 1605
274 Ga0265325_10001717 3300031241 Bacteria 15223
275 Ga0265340_10089538 3300031247 Bacteria 1440
276 Ga0265339_10048650 3300031249 Bacteria 2324
277 Ga0265331_10065696 3300031250 Bacteria 1705
278 Ga0265327_10169719 3300031251 Unclassified 1003
279 Ga0265316_10114783 3300031344 Bacteria 2037
280 Ga0265313_10000039 3300031595 Bacteria 120922
281 Ga0265314_10055372 3300031711 Bacteria 2738
282 Ga0265314_10396416 3300031711 Unclassified 747
283 Ga0265342_10002123 3300031712 Bacteria 17477
284 Ga0373944_0204441 3300035089 Bacteria 716
285 Ga0373937_0186355 3300036401 Unclassified 1949
286 Ga0373937_0454311 3300036401 Bacteria 1217
287 Ga0373925_0002920 3300037068 Bacteria 13481
288 Ga0395899_0000070 3300037312 Bacteria 189668
289 Ga0395900_0088550 3300037418 Bacteria 3183
290 Ga0395900_0237214 3300037418 Bacteria 1831
291 Ga0395900_0568254 3300037418 Bacteria 1077
292 Ga0395898_0004784 3300037466 Bacteria 14731
293 Ga0395898_0005032 3300037466 Bacteria 14335
294 Ga0395898_0055232 3300037466 Bacteria 3874
295 Ga0395905_0012907 3300037471 Bacteria 8031
296 Ga0395905_0418904 3300037471 Bacteria 1235
297 Ga0436364_0273345 3300037853 Bacteria 2794207
298 Ga0436364_1148342 3300037853 Bacteria 929
299 Ga0436364_1149520 3300037853 Bacteria 10666
300 Ga0436364_1373065 3300037853 Bacteria 915
301 Ga0436364_1450991 3300037853 Bacteria 17355
302 Ga0395901_0171042 3300038443 Bacteria 2280
303 Ga0395901_0267948 3300038443 Bacteria 1777
304 Ga0395901_0494493 3300038443 Bacteria 1246
305 Ga0436365_0218820 3300039437 Bacteria 38620
306 Ga0436365_0343078 3300039437 Bacteria 3288
307 Ga0436365_0818086 3300039437 Bacteria 1020
308 Ga0436365_1553829 3300039437 Bacteria 9731
309 Ga0436365_1774095 3300039437 Bacteria 1211
310 Ga0436360_0365988 3300039438 Bacteria 856
311 Ga0436360_0372078 3300039438 Bacteria 1217
312 Ga0436360_0501955 3300039438 Bacteria 5618
313 Ga0436360_0857744 3300039438 Bacteria 3067
314 Ga0436360_0867561 3300039438 Bacteria 1209
315 Ga0436360_1272743 3300039438 Bacteria 1843
316 Ga0436361_0003286 3300039447 Bacteria 1880
317 Ga0436361_0011345 3300039447 Bacteria 39413
318 Ga0436361_0156093 3300039447 Bacteria 1493
319 Ga0436361_0592342 3300039447 Bacteria 31658
320 Ga0436361_1116328 3300039447 Unclassified 1092
321 Ga0436361_1146136 3300039447 Bacteria 1569
322 Ga0436363_0504700 3300039450 Bacteria 987
323 Ga0436363_0506728 3300039450 Bacteria 901
324 Ga0436363_0608791 3300039450 Bacteria 1315
325 Ga0436363_0650287 3300039450 Bacteria 2498
326 Ga0436363_0789833 3300039450 Bacteria 16693
327 Ga0436363_0931737 3300039450 Bacteria 1897
328 Ga0436363_1332270 3300039450 Bacteria 734
329 Ga0436363_1413874 3300039450 Bacteria 2497
330 Ga0436362_0271798 3300039453 Bacteria 10279
331 Ga0436362_0304886 3300039453 Bacteria 1912
332 Ga0436362_0315812 3300039453 Bacteria 4049
333 Ga0436362_0358793 3300039453 Bacteria 816
334 Ga0436362_0552020 3300039453 Bacteria 1066
335 Ga0436362_0823235 3300039453 Bacteria 1034
336 Ga0436362_0868538 3300039453 Bacteria 820
337 Ga0451839_0368439 3300041496 Bacteria 949
338 Ga0453684_1438898 3300044712 Bacteria 713
339 Ga0451576_0162067 3300045051 Bacteria 2334
340 Ga0451576_0585005 3300045051 Bacteria 1173
341 Ga0495629_0052919 3300046459 Bacteria 2841
342 Ga0495580_0082123 3300046472 Bacteria 2246
343 Ga0495610_0071711 3300046512 Bacteria 1614
344 Ga0495648_0187439 3300046524 Unclassified 1046
345 Ga0495663_0000808 3300046525 Bacteria 10703
346 Ga0495598_0000259 3300046537 Bacteria 9519
347 Ga0495621_0000089 3300046539 Bacteria 18610
348 Ga0495621_0112960 3300046539 Bacteria 1043
349 Ga0495622_0014424 3300046557 Bacteria 3668
350 Ga0495656_0124802 3300046615 Bacteria 1219
351 Ga0495656_0191297 3300046615 Bacteria 1011
352 Ga0495668_0251830 3300046616 Bacteria 967
353 Ga0495635_0103583 3300046663 Bacteria 1945
354 Ga0495635_0175505 3300046663 Bacteria 1457
355 Ga0495661_0123746 3300046665 Bacteria 1425
356 Ga0495658_0009144 3300046683 Bacteria 4926
357 Ga0495670_0174166 3300046691 Bacteria 1134
358 Ga0495600_0349129 3300046809 Bacteria 927
359 Ga0495636_0044842 3300047318 Bacteria 1842
360 Ga0495674_0592510 3300047319 Bacteria 879
361 Ga0495680_0539112 3300047322 Bacteria 788
362 Ga0495681_0187549 3300047470 Bacteria 846
363 Ga0495684_0019080 3300047471 Bacteria 5281
364 Ga0495684_0332160 3300047471 Bacteria 1084
365 Ga0496100_0314434 3300048903 Bacteria 1175
366 Ga0496100_0357932 3300048903 Bacteria 1104
367 Ga0496101_1070817 3300048904 Bacteria 633
368 Ga0496104_0478816 3300048907 Bacteria 1156
369 Ga0496106_0274221 3300048909 Bacteria 1351
370 Ga0496107_0199090 3300048910 Bacteria 1489
371 Ga0496108_0809269 3300048911 Bacteria 808
372 Ga0496109_0475682 3300048912 Bacteria 1180
373 Ga0496115_0595256 3300048918 Bacteria 880
374 Ga0496120_0092138 3300048923 Bacteria 1617
375 Ga0501047_0537042 3300049581 Bacteria 994
376 Ga0501072_0231312 3300049588 Bacteria 1473
377 Ga0501044_0434928 3300049823 Bacteria 1221
378 nmdc:mga00v17_143827_c1 3300050491 Bacteria 1530
379 nmdc:mga05p37_137016_c1 3300050507 Bacteria 3000
380 nmdc:mga05p37_469491_c1 3300050507 Bacteria 1452
381 nmdc:mga06r32_1045216_c1 3300050510 Bacteria 768
382 nmdc:mga08y16_943233_c1 3300050511 Bacteria 846
383 nmdc:mga0n895_755058_c1 3300050512 Bacteria 965
384 nmdc:mga08x19_116730_c1 3300050514 Bacteria 1785
385 nmdc:mga08x19_631358_c1 3300050514 Bacteria 759
386 Ga0500562_080122 3300053108 Bacteria 883
387 Ga0500595_006794 3300053119 Bacteria 4818
388 Ga0500595_010322 3300053119 Bacteria 3718
389 Ga0500559_0087644 3300053136 Bacteria 1422
390 Ga0500573_0000009 3300053140 Bacteria 230823
391 Ga0500645_043787 3300053730 Bacteria 1318
392 Ga0587076_078938 3300059645 Bacteria 698
393 Ga0587114_021826 3300059655 Bacteria 911

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005290 Ga0065712_10018719 Ga0065712_100187191 178
2 3300005330 Ga0070690_100250069 Ga0070690_1002500692 178
3 3300005343 Ga0070687_100255166 Ga0070687_1002551661 178
4 3300005345 Ga0070692_10051485 Ga0070692_100514852 178
5 3300005355 Ga0070671_100100026 Ga0070671_1001000263 178
6 3300005356 Ga0070674_100035833 Ga0070674_1000358333 178
7 3300005367 Ga0070667_100564765 Ga0070667_1005647651 178
8 3300005440 Ga0070705_100181230 Ga0070705_1001812302 178
9 3300005441 Ga0070700_100017407 Ga0070700_1000174073 178
10 3300005456 Ga0070678_100162915 Ga0070678_1001629152 178
11 3300005459 Ga0068867_100017779 Ga0068867_1000177793 178
12 3300005468 Ga0070707_100356327 Ga0070707_1003563272 178
13 3300005543 Ga0070672_100434148 Ga0070672_1004341481 178
14 3300005544 Ga0070686_100112314 Ga0070686_1001123142 178
15 3300005545 Ga0070695_100043882 Ga0070695_1000438822 178
16 3300005545 Ga0070695_100072232 Ga0070695_1000722321 178
17 3300005546 Ga0070696_100006198 Ga0070696_1000061982 178
18 3300005547 Ga0070693_100102918 Ga0070693_1001029182 178
19 3300005578 Ga0068854_100230434 Ga0068854_1002304342 178
20 3300005615 Ga0070702_100027667 Ga0070702_1000276671 178
21 3300005617 Ga0068859_100534287 Ga0068859_1005342872 178
22 3300005618 Ga0068864_100499908 Ga0068864_1004999081 178
23 3300005718 Ga0068866_10016774 Ga0068866_100167742 178
24 3300005840 Ga0068870_10071690 Ga0068870_100716902 178
25 3300005841 Ga0068863_100191888 Ga0068863_1001918882 178
26 3300005843 Ga0068860_100996838 Ga0068860_1009968382 178
27 3300006237 Ga0097621_100062767 Ga0097621_1000627674 178
28 3300006881 Ga0068865_100011598 Ga0068865_1000115983 178
29 3300006931 Ga0097620_100534285 Ga0097620_1005342852 178
30 3300009148 Ga0105243_10516722 Ga0105243_105167222 178
31 3300009176 Ga0105242_10787329 Ga0105242_107873291 178
32 3300005364 Ga0070673_100251598 Ga0070673_1002515981 179
33 3300005365 Ga0070688_100161552 Ga0070688_1001615522 179
34 3300005365 Ga0070688_100383932 Ga0070688_1003839322 179
35 3300005440 Ga0070705_100231305 Ga0070705_1002313052 179
36 3300005441 Ga0070700_100674901 Ga0070700_1006749011 179
37 3300005467 Ga0070706_100690179 Ga0070706_1006901792 179
38 3300005518 Ga0070699_100156562 Ga0070699_1001565621 179
39 3300006871 Ga0075434_100269786 Ga0075434_1002697862 179
40 3300009094 Ga0111539_11189521 Ga0111539_111895211 179
41 3300009148 Ga0105243_10009791 Ga0105243_100097915 179
42 3300009174 Ga0105241_10146998 Ga0105241_101469982 179
43 3300009176 Ga0105242_10002254 Ga0105242_100022543 179
44 3300009177 Ga0105248_10963662 Ga0105248_109636621 179
45 3300009553 Ga0105249_10418214 Ga0105249_104182142 179
46 3300010375 Ga0105239_10072581 Ga0105239_100725812 179
47 3300013297 Ga0157378_10049903 Ga0157378_100499033 179
48 3300013306 Ga0163162_10833729 Ga0163162_108337291 179
49 3300013308 Ga0157375_10160198 Ga0157375_101601982 179
50 3300014325 Ga0163163_10019568 Ga0163163_100195685 179
51 3300014326 Ga0157380_10071103 Ga0157380_100711033 179
52 3300014969 Ga0157376_10025069 Ga0157376_100250692 179
53 3300038443 Ga0395901_0171042 Ga0395901_0171042_1049_1588 179
54 3300045051 Ga0451576_0585005 Ga0451576_0585005_254_793 179
55 3300046512 Ga0495610_0071711 Ga0495610_0071711_592_1131 179
56 3300046525 Ga0495663_0000808 Ga0495663_0000808_2680_3219 179
57 3300046539 Ga0495621_0000089 Ga0495621_0000089_17469_18008 179
58 3300050507 nmdc:mga05p37_137016_c1 nmdc:mga05p37_137016_c1_35_574 179
59 3300050511 nmdc:mga08y16_943233_c1 nmdc:mga08y16_943233_c1_163_708 179
60 3300005293 Ga0065715_10387078 Ga0065715_103870781 180
61 3300005331 Ga0070670_100311712 Ga0070670_1003117122 180
62 3300005337 Ga0070682_100000051 Ga0070682_10000005116 180
63 3300005355 Ga0070671_100268139 Ga0070671_1002681392 180
64 3300005467 Ga0070706_100043141 Ga0070706_1000431414 180
65 3300005563 Ga0068855_100214929 Ga0068855_1002149295 180
66 3300005618 Ga0068864_100658728 Ga0068864_1006587282 180
67 3300006237 Ga0097621_100741048 Ga0097621_1007410482 180
68 3300006358 Ga0068871_100260577 Ga0068871_1002605771 180
69 3300009093 Ga0105240_10348150 Ga0105240_103481502 180
70 3300009093 Ga0105240_10773580 Ga0105240_107735801 180
71 3300013308 Ga0157375_11741620 Ga0157375_117416201 180
72 3300014745 Ga0157377_10626032 Ga0157377_106260321 180
73 3300020077 Ga0206351_10013487 Ga0206351_100134872 180
74 3300021377 Ga0213874_10020580 Ga0213874_100205803 180
75 3300025910 Ga0207684_10143688 Ga0207684_101436882 180
76 3300025913 Ga0207695_10693218 Ga0207695_106932181 180
77 3300025933 Ga0207706_10631365 Ga0207706_106313651 180
78 3300026116 Ga0207674_10431892 Ga0207674_104318921 180
79 3300031247 Ga0265340_10089538 Ga0265340_100895381 180
80 3300037418 Ga0395900_0568254 Ga0395900_0568254_197_751 180
81 3300037471 Ga0395905_0012907 Ga0395905_0012907_3590_4144 180
82 3300037471 Ga0395905_0418904 Ga0395905_0418904_152_706 180
83 3300038443 Ga0395901_0494493 Ga0395901_0494493_516_1070 180
84 3300039450 Ga0436363_0504700 Ga0436363_0504700_39_596 180
85 3300039450 Ga0436363_0506728 Ga0436363_0506728_110_676 180
86 3300039450 Ga0436363_0608791 Ga0436363_0608791_168_725 180
87 3300039450 Ga0436363_1332270 Ga0436363_1332270_52_609 180
88 3300039450 Ga0436363_1413874 Ga0436363_1413874_1109_1666 180
89 3300039453 Ga0436362_0823235 Ga0436362_0823235_89_646 180
90 3300046537 Ga0495598_0000259 Ga0495598_0000259_6652_7218 180
91 3300046615 Ga0495656_0191297 Ga0495656_0191297_242_808 180
92 3300046616 Ga0495668_0251830 Ga0495668_0251830_65_631 180
93 3300049588 Ga0501072_0231312 Ga0501072_0231312_919_1461 180
94 3300053136 Ga0500559_0087644 Ga0500559_0087644_138_701 180
95 3300059645 Ga0587076_078938 Ga0587076_078938_52_606 180
96 3300004800 Ga0058861_11383358 Ga0058861_113833581 181
97 3300004803 Ga0058862_12798699 Ga0058862_127986991 181
98 3300014968 Ga0157379_10000302 Ga0157379_1000030216 181
99 3300020076 Ga0206355_1032658 Ga0206355_10326581 181
100 3300021388 Ga0213875_10021861 Ga0213875_100218612 181
101 3300022467 Ga0224712_10405814 Ga0224712_104058141 181
102 3300025941 Ga0207711_10185821 Ga0207711_101858212 181
103 3300028800 Ga0265338_10056935 Ga0265338_100569351 181
104 3300039450 Ga0436363_0931737 Ga0436363_0931737_776_1342 181
105 3300046557 Ga0495622_0014424 Ga0495622_0014424_3036_3602 181
106 3300046663 Ga0495635_0175505 Ga0495635_0175505_166_777 181
107 3300046809 Ga0495600_0349129 Ga0495600_0349129_206_817 181
108 3300047322 Ga0495680_0539112 Ga0495680_0539112_95_766 181
109 3300047471 Ga0495684_0019080 Ga0495684_0019080_2809_3420 181
110 3300048918 Ga0496115_0595256 Ga0496115_0595256_141_701 181
111 3300049823 Ga0501044_0434928 Ga0501044_0434928_612_1169 181
112 3300050510 nmdc:mga06r32_1045216_c1 nmdc:mga06r32_1045216_c1_161_706 181
113 3300053119 Ga0500595_010322 Ga0500595_010322_2431_2997 181
114 3300005435 Ga0070714_100040876 Ga0070714_1000408762 182
115 3300005440 Ga0070705_100626277 Ga0070705_1006262771 182
116 3300005536 Ga0070697_100594135 Ga0070697_1005941352 182
117 3300006914 Ga0075436_100161690 Ga0075436_1001616902 182
118 3300021358 Ga0213873_10057123 Ga0213873_100571231 182
119 3300021384 Ga0213876_10236980 Ga0213876_102369801 182
120 3300021441 Ga0213871_10008909 Ga0213871_100089093 182
121 3300024225 Ga0224572_1004184 Ga0224572_10041842 182
122 3300025885 Ga0207653_10087637 Ga0207653_100876372 182
123 3300025929 Ga0207664_10415809 Ga0207664_104158092 182
124 3300026116 Ga0207674_10174075 Ga0207674_101740753 182
125 3300037853 Ga0436364_1149520 Ga0436364_1149520_5934_6497 182
126 3300037853 Ga0436364_1373065 Ga0436364_1373065_137_703 182
127 3300039437 Ga0436365_0818086 Ga0436365_0818086_227_802 182
128 3300039437 Ga0436365_1774095 Ga0436365_1774095_176_742 182
129 3300039438 Ga0436360_0501955 Ga0436360_0501955_943_1515 182
130 3300039453 Ga0436362_0304886 Ga0436362_0304886_488_1060 182
131 3300039453 Ga0436362_0868538 Ga0436362_0868538_189_761 182
132 3300050507 nmdc:mga05p37_469491_c1 nmdc:mga05p37_469491_c1_31_579 182
133 3300050512 nmdc:mga0n895_755058_c1 nmdc:mga0n895_755058_c1_400_948 182
134 3300050514 nmdc:mga08x19_116730_c1 nmdc:mga08x19_116730_c1_340_888 182
135 3300003215 JGI25153J46596_10001380 JGI25153J46596_1000138013 183
136 3300004803 Ga0058862_10062104 Ga0058862_100621042 183
137 3300005327 Ga0070658_10010818 Ga0070658_100108185 183
138 3300005329 Ga0070683_100202211 Ga0070683_1002022113 183
139 3300005329 Ga0070683_100263413 Ga0070683_1002634131 183
140 3300005335 Ga0070666_10057065 Ga0070666_100570653 183
141 3300005335 Ga0070666_10095832 Ga0070666_100958322 183
142 3300005335 Ga0070666_10387746 Ga0070666_103877461 183
143 3300005336 Ga0070680_100009878 Ga0070680_1000098786 183
144 3300005336 Ga0070680_100121777 Ga0070680_1001217772 183
145 3300005337 Ga0070682_100075660 Ga0070682_1000756602 183
146 3300005339 Ga0070660_100154645 Ga0070660_1001546452 183
147 3300005339 Ga0070660_100914323 Ga0070660_1009143231 183
148 3300005340 Ga0070689_101019727 Ga0070689_1010197271 183
149 3300005344 Ga0070661_100003057 Ga0070661_1000030571 183
150 3300005354 Ga0070675_100384839 Ga0070675_1003848392 183
151 3300005356 Ga0070674_100841785 Ga0070674_1008417851 183
152 3300005364 Ga0070673_101199772 Ga0070673_1011997721 183
153 3300005366 Ga0070659_100451906 Ga0070659_1004519061 183
154 3300005435 Ga0070714_100082989 Ga0070714_1000829891 183
155 3300005435 Ga0070714_100113434 Ga0070714_1001134341 183
156 3300005435 Ga0070714_100148804 Ga0070714_1001488042 183
157 3300005455 Ga0070663_100339548 Ga0070663_1003395483 183
158 3300005456 Ga0070678_100772979 Ga0070678_1007729792 183
159 3300005456 Ga0070678_100870718 Ga0070678_1008707181 183
160 3300005457 Ga0070662_100219887 Ga0070662_1002198873 183
161 3300005458 Ga0070681_10021846 Ga0070681_100218467 183
162 3300005458 Ga0070681_10047357 Ga0070681_100473574 183
163 3300005458 Ga0070681_10228765 Ga0070681_102287652 183
164 3300005458 Ga0070681_10404211 Ga0070681_104042112 183
165 3300005530 Ga0070679_100053410 Ga0070679_1000534101 183
166 3300005530 Ga0070679_100069932 Ga0070679_1000699323 183
167 3300005535 Ga0070684_100066578 Ga0070684_1000665782 183
168 3300005535 Ga0070684_100101532 Ga0070684_1001015323 183
169 3300005536 Ga0070697_100716360 Ga0070697_1007163601 183
170 3300005539 Ga0068853_100066306 Ga0068853_1000663064 183
171 3300005539 Ga0068853_100708109 Ga0068853_1007081091 183
172 3300005547 Ga0070693_100092969 Ga0070693_1000929693 183
173 3300005548 Ga0070665_100178040 Ga0070665_1001780403 183
174 3300005548 Ga0070665_100285686 Ga0070665_1002856863 183
175 3300005563 Ga0068855_100236694 Ga0068855_1002366942 183
176 3300005563 Ga0068855_100540416 Ga0068855_1005404162 183
177 3300005563 Ga0068855_100838614 Ga0068855_1008386142 183
178 3300005563 Ga0068855_101436880 Ga0068855_1014368801 183
179 3300005564 Ga0070664_100005931 Ga0070664_1000059318 183
180 3300005564 Ga0070664_100661866 Ga0070664_1006618661 183
181 3300005577 Ga0068857_100063545 Ga0068857_1000635454 183
182 3300005578 Ga0068854_100297718 Ga0068854_1002977182 183
183 3300005578 Ga0068854_101385572 Ga0068854_1013855721 183
184 3300005614 Ga0068856_100042213 Ga0068856_1000422136 183
185 3300005614 Ga0068856_100171712 Ga0068856_1001717121 183
186 3300005616 Ga0068852_100197317 Ga0068852_1001973174 183
187 3300005618 Ga0068864_100089603 Ga0068864_1000896033 183
188 3300005719 Ga0068861_100098668 Ga0068861_1000986683 183
189 3300005842 Ga0068858_100575926 Ga0068858_1005759262 183
190 3300005843 Ga0068860_100032686 Ga0068860_1000326862 183
191 3300005844 Ga0068862_100550992 Ga0068862_1005509922 183
192 3300005985 Ga0081539_10100678 Ga0081539_101006782 183
193 3300006028 Ga0070717_10104934 Ga0070717_101049342 183
194 3300006051 Ga0075364_10474850 Ga0075364_104748502 183
195 3300006163 Ga0070715_10177020 Ga0070715_101770202 183
196 3300006173 Ga0070716_100450971 Ga0070716_1004509711 183
197 3300006175 Ga0070712_100916318 Ga0070712_1009163181 183
198 3300006881 Ga0068865_100876889 Ga0068865_1008768892 183
199 3300009093 Ga0105240_10010977 Ga0105240_1001097712 183
200 3300009093 Ga0105240_10253794 Ga0105240_102537943 183
201 3300009093 Ga0105240_10256781 Ga0105240_102567812 183
202 3300009093 Ga0105240_10318737 Ga0105240_103187372 183
203 3300009093 Ga0105240_10365163 Ga0105240_103651633 183
204 3300009093 Ga0105240_10397950 Ga0105240_103979501 183
205 3300009093 Ga0105240_10401836 Ga0105240_104018362 183
206 3300009174 Ga0105241_10181938 Ga0105241_101819381 183
207 3300009176 Ga0105242_10069861 Ga0105242_100698612 183
208 3300009177 Ga0105248_10363312 Ga0105248_103633122 183
209 3300009177 Ga0105248_10562201 Ga0105248_105622012 183
210 3300009545 Ga0105237_10056440 Ga0105237_100564404 183
211 3300009551 Ga0105238_10084285 Ga0105238_100842852 183
212 3300009551 Ga0105238_10122384 Ga0105238_101223842 183
213 3300009551 Ga0105238_10354352 Ga0105238_103543522 183
214 3300009551 Ga0105238_10380106 Ga0105238_103801062 183
215 3300009551 Ga0105238_10616538 Ga0105238_106165381 183
216 3300009553 Ga0105249_10176021 Ga0105249_101760213 183
217 3300009553 Ga0105249_10784987 Ga0105249_107849871 183
218 3300010159 Ga0099796_10125127 Ga0099796_101251272 183
219 3300010375 Ga0105239_10361437 Ga0105239_103614373 183
220 3300010375 Ga0105239_10720349 Ga0105239_107203491 183
221 3300013100 Ga0157373_10474584 Ga0157373_104745841 183
222 3300013102 Ga0157371_10192342 Ga0157371_101923422 183
223 3300013105 Ga0157369_10036464 Ga0157369_100364642 183
224 3300013297 Ga0157378_10502863 Ga0157378_105028632 183
225 3300013306 Ga0163162_10907950 Ga0163162_109079501 183
226 3300013307 Ga0157372_10178995 Ga0157372_101789953 183
227 3300013307 Ga0157372_10192916 Ga0157372_101929162 183
228 3300013307 Ga0157372_10515554 Ga0157372_105155542 183
229 3300013307 Ga0157372_11949502 Ga0157372_119495021 183
230 3300013308 Ga0157375_10713633 Ga0157375_107136332 183
231 3300013308 Ga0157375_11465647 Ga0157375_114656471 183
232 3300014325 Ga0163163_10437719 Ga0163163_104377192 183
233 3300014969 Ga0157376_10305504 Ga0157376_103055042 183
234 3300020069 Ga0197907_10516917 Ga0197907_105169171 183
235 3300020069 Ga0197907_10911782 Ga0197907_109117822 183
236 3300020075 Ga0206349_1390521 Ga0206349_13905211 183
237 3300020076 Ga0206355_1550509 Ga0206355_15505092 183
238 3300020078 Ga0206352_11155686 Ga0206352_111556861 183
239 3300020080 Ga0206350_10613185 Ga0206350_106131851 183
240 3300020081 Ga0206354_10441615 Ga0206354_104416152 183
241 3300020082 Ga0206353_11630308 Ga0206353_116303081 183
242 3300021358 Ga0213873_10003876 Ga0213873_100038762 183
243 3300021361 Ga0213872_10002472 Ga0213872_100024724 183
244 3300021361 Ga0213872_10025385 Ga0213872_100253852 183
245 3300021377 Ga0213874_10000119 Ga0213874_100001193 183
246 3300021377 Ga0213874_10029066 Ga0213874_100290662 183
247 3300021377 Ga0213874_10193024 Ga0213874_101930241 183
248 3300021384 Ga0213876_10006268 Ga0213876_100062685 183
249 3300021384 Ga0213876_10228507 Ga0213876_102285072 183
250 3300021388 Ga0213875_10000001 Ga0213875_10000001238 183
251 3300021388 Ga0213875_10003662 Ga0213875_100036627 183
252 3300021388 Ga0213875_10358513 Ga0213875_103585131 183
253 3300021441 Ga0213871_10043574 Ga0213871_100435741 183
254 3300022467 Ga0224712_10052178 Ga0224712_100521781 183
255 3300022467 Ga0224712_10274948 Ga0224712_102749481 183
256 3300025297 Ga0209758_1000008 Ga0209758_1000008900 183
257 3300025903 Ga0207680_10164896 Ga0207680_101648962 183
258 3300025904 Ga0207647_10568477 Ga0207647_105684771 183
259 3300025906 Ga0207699_10195481 Ga0207699_101954812 183
260 3300025909 Ga0207705_10125801 Ga0207705_101258011 183
261 3300025912 Ga0207707_10025674 Ga0207707_100256744 183
262 3300025912 Ga0207707_10170854 Ga0207707_101708541 183
263 3300025913 Ga0207695_10001655 Ga0207695_1000165530 183
264 3300025913 Ga0207695_10176885 Ga0207695_101768852 183
265 3300025913 Ga0207695_10435819 Ga0207695_104358193 183
266 3300025913 Ga0207695_10768715 Ga0207695_107687152 183
267 3300025914 Ga0207671_10067003 Ga0207671_100670034 183
268 3300025914 Ga0207671_10279324 Ga0207671_102793242 183
269 3300025915 Ga0207693_10110747 Ga0207693_101107472 183
270 3300025917 Ga0207660_10020944 Ga0207660_100209443 183
271 3300025917 Ga0207660_10237950 Ga0207660_102379501 183
272 3300025919 Ga0207657_10005146 Ga0207657_100051468 183
273 3300025920 Ga0207649_10080104 Ga0207649_100801042 183
274 3300025921 Ga0207652_10068061 Ga0207652_100680613 183
275 3300025921 Ga0207652_10111209 Ga0207652_101112092 183
276 3300025924 Ga0207694_10078411 Ga0207694_100784113 183
277 3300025924 Ga0207694_10104864 Ga0207694_101048643 183
278 3300025925 Ga0207650_10347522 Ga0207650_103475222 183
279 3300025929 Ga0207664_10024463 Ga0207664_100244636 183
280 3300025932 Ga0207690_10248942 Ga0207690_102489422 183
281 3300025933 Ga0207706_10178624 Ga0207706_101786243 183
282 3300025934 Ga0207686_10089637 Ga0207686_100896373 183
283 3300025934 Ga0207686_10346195 Ga0207686_103461952 183
284 3300025938 Ga0207704_10472555 Ga0207704_104725551 183
285 3300025939 Ga0207665_10358828 Ga0207665_103588282 183
286 3300025941 Ga0207711_10215562 Ga0207711_102155623 183
287 3300025941 Ga0207711_10232109 Ga0207711_102321092 183
288 3300025944 Ga0207661_10334801 Ga0207661_103348011 183
289 3300025945 Ga0207679_10005382 Ga0207679_100053829 183
290 3300025945 Ga0207679_10593056 Ga0207679_105930561 183
291 3300025949 Ga0207667_10739015 Ga0207667_107390152 183
292 3300025961 Ga0207712_10120159 Ga0207712_101201593 183
293 3300026035 Ga0207703_10316499 Ga0207703_103164992 183
294 3300026041 Ga0207639_10058420 Ga0207639_100584203 183
295 3300026067 Ga0207678_10236391 Ga0207678_102363912 183
296 3300026078 Ga0207702_10115282 Ga0207702_101152822 183
297 3300026116 Ga0207674_10263093 Ga0207674_102630932 183
298 3300026118 Ga0207675_100953425 Ga0207675_1009534252 183
299 3300026121 Ga0207683_10166074 Ga0207683_101660743 183
300 3300026121 Ga0207683_10351765 Ga0207683_103517651 183
301 3300026121 Ga0207683_11148105 Ga0207683_111481051 183
302 3300026142 Ga0207698_10146827 Ga0207698_101468274 183
303 3300027907 Ga0207428_10319885 Ga0207428_103198851 183
304 3300028379 Ga0268266_10181107 Ga0268266_101811071 183
305 3300028379 Ga0268266_11257130 Ga0268266_112571301 183
306 3300028381 Ga0268264_10022213 Ga0268264_100222133 183
307 3300028577 Ga0265318_10140842 Ga0265318_101408421 183
308 3300028800 Ga0265338_10000193 Ga0265338_1000019380 183
309 3300028800 Ga0265338_10236680 Ga0265338_102366802 183
310 3300031238 Ga0265332_10061548 Ga0265332_100615481 183
311 3300031241 Ga0265325_10001717 Ga0265325_100017173 183
312 3300031249 Ga0265339_10048650 Ga0265339_100486503 183
313 3300031250 Ga0265331_10065696 Ga0265331_100656962 183
314 3300031251 Ga0265327_10169719 Ga0265327_101697192 183
315 3300031344 Ga0265316_10114783 Ga0265316_101147833 183
316 3300031595 Ga0265313_10000039 Ga0265313_10000039104 183
317 3300031711 Ga0265314_10055372 Ga0265314_100553722 183
318 3300031711 Ga0265314_10396416 Ga0265314_103964161 183
319 3300031712 Ga0265342_10002123 Ga0265342_100021236 183
320 3300035089 Ga0373944_0204441 Ga0373944_0204441_46_618 183
321 3300036401 Ga0373937_0186355 Ga0373937_0186355_551_1114 183
322 3300036401 Ga0373937_0454311 Ga0373937_0454311_253_813 183
323 3300037068 Ga0373925_0002920 Ga0373925_0002920_3776_4348 183
324 3300037312 Ga0395899_0000070 Ga0395899_0000070_165923_166555 183
325 3300037418 Ga0395900_0088550 Ga0395900_0088550_1633_2214 183
326 3300037418 Ga0395900_0237214 Ga0395900_0237214_627_1211 183
327 3300037466 Ga0395898_0004784 Ga0395898_0004784_11774_12352 183
328 3300037466 Ga0395898_0005032 Ga0395898_0005032_6933_7511 183
329 3300037466 Ga0395898_0055232 Ga0395898_0055232_1083_1664 183
330 3300037853 Ga0436364_0273345 Ga0436364_0273345_216948_217511 183
331 3300037853 Ga0436364_1148342 Ga0436364_1148342_263_850 183
332 3300037853 Ga0436364_1450991 Ga0436364_1450991_13074_13640 183
333 3300038443 Ga0395901_0267948 Ga0395901_0267948_493_1077 183
334 3300039437 Ga0436365_0218820 Ga0436365_0218820_11953_12540 183
335 3300039437 Ga0436365_0343078 Ga0436365_0343078_2338_2901 183
336 3300039437 Ga0436365_1553829 Ga0436365_1553829_6004_6567 183
337 3300039438 Ga0436360_0365988 Ga0436360_0365988_124_702 183
338 3300039438 Ga0436360_0372078 Ga0436360_0372078_445_1023 183
339 3300039438 Ga0436360_0857744 Ga0436360_0857744_1331_1924 183
340 3300039438 Ga0436360_0867561 Ga0436360_0867561_219_791 183
341 3300039438 Ga0436360_1272743 Ga0436360_1272743_1112_1705 183
342 3300039447 Ga0436361_0003286 Ga0436361_0003286_37_600 183
343 3300039447 Ga0436361_0011345 Ga0436361_0011345_18329_18913 183
344 3300039447 Ga0436361_0156093 Ga0436361_0156093_340_903 183
345 3300039447 Ga0436361_0592342 Ga0436361_0592342_15206_15769 183
346 3300039447 Ga0436361_1116328 Ga0436361_1116328_346_918 183
347 3300039447 Ga0436361_1146136 Ga0436361_1146136_427_1020 183
348 3300039450 Ga0436363_0650287 Ga0436363_0650287_862_1425 183
349 3300039450 Ga0436363_0789833 Ga0436363_0789833_13598_14161 183
350 3300039453 Ga0436362_0271798 Ga0436362_0271798_3307_3870 183
351 3300039453 Ga0436362_0315812 Ga0436362_0315812_2100_2693 183
352 3300039453 Ga0436362_0358793 Ga0436362_0358793_111_671 183
353 3300039453 Ga0436362_0552020 Ga0436362_0552020_80_643 183
354 3300041496 Ga0451839_0368439 Ga0451839_0368439_81_632 183
355 3300044712 Ga0453684_1438898 Ga0453684_1438898_34_594 183
356 3300045051 Ga0451576_0162067 Ga0451576_0162067_141_701 183
357 3300046459 Ga0495629_0052919 Ga0495629_0052919_141_713 183
358 3300046472 Ga0495580_0082123 Ga0495580_0082123_1413_1985 183
359 3300046524 Ga0495648_0187439 Ga0495648_0187439_11_583 183
360 3300046539 Ga0495621_0112960 Ga0495621_0112960_259_831 183
361 3300046615 Ga0495656_0124802 Ga0495656_0124802_176_748 183
362 3300046663 Ga0495635_0103583 Ga0495635_0103583_782_1354 183
363 3300046665 Ga0495661_0123746 Ga0495661_0123746_782_1354 183
364 3300046683 Ga0495658_0009144 Ga0495658_0009144_1366_1938 183
365 3300046691 Ga0495670_0174166 Ga0495670_0174166_448_1020 183
366 3300047318 Ga0495636_0044842 Ga0495636_0044842_919_1491 183
367 3300047319 Ga0495674_0592510 Ga0495674_0592510_218_790 183
368 3300047470 Ga0495681_0187549 Ga0495681_0187549_31_603 183
369 3300047471 Ga0495684_0332160 Ga0495684_0332160_117_689 183
370 3300048903 Ga0496100_0314434 Ga0496100_0314434_336_899 183
371 3300048903 Ga0496100_0357932 Ga0496100_0357932_270_842 183
372 3300048904 Ga0496101_1070817 Ga0496101_1070817_26_589 183
373 3300048907 Ga0496104_0478816 Ga0496104_0478816_349_912 183
374 3300048909 Ga0496106_0274221 Ga0496106_0274221_720_1283 183
375 3300048910 Ga0496107_0199090 Ga0496107_0199090_26_589 183
376 3300048911 Ga0496108_0809269 Ga0496108_0809269_155_718 183
377 3300048912 Ga0496109_0475682 Ga0496109_0475682_32_595 183
378 3300048923 Ga0496120_0092138 Ga0496120_0092138_74_646 183
379 3300049581 Ga0501047_0537042 Ga0501047_0537042_272_934 183
380 3300050491 nmdc:mga00v17_143827_c1 nmdc:mga00v17_143827_c1_96_647 183
381 3300050514 nmdc:mga08x19_631358_c1 nmdc:mga08x19_631358_c1_14_577 183
382 3300053108 Ga0500562_080122 Ga0500562_080122_106_681 183
383 3300053119 Ga0500595_006794 Ga0500595_006794_2418_2990 183
384 3300053140 Ga0500573_0000009 Ga0500573_0000009_77894_78466 183
385 3300053730 Ga0500645_043787 Ga0500645_043787_347_919 183
386 3300059655 Ga0587114_021826 Ga0587114_021826_90_677 183
387 3300003187 JGI25151J46595_10081408 JGI25151J46595_100814081 184
388 3300003775 Ga0055524_1014743 Ga0055524_10147432 184
389 3300025263 Ga0209565_1001699 Ga0209565_10016997 184
390 3300025291 Ga0209675_1010332 Ga0209675_10103322 184
391 3300025294 Ga0209025_1003194 Ga0209025_10031946 184
392 3300025299 Ga0209256_1000905 Ga0209256_100090525 184
393 3300025303 Ga0209051_1001616 Ga0209051_100161615 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

81

221

0.96

PF02915

Rubrerythrin

Rubrerythrin

82

217

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2chp-assembly1.cif.gz_A crystal structure of the dodecameric ferritin mrga from b. subtilis 168 0.9543 35 175
2vzb-assembly1.cif.gz_A a dodecameric thioferritin in the bacterial domain, characterization of the bacterioferritin-related protein from bacteroides fragilis 0.9526 32 177
8ff9-assembly1.cif.gz_B crystal structure of apo dps protein (pa0962) from pseudomonas aeruginosa (orthorhombic form) 0.9519 34 175
4m34-assembly1.cif.gz_B crystal structure of gated-pore mutant d138h of second dna-binding protein under starvation from mycobacterium smegmatis 0.9478 37 168
2d5k-assembly1.cif.gz_B crystal structure of dps from staphylococcus aureus 0.9474 38 175
ID Description Score Start End Superfamily
2chpA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9543 35 175 1.20.1260.10
2vzbB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9526 32 177 1.20.1260.10
2c41C01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9487 36 175 1.20.1260.10
2yw7F00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9478 35 171 1.20.1260.10
4cyaA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9451 35 175 1.20.1260.10
ID Description Score Start End GO Terms
AF-F1VVE5-F1-model_v4 Putative bacterioferritin 0.9973 42 177 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037
AF-A0A3M5D710-F1-model_v4 Ferritin-like diiron domain-containing protein 0.9945 84 179 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037
AF-E6PIX5-F1-model_v4 Putative bacterioferritin (Cytochrome b1) 0.9917 23 179 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037
AF-A0A656GYT0-F1-model_v4 deleted 0.9908 43 177
AF-A0A0N1JPV0-F1-model_v4 ferroxidase (EC 1.16.3.1) 0.9863 27 177 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037

Feature Viewer

pLDDT pTM Quality
89.28 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map