F432702
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 393 | 232 | 393 | 188 |
Family's Representative Sequence
| Representative Sequence | 3300047322|Ga0495680_0539112|Ga0495680_0539112_95_766 |
| Length | 223 |
| Sequence | MQWTRDRARRCLCLATAGRPHHLTVSPHDAKEIPVSHALGTSSATAKPFLTDVKTLRERTRKNLSEGVVTTTYGGDVKRTIEILQSVLATEIVCVLRYTMHAVAATGISSEAIKAEFAEHAREEQEHMMSVAERINQLGGTPNFNPEGLATRSASQYAEGENLVDMIKENLIAERIAVDHYRELIRYFGDDDPATRVMLQGILATEEEHASDMLDLLEAHQGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 102 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 108 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 109 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 112 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 113 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 115 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 163 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 164 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 172 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 177 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 178 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 179 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 180 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 181 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 182 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 183 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 184 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 185 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 186 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 187 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 188 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 213 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 216 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 217 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 221 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 227 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 228 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 229 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 230 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 231 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.42 |
| Metatranscriptomes | 4.58 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.33 |
| Nodule | 0 |
| Rhizoplane | 2.29 |
| Rhizosphere | 85.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10081408 | 3300003187 | Bacteria | 935 |
| 2 | JGI25153J46596_10001380 | 3300003215 | Bacteria | 14525 |
| 3 | Ga0055524_1014743 | 3300003775 | Bacteria | 2881 |
| 4 | Ga0058861_11383358 | 3300004800 | Bacteria | 613 |
| 5 | Ga0058862_10062104 | 3300004803 | Unclassified | 1262 |
| 6 | Ga0058862_12798699 | 3300004803 | Bacteria | 675 |
| 7 | Ga0065712_10018719 | 3300005290 | Bacteria | 2033 |
| 8 | Ga0065715_10387078 | 3300005293 | Unclassified | 883 |
| 9 | Ga0070658_10010818 | 3300005327 | Bacteria | 7314 |
| 10 | Ga0070683_100202211 | 3300005329 | Bacteria | 1886 |
| 11 | Ga0070683_100263413 | 3300005329 | Unclassified | 1640 |
| 12 | Ga0070690_100250069 | 3300005330 | Bacteria | 1253 |
| 13 | Ga0070670_100311712 | 3300005331 | Bacteria | 1377 |
| 14 | Ga0070666_10057065 | 3300005335 | Bacteria | 2638 |
| 15 | Ga0070666_10095832 | 3300005335 | Unclassified | 2042 |
| 16 | Ga0070666_10387746 | 3300005335 | Bacteria | 1003 |
| 17 | Ga0070680_100009878 | 3300005336 | Bacteria | 7346 |
| 18 | Ga0070680_100121777 | 3300005336 | Unclassified | 2178 |
| 19 | Ga0070682_100000051 | 3300005337 | Bacteria | 123476 |
| 20 | Ga0070682_100075660 | 3300005337 | Bacteria | 2166 |
| 21 | Ga0070660_100154645 | 3300005339 | Bacteria | 1846 |
| 22 | Ga0070660_100914323 | 3300005339 | Bacteria | 740 |
| 23 | Ga0070689_101019727 | 3300005340 | Bacteria | 737 |
| 24 | Ga0070687_100255166 | 3300005343 | Bacteria | 1091 |
| 25 | Ga0070661_100003057 | 3300005344 | Bacteria | 11512 |
| 26 | Ga0070692_10051485 | 3300005345 | Bacteria | 2142 |
| 27 | Ga0070675_100384839 | 3300005354 | Unclassified | 1249 |
| 28 | Ga0070671_100100026 | 3300005355 | Bacteria | 2433 |
| 29 | Ga0070671_100268139 | 3300005355 | Unclassified | 1451 |
| 30 | Ga0070674_100035833 | 3300005356 | Bacteria | 3326 |
| 31 | Ga0070674_100841785 | 3300005356 | Bacteria | 795 |
| 32 | Ga0070673_100251598 | 3300005364 | Bacteria | 1540 |
| 33 | Ga0070673_101199772 | 3300005364 | Bacteria | 711 |
| 34 | Ga0070688_100161552 | 3300005365 | Bacteria | 1539 |
| 35 | Ga0070688_100383932 | 3300005365 | Bacteria | 1036 |
| 36 | Ga0070659_100451906 | 3300005366 | Bacteria | 1090 |
| 37 | Ga0070667_100564765 | 3300005367 | Bacteria | 1047 |
| 38 | Ga0070714_100040876 | 3300005435 | Bacteria | 3909 |
| 39 | Ga0070714_100082989 | 3300005435 | Bacteria | 2793 |
| 40 | Ga0070714_100113434 | 3300005435 | Bacteria | 2403 |
| 41 | Ga0070714_100148804 | 3300005435 | Bacteria | 2108 |
| 42 | Ga0070705_100181230 | 3300005440 | Bacteria | 1427 |
| 43 | Ga0070705_100231305 | 3300005440 | Bacteria | 1286 |
| 44 | Ga0070705_100626277 | 3300005440 | Bacteria | 836 |
| 45 | Ga0070700_100017407 | 3300005441 | Bacteria | 4109 |
| 46 | Ga0070700_100674901 | 3300005441 | Bacteria | 818 |
| 47 | Ga0070663_100339548 | 3300005455 | Bacteria | 1213 |
| 48 | Ga0070678_100162915 | 3300005456 | Bacteria | 1809 |
| 49 | Ga0070678_100772979 | 3300005456 | Bacteria | 870 |
| 50 | Ga0070678_100870718 | 3300005456 | Bacteria | 822 |
| 51 | Ga0070662_100219887 | 3300005457 | Bacteria | 1515 |
| 52 | Ga0070681_10021846 | 3300005458 | Bacteria | 6418 |
| 53 | Ga0070681_10047357 | 3300005458 | Bacteria | 4298 |
| 54 | Ga0070681_10228765 | 3300005458 | Unclassified | 1774 |
| 55 | Ga0070681_10404211 | 3300005458 | Bacteria | 1277 |
| 56 | Ga0068867_100017779 | 3300005459 | Bacteria | 5048 |
| 57 | Ga0070706_100043141 | 3300005467 | Unclassified | 4166 |
| 58 | Ga0070706_100690179 | 3300005467 | Bacteria | 947 |
| 59 | Ga0070707_100356327 | 3300005468 | Bacteria | 1421 |
| 60 | Ga0070699_100156562 | 3300005518 | Bacteria | 2016 |
| 61 | Ga0070679_100053410 | 3300005530 | Bacteria | 4022 |
| 62 | Ga0070679_100069932 | 3300005530 | Bacteria | 3502 |
| 63 | Ga0070684_100066578 | 3300005535 | Bacteria | 3162 |
| 64 | Ga0070684_100101532 | 3300005535 | Bacteria | 2570 |
| 65 | Ga0070697_100594135 | 3300005536 | Bacteria | 973 |
| 66 | Ga0070697_100716360 | 3300005536 | Bacteria | 883 |
| 67 | Ga0068853_100066306 | 3300005539 | Bacteria | 3134 |
| 68 | Ga0068853_100708109 | 3300005539 | Bacteria | 961 |
| 69 | Ga0070672_100434148 | 3300005543 | Bacteria | 1129 |
| 70 | Ga0070686_100112314 | 3300005544 | Bacteria | 1858 |
| 71 | Ga0070695_100043882 | 3300005545 | Bacteria | 2844 |
| 72 | Ga0070695_100072232 | 3300005545 | Bacteria | 2262 |
| 73 | Ga0070696_100006198 | 3300005546 | Bacteria | 7999 |
| 74 | Ga0070693_100092969 | 3300005547 | Bacteria | 1822 |
| 75 | Ga0070693_100102918 | 3300005547 | Bacteria | 1743 |
| 76 | Ga0070665_100178040 | 3300005548 | Bacteria | 2127 |
| 77 | Ga0070665_100285686 | 3300005548 | Bacteria | 1652 |
| 78 | Ga0068855_100214929 | 3300005563 | Bacteria | 2159 |
| 79 | Ga0068855_100236694 | 3300005563 | Bacteria | 2042 |
| 80 | Ga0068855_100540416 | 3300005563 | Bacteria | 1262 |
| 81 | Ga0068855_100838614 | 3300005563 | Archaea | 975 |
| 82 | Ga0068855_101436880 | 3300005563 | Bacteria | 710 |
| 83 | Ga0070664_100005931 | 3300005564 | Bacteria | 9868 |
| 84 | Ga0070664_100661866 | 3300005564 | Unclassified | 971 |
| 85 | Ga0068857_100063545 | 3300005577 | Bacteria | 3282 |
| 86 | Ga0068854_100230434 | 3300005578 | Bacteria | 1470 |
| 87 | Ga0068854_100297718 | 3300005578 | Bacteria | 1304 |
| 88 | Ga0068854_101385572 | 3300005578 | Bacteria | 635 |
| 89 | Ga0068856_100042213 | 3300005614 | Bacteria | 4486 |
| 90 | Ga0068856_100171712 | 3300005614 | Bacteria | 2180 |
| 91 | Ga0070702_100027667 | 3300005615 | Bacteria | 3063 |
| 92 | Ga0068852_100197317 | 3300005616 | Bacteria | 1903 |
| 93 | Ga0068859_100534287 | 3300005617 | Bacteria | 1267 |
| 94 | Ga0068864_100089603 | 3300005618 | Bacteria | 2710 |
| 95 | Ga0068864_100499908 | 3300005618 | Bacteria | 1169 |
| 96 | Ga0068864_100658728 | 3300005618 | Bacteria | 1020 |
| 97 | Ga0068866_10016774 | 3300005718 | Bacteria | 3281 |
| 98 | Ga0068861_100098668 | 3300005719 | Bacteria | 2319 |
| 99 | Ga0068870_10071690 | 3300005840 | Bacteria | 1891 |
| 100 | Ga0068863_100191888 | 3300005841 | Bacteria | 1963 |
| 101 | Ga0068858_100575926 | 3300005842 | Bacteria | 1091 |
| 102 | Ga0068860_100032686 | 3300005843 | Bacteria | 4999 |
| 103 | Ga0068860_100996838 | 3300005843 | Bacteria | 855 |
| 104 | Ga0068862_100550992 | 3300005844 | Bacteria | 1101 |
| 105 | Ga0081539_10100678 | 3300005985 | Bacteria | 1473 |
| 106 | Ga0070717_10104934 | 3300006028 | Bacteria | 2405 |
| 107 | Ga0075364_10474850 | 3300006051 | Bacteria | 855 |
| 108 | Ga0070715_10177020 | 3300006163 | Bacteria | 1067 |
| 109 | Ga0070716_100450971 | 3300006173 | Bacteria | 938 |
| 110 | Ga0070712_100916318 | 3300006175 | Bacteria | 756 |
| 111 | Ga0097621_100062767 | 3300006237 | Bacteria | 3051 |
| 112 | Ga0097621_100741048 | 3300006237 | Bacteria | 907 |
| 113 | Ga0068871_100260577 | 3300006358 | Bacteria | 1512 |
| 114 | Ga0075434_100269786 | 3300006871 | Bacteria | 1721 |
| 115 | Ga0068865_100011598 | 3300006881 | Bacteria | 5522 |
| 116 | Ga0068865_100876889 | 3300006881 | Bacteria | 779 |
| 117 | Ga0075436_100161690 | 3300006914 | Bacteria | 1579 |
| 118 | Ga0097620_100534285 | 3300006931 | Bacteria | 1267 |
| 119 | Ga0105240_10010977 | 3300009093 | Bacteria | 12686 |
| 120 | Ga0105240_10253794 | 3300009093 | Bacteria | 2032 |
| 121 | Ga0105240_10256781 | 3300009093 | Bacteria | 2018 |
| 122 | Ga0105240_10318737 | 3300009093 | Bacteria | 1773 |
| 123 | Ga0105240_10348150 | 3300009093 | Bacteria | 1681 |
| 124 | Ga0105240_10365163 | 3300009093 | Bacteria | 1634 |
| 125 | Ga0105240_10397950 | 3300009093 | Unclassified | 1552 |
| 126 | Ga0105240_10401836 | 3300009093 | Bacteria | 1543 |
| 127 | Ga0105240_10773580 | 3300009093 | Bacteria | 1042 |
| 128 | Ga0111539_11189521 | 3300009094 | Bacteria | 885 |
| 129 | Ga0105243_10009791 | 3300009148 | Bacteria | 7296 |
| 130 | Ga0105243_10516722 | 3300009148 | Bacteria | 1135 |
| 131 | Ga0105241_10146998 | 3300009174 | Bacteria | 1924 |
| 132 | Ga0105241_10181938 | 3300009174 | Bacteria | 1744 |
| 133 | Ga0105242_10002254 | 3300009176 | Bacteria | 15218 |
| 134 | Ga0105242_10069861 | 3300009176 | Bacteria | 2910 |
| 135 | Ga0105242_10787329 | 3300009176 | Bacteria | 940 |
| 136 | Ga0105248_10363312 | 3300009177 | Bacteria | 1630 |
| 137 | Ga0105248_10562201 | 3300009177 | Unclassified | 1287 |
| 138 | Ga0105248_10963662 | 3300009177 | Bacteria | 963 |
| 139 | Ga0105237_10056440 | 3300009545 | Bacteria | 3931 |
| 140 | Ga0105238_10084285 | 3300009551 | Bacteria | 3168 |
| 141 | Ga0105238_10122384 | 3300009551 | Bacteria | 2581 |
| 142 | Ga0105238_10354352 | 3300009551 | Bacteria | 1456 |
| 143 | Ga0105238_10380106 | 3300009551 | Bacteria | 1404 |
| 144 | Ga0105238_10616538 | 3300009551 | Unclassified | 1093 |
| 145 | Ga0105249_10176021 | 3300009553 | Bacteria | 2078 |
| 146 | Ga0105249_10418214 | 3300009553 | Bacteria | 1374 |
| 147 | Ga0105249_10784987 | 3300009553 | Bacteria | 1016 |
| 148 | Ga0099796_10125127 | 3300010159 | Bacteria | 992 |
| 149 | Ga0105239_10072581 | 3300010375 | Bacteria | 3784 |
| 150 | Ga0105239_10361437 | 3300010375 | Bacteria | 1640 |
| 151 | Ga0105239_10720349 | 3300010375 | Bacteria | 1141 |
| 152 | Ga0157373_10474584 | 3300013100 | Unclassified | 902 |
| 153 | Ga0157371_10192342 | 3300013102 | Unclassified | 1461 |
| 154 | Ga0157369_10036464 | 3300013105 | Bacteria | 5386 |
| 155 | Ga0157378_10049903 | 3300013297 | Bacteria | 3723 |
| 156 | Ga0157378_10502863 | 3300013297 | Unclassified | 1211 |
| 157 | Ga0163162_10833729 | 3300013306 | Bacteria | 1038 |
| 158 | Ga0163162_10907950 | 3300013306 | Bacteria | 994 |
| 159 | Ga0157372_10178995 | 3300013307 | Bacteria | 2454 |
| 160 | Ga0157372_10192916 | 3300013307 | Bacteria | 2359 |
| 161 | Ga0157372_10515554 | 3300013307 | Bacteria | 1394 |
| 162 | Ga0157372_11949502 | 3300013307 | Bacteria | 675 |
| 163 | Ga0157375_10160198 | 3300013308 | Bacteria | 2392 |
| 164 | Ga0157375_10713633 | 3300013308 | Bacteria | 1156 |
| 165 | Ga0157375_11465647 | 3300013308 | Unclassified | 805 |
| 166 | Ga0157375_11741620 | 3300013308 | Bacteria | 738 |
| 167 | Ga0163163_10019568 | 3300014325 | Bacteria | 6360 |
| 168 | Ga0163163_10437719 | 3300014325 | Unclassified | 1367 |
| 169 | Ga0157380_10071103 | 3300014326 | Bacteria | 2814 |
| 170 | Ga0157377_10626032 | 3300014745 | Bacteria | 771 |
| 171 | Ga0157379_10000302 | 3300014968 | Bacteria | 39090 |
| 172 | Ga0157376_10025069 | 3300014969 | Bacteria | 4693 |
| 173 | Ga0157376_10305504 | 3300014969 | Bacteria | 1507 |
| 174 | Ga0197907_10516917 | 3300020069 | Bacteria | 723 |
| 175 | Ga0197907_10911782 | 3300020069 | Bacteria | 1215 |
| 176 | Ga0206349_1390521 | 3300020075 | Bacteria | 813 |
| 177 | Ga0206355_1032658 | 3300020076 | Bacteria | 635 |
| 178 | Ga0206355_1550509 | 3300020076 | Bacteria | 1872 |
| 179 | Ga0206351_10013487 | 3300020077 | Bacteria | 1186 |
| 180 | Ga0206352_11155686 | 3300020078 | Unclassified | 1035 |
| 181 | Ga0206350_10613185 | 3300020080 | Archaea | 945 |
| 182 | Ga0206354_10441615 | 3300020081 | Unclassified | 1190 |
| 183 | Ga0206353_11630308 | 3300020082 | Unclassified | 793 |
| 184 | Ga0213873_10003876 | 3300021358 | Bacteria | 2740 |
| 185 | Ga0213873_10057123 | 3300021358 | Bacteria | 1047 |
| 186 | Ga0213872_10002472 | 3300021361 | Bacteria | 10833 |
| 187 | Ga0213872_10025385 | 3300021361 | Bacteria | 2724 |
| 188 | Ga0213874_10000119 | 3300021377 | Bacteria | 13057 |
| 189 | Ga0213874_10020580 | 3300021377 | Bacteria | 1810 |
| 190 | Ga0213874_10029066 | 3300021377 | Bacteria | 1584 |
| 191 | Ga0213874_10193024 | 3300021377 | Bacteria | 729 |
| 192 | Ga0213876_10006268 | 3300021384 | Bacteria | 6484 |
| 193 | Ga0213876_10228507 | 3300021384 | Bacteria | 989 |
| 194 | Ga0213876_10236980 | 3300021384 | Bacteria | 970 |
| 195 | Ga0213875_10000001 | 3300021388 | Bacteria | 2793540 |
| 196 | Ga0213875_10003662 | 3300021388 | Bacteria | 8682 |
| 197 | Ga0213875_10021861 | 3300021388 | Bacteria | 3061 |
| 198 | Ga0213875_10358513 | 3300021388 | Bacteria | 693 |
| 199 | Ga0213871_10008909 | 3300021441 | Bacteria | 2229 |
| 200 | Ga0213871_10043574 | 3300021441 | Bacteria | 1211 |
| 201 | Ga0224712_10052178 | 3300022467 | Bacteria | 1596 |
| 202 | Ga0224712_10274948 | 3300022467 | Bacteria | 783 |
| 203 | Ga0224712_10405814 | 3300022467 | Bacteria | 650 |
| 204 | Ga0224572_1004184 | 3300024225 | Bacteria | 2494 |
| 205 | Ga0209565_1001699 | 3300025263 | Bacteria | 9085 |
| 206 | Ga0209675_1010332 | 3300025291 | Bacteria | 3198 |
| 207 | Ga0209025_1003194 | 3300025294 | Bacteria | 15900 |
| 208 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 209 | Ga0209256_1000905 | 3300025299 | Bacteria | 36349 |
| 210 | Ga0209051_1001616 | 3300025303 | Bacteria | 18379 |
| 211 | Ga0207653_10087637 | 3300025885 | Bacteria | 1086 |
| 212 | Ga0207680_10164896 | 3300025903 | Bacteria | 1488 |
| 213 | Ga0207647_10568477 | 3300025904 | Bacteria | 628 |
| 214 | Ga0207699_10195481 | 3300025906 | Bacteria | 1367 |
| 215 | Ga0207705_10125801 | 3300025909 | Bacteria | 1905 |
| 216 | Ga0207684_10143688 | 3300025910 | Unclassified | 2052 |
| 217 | Ga0207707_10025674 | 3300025912 | Bacteria | 5153 |
| 218 | Ga0207707_10170854 | 3300025912 | Bacteria | 1900 |
| 219 | Ga0207695_10001655 | 3300025913 | Bacteria | 35911 |
| 220 | Ga0207695_10176885 | 3300025913 | Bacteria | 2056 |
| 221 | Ga0207695_10435819 | 3300025913 | Unclassified | 1194 |
| 222 | Ga0207695_10693218 | 3300025913 | Bacteria | 899 |
| 223 | Ga0207695_10768715 | 3300025913 | Bacteria | 844 |
| 224 | Ga0207671_10067003 | 3300025914 | Bacteria | 2673 |
| 225 | Ga0207671_10279324 | 3300025914 | Bacteria | 1317 |
| 226 | Ga0207693_10110747 | 3300025915 | Bacteria | 2153 |
| 227 | Ga0207660_10020944 | 3300025917 | Bacteria | 4393 |
| 228 | Ga0207660_10237950 | 3300025917 | Unclassified | 1434 |
| 229 | Ga0207657_10005146 | 3300025919 | Bacteria | 13710 |
| 230 | Ga0207649_10080104 | 3300025920 | Bacteria | 2111 |
| 231 | Ga0207652_10068061 | 3300025921 | Bacteria | 3088 |
| 232 | Ga0207652_10111209 | 3300025921 | Bacteria | 2429 |
| 233 | Ga0207694_10078411 | 3300025924 | Bacteria | 2589 |
| 234 | Ga0207694_10104864 | 3300025924 | Bacteria | 2244 |
| 235 | Ga0207650_10347522 | 3300025925 | Bacteria | 1219 |
| 236 | Ga0207664_10024463 | 3300025929 | Bacteria | 4538 |
| 237 | Ga0207664_10415809 | 3300025929 | Bacteria | 1197 |
| 238 | Ga0207690_10248942 | 3300025932 | Bacteria | 1372 |
| 239 | Ga0207706_10178624 | 3300025933 | Bacteria | 1864 |
| 240 | Ga0207706_10631365 | 3300025933 | Unclassified | 919 |
| 241 | Ga0207686_10089637 | 3300025934 | Bacteria | 2028 |
| 242 | Ga0207686_10346195 | 3300025934 | Bacteria | 1118 |
| 243 | Ga0207704_10472555 | 3300025938 | Bacteria | 1005 |
| 244 | Ga0207665_10358828 | 3300025939 | Bacteria | 1102 |
| 245 | Ga0207711_10185821 | 3300025941 | Bacteria | 1892 |
| 246 | Ga0207711_10215562 | 3300025941 | Bacteria | 1754 |
| 247 | Ga0207711_10232109 | 3300025941 | Bacteria | 1690 |
| 248 | Ga0207661_10334801 | 3300025944 | Unclassified | 1363 |
| 249 | Ga0207679_10005382 | 3300025945 | Bacteria | 8023 |
| 250 | Ga0207679_10593056 | 3300025945 | Unclassified | 998 |
| 251 | Ga0207667_10739015 | 3300025949 | Bacteria | 984 |
| 252 | Ga0207712_10120159 | 3300025961 | Bacteria | 1987 |
| 253 | Ga0207703_10316499 | 3300026035 | Bacteria | 1428 |
| 254 | Ga0207639_10058420 | 3300026041 | Bacteria | 2967 |
| 255 | Ga0207678_10236391 | 3300026067 | Bacteria | 1565 |
| 256 | Ga0207702_10115282 | 3300026078 | Bacteria | 2396 |
| 257 | Ga0207674_10174075 | 3300026116 | Bacteria | 2105 |
| 258 | Ga0207674_10263093 | 3300026116 | Bacteria | 1672 |
| 259 | Ga0207674_10431892 | 3300026116 | Bacteria | 1273 |
| 260 | Ga0207675_100953425 | 3300026118 | Bacteria | 875 |
| 261 | Ga0207683_10166074 | 3300026121 | Bacteria | 1997 |
| 262 | Ga0207683_10351765 | 3300026121 | Bacteria | 1352 |
| 263 | Ga0207683_11148105 | 3300026121 | Unclassified | 720 |
| 264 | Ga0207698_10146827 | 3300026142 | Bacteria | 2041 |
| 265 | Ga0207428_10319885 | 3300027907 | Bacteria | 1146 |
| 266 | Ga0268266_10181107 | 3300028379 | Bacteria | 1918 |
| 267 | Ga0268266_11257130 | 3300028379 | Bacteria | 715 |
| 268 | Ga0268264_10022213 | 3300028381 | Bacteria | 5180 |
| 269 | Ga0265318_10140842 | 3300028577 | Bacteria | 886 |
| 270 | Ga0265338_10000193 | 3300028800 | Bacteria | 115132 |
| 271 | Ga0265338_10056935 | 3300028800 | Bacteria | 3462 |
| 272 | Ga0265338_10236680 | 3300028800 | Bacteria | 1355 |
| 273 | Ga0265332_10061548 | 3300031238 | Bacteria | 1605 |
| 274 | Ga0265325_10001717 | 3300031241 | Bacteria | 15223 |
| 275 | Ga0265340_10089538 | 3300031247 | Bacteria | 1440 |
| 276 | Ga0265339_10048650 | 3300031249 | Bacteria | 2324 |
| 277 | Ga0265331_10065696 | 3300031250 | Bacteria | 1705 |
| 278 | Ga0265327_10169719 | 3300031251 | Unclassified | 1003 |
| 279 | Ga0265316_10114783 | 3300031344 | Bacteria | 2037 |
| 280 | Ga0265313_10000039 | 3300031595 | Bacteria | 120922 |
| 281 | Ga0265314_10055372 | 3300031711 | Bacteria | 2738 |
| 282 | Ga0265314_10396416 | 3300031711 | Unclassified | 747 |
| 283 | Ga0265342_10002123 | 3300031712 | Bacteria | 17477 |
| 284 | Ga0373944_0204441 | 3300035089 | Bacteria | 716 |
| 285 | Ga0373937_0186355 | 3300036401 | Unclassified | 1949 |
| 286 | Ga0373937_0454311 | 3300036401 | Bacteria | 1217 |
| 287 | Ga0373925_0002920 | 3300037068 | Bacteria | 13481 |
| 288 | Ga0395899_0000070 | 3300037312 | Bacteria | 189668 |
| 289 | Ga0395900_0088550 | 3300037418 | Bacteria | 3183 |
| 290 | Ga0395900_0237214 | 3300037418 | Bacteria | 1831 |
| 291 | Ga0395900_0568254 | 3300037418 | Bacteria | 1077 |
| 292 | Ga0395898_0004784 | 3300037466 | Bacteria | 14731 |
| 293 | Ga0395898_0005032 | 3300037466 | Bacteria | 14335 |
| 294 | Ga0395898_0055232 | 3300037466 | Bacteria | 3874 |
| 295 | Ga0395905_0012907 | 3300037471 | Bacteria | 8031 |
| 296 | Ga0395905_0418904 | 3300037471 | Bacteria | 1235 |
| 297 | Ga0436364_0273345 | 3300037853 | Bacteria | 2794207 |
| 298 | Ga0436364_1148342 | 3300037853 | Bacteria | 929 |
| 299 | Ga0436364_1149520 | 3300037853 | Bacteria | 10666 |
| 300 | Ga0436364_1373065 | 3300037853 | Bacteria | 915 |
| 301 | Ga0436364_1450991 | 3300037853 | Bacteria | 17355 |
| 302 | Ga0395901_0171042 | 3300038443 | Bacteria | 2280 |
| 303 | Ga0395901_0267948 | 3300038443 | Bacteria | 1777 |
| 304 | Ga0395901_0494493 | 3300038443 | Bacteria | 1246 |
| 305 | Ga0436365_0218820 | 3300039437 | Bacteria | 38620 |
| 306 | Ga0436365_0343078 | 3300039437 | Bacteria | 3288 |
| 307 | Ga0436365_0818086 | 3300039437 | Bacteria | 1020 |
| 308 | Ga0436365_1553829 | 3300039437 | Bacteria | 9731 |
| 309 | Ga0436365_1774095 | 3300039437 | Bacteria | 1211 |
| 310 | Ga0436360_0365988 | 3300039438 | Bacteria | 856 |
| 311 | Ga0436360_0372078 | 3300039438 | Bacteria | 1217 |
| 312 | Ga0436360_0501955 | 3300039438 | Bacteria | 5618 |
| 313 | Ga0436360_0857744 | 3300039438 | Bacteria | 3067 |
| 314 | Ga0436360_0867561 | 3300039438 | Bacteria | 1209 |
| 315 | Ga0436360_1272743 | 3300039438 | Bacteria | 1843 |
| 316 | Ga0436361_0003286 | 3300039447 | Bacteria | 1880 |
| 317 | Ga0436361_0011345 | 3300039447 | Bacteria | 39413 |
| 318 | Ga0436361_0156093 | 3300039447 | Bacteria | 1493 |
| 319 | Ga0436361_0592342 | 3300039447 | Bacteria | 31658 |
| 320 | Ga0436361_1116328 | 3300039447 | Unclassified | 1092 |
| 321 | Ga0436361_1146136 | 3300039447 | Bacteria | 1569 |
| 322 | Ga0436363_0504700 | 3300039450 | Bacteria | 987 |
| 323 | Ga0436363_0506728 | 3300039450 | Bacteria | 901 |
| 324 | Ga0436363_0608791 | 3300039450 | Bacteria | 1315 |
| 325 | Ga0436363_0650287 | 3300039450 | Bacteria | 2498 |
| 326 | Ga0436363_0789833 | 3300039450 | Bacteria | 16693 |
| 327 | Ga0436363_0931737 | 3300039450 | Bacteria | 1897 |
| 328 | Ga0436363_1332270 | 3300039450 | Bacteria | 734 |
| 329 | Ga0436363_1413874 | 3300039450 | Bacteria | 2497 |
| 330 | Ga0436362_0271798 | 3300039453 | Bacteria | 10279 |
| 331 | Ga0436362_0304886 | 3300039453 | Bacteria | 1912 |
| 332 | Ga0436362_0315812 | 3300039453 | Bacteria | 4049 |
| 333 | Ga0436362_0358793 | 3300039453 | Bacteria | 816 |
| 334 | Ga0436362_0552020 | 3300039453 | Bacteria | 1066 |
| 335 | Ga0436362_0823235 | 3300039453 | Bacteria | 1034 |
| 336 | Ga0436362_0868538 | 3300039453 | Bacteria | 820 |
| 337 | Ga0451839_0368439 | 3300041496 | Bacteria | 949 |
| 338 | Ga0453684_1438898 | 3300044712 | Bacteria | 713 |
| 339 | Ga0451576_0162067 | 3300045051 | Bacteria | 2334 |
| 340 | Ga0451576_0585005 | 3300045051 | Bacteria | 1173 |
| 341 | Ga0495629_0052919 | 3300046459 | Bacteria | 2841 |
| 342 | Ga0495580_0082123 | 3300046472 | Bacteria | 2246 |
| 343 | Ga0495610_0071711 | 3300046512 | Bacteria | 1614 |
| 344 | Ga0495648_0187439 | 3300046524 | Unclassified | 1046 |
| 345 | Ga0495663_0000808 | 3300046525 | Bacteria | 10703 |
| 346 | Ga0495598_0000259 | 3300046537 | Bacteria | 9519 |
| 347 | Ga0495621_0000089 | 3300046539 | Bacteria | 18610 |
| 348 | Ga0495621_0112960 | 3300046539 | Bacteria | 1043 |
| 349 | Ga0495622_0014424 | 3300046557 | Bacteria | 3668 |
| 350 | Ga0495656_0124802 | 3300046615 | Bacteria | 1219 |
| 351 | Ga0495656_0191297 | 3300046615 | Bacteria | 1011 |
| 352 | Ga0495668_0251830 | 3300046616 | Bacteria | 967 |
| 353 | Ga0495635_0103583 | 3300046663 | Bacteria | 1945 |
| 354 | Ga0495635_0175505 | 3300046663 | Bacteria | 1457 |
| 355 | Ga0495661_0123746 | 3300046665 | Bacteria | 1425 |
| 356 | Ga0495658_0009144 | 3300046683 | Bacteria | 4926 |
| 357 | Ga0495670_0174166 | 3300046691 | Bacteria | 1134 |
| 358 | Ga0495600_0349129 | 3300046809 | Bacteria | 927 |
| 359 | Ga0495636_0044842 | 3300047318 | Bacteria | 1842 |
| 360 | Ga0495674_0592510 | 3300047319 | Bacteria | 879 |
| 361 | Ga0495680_0539112 | 3300047322 | Bacteria | 788 |
| 362 | Ga0495681_0187549 | 3300047470 | Bacteria | 846 |
| 363 | Ga0495684_0019080 | 3300047471 | Bacteria | 5281 |
| 364 | Ga0495684_0332160 | 3300047471 | Bacteria | 1084 |
| 365 | Ga0496100_0314434 | 3300048903 | Bacteria | 1175 |
| 366 | Ga0496100_0357932 | 3300048903 | Bacteria | 1104 |
| 367 | Ga0496101_1070817 | 3300048904 | Bacteria | 633 |
| 368 | Ga0496104_0478816 | 3300048907 | Bacteria | 1156 |
| 369 | Ga0496106_0274221 | 3300048909 | Bacteria | 1351 |
| 370 | Ga0496107_0199090 | 3300048910 | Bacteria | 1489 |
| 371 | Ga0496108_0809269 | 3300048911 | Bacteria | 808 |
| 372 | Ga0496109_0475682 | 3300048912 | Bacteria | 1180 |
| 373 | Ga0496115_0595256 | 3300048918 | Bacteria | 880 |
| 374 | Ga0496120_0092138 | 3300048923 | Bacteria | 1617 |
| 375 | Ga0501047_0537042 | 3300049581 | Bacteria | 994 |
| 376 | Ga0501072_0231312 | 3300049588 | Bacteria | 1473 |
| 377 | Ga0501044_0434928 | 3300049823 | Bacteria | 1221 |
| 378 | nmdc:mga00v17_143827_c1 | 3300050491 | Bacteria | 1530 |
| 379 | nmdc:mga05p37_137016_c1 | 3300050507 | Bacteria | 3000 |
| 380 | nmdc:mga05p37_469491_c1 | 3300050507 | Bacteria | 1452 |
| 381 | nmdc:mga06r32_1045216_c1 | 3300050510 | Bacteria | 768 |
| 382 | nmdc:mga08y16_943233_c1 | 3300050511 | Bacteria | 846 |
| 383 | nmdc:mga0n895_755058_c1 | 3300050512 | Bacteria | 965 |
| 384 | nmdc:mga08x19_116730_c1 | 3300050514 | Bacteria | 1785 |
| 385 | nmdc:mga08x19_631358_c1 | 3300050514 | Bacteria | 759 |
| 386 | Ga0500562_080122 | 3300053108 | Bacteria | 883 |
| 387 | Ga0500595_006794 | 3300053119 | Bacteria | 4818 |
| 388 | Ga0500595_010322 | 3300053119 | Bacteria | 3718 |
| 389 | Ga0500559_0087644 | 3300053136 | Bacteria | 1422 |
| 390 | Ga0500573_0000009 | 3300053140 | Bacteria | 230823 |
| 391 | Ga0500645_043787 | 3300053730 | Bacteria | 1318 |
| 392 | Ga0587076_078938 | 3300059645 | Bacteria | 698 |
| 393 | Ga0587114_021826 | 3300059655 | Bacteria | 911 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005290 | Ga0065712_10018719 | Ga0065712_100187191 | 178 |
| 2 | 3300005330 | Ga0070690_100250069 | Ga0070690_1002500692 | 178 |
| 3 | 3300005343 | Ga0070687_100255166 | Ga0070687_1002551661 | 178 |
| 4 | 3300005345 | Ga0070692_10051485 | Ga0070692_100514852 | 178 |
| 5 | 3300005355 | Ga0070671_100100026 | Ga0070671_1001000263 | 178 |
| 6 | 3300005356 | Ga0070674_100035833 | Ga0070674_1000358333 | 178 |
| 7 | 3300005367 | Ga0070667_100564765 | Ga0070667_1005647651 | 178 |
| 8 | 3300005440 | Ga0070705_100181230 | Ga0070705_1001812302 | 178 |
| 9 | 3300005441 | Ga0070700_100017407 | Ga0070700_1000174073 | 178 |
| 10 | 3300005456 | Ga0070678_100162915 | Ga0070678_1001629152 | 178 |
| 11 | 3300005459 | Ga0068867_100017779 | Ga0068867_1000177793 | 178 |
| 12 | 3300005468 | Ga0070707_100356327 | Ga0070707_1003563272 | 178 |
| 13 | 3300005543 | Ga0070672_100434148 | Ga0070672_1004341481 | 178 |
| 14 | 3300005544 | Ga0070686_100112314 | Ga0070686_1001123142 | 178 |
| 15 | 3300005545 | Ga0070695_100043882 | Ga0070695_1000438822 | 178 |
| 16 | 3300005545 | Ga0070695_100072232 | Ga0070695_1000722321 | 178 |
| 17 | 3300005546 | Ga0070696_100006198 | Ga0070696_1000061982 | 178 |
| 18 | 3300005547 | Ga0070693_100102918 | Ga0070693_1001029182 | 178 |
| 19 | 3300005578 | Ga0068854_100230434 | Ga0068854_1002304342 | 178 |
| 20 | 3300005615 | Ga0070702_100027667 | Ga0070702_1000276671 | 178 |
| 21 | 3300005617 | Ga0068859_100534287 | Ga0068859_1005342872 | 178 |
| 22 | 3300005618 | Ga0068864_100499908 | Ga0068864_1004999081 | 178 |
| 23 | 3300005718 | Ga0068866_10016774 | Ga0068866_100167742 | 178 |
| 24 | 3300005840 | Ga0068870_10071690 | Ga0068870_100716902 | 178 |
| 25 | 3300005841 | Ga0068863_100191888 | Ga0068863_1001918882 | 178 |
| 26 | 3300005843 | Ga0068860_100996838 | Ga0068860_1009968382 | 178 |
| 27 | 3300006237 | Ga0097621_100062767 | Ga0097621_1000627674 | 178 |
| 28 | 3300006881 | Ga0068865_100011598 | Ga0068865_1000115983 | 178 |
| 29 | 3300006931 | Ga0097620_100534285 | Ga0097620_1005342852 | 178 |
| 30 | 3300009148 | Ga0105243_10516722 | Ga0105243_105167222 | 178 |
| 31 | 3300009176 | Ga0105242_10787329 | Ga0105242_107873291 | 178 |
| 32 | 3300005364 | Ga0070673_100251598 | Ga0070673_1002515981 | 179 |
| 33 | 3300005365 | Ga0070688_100161552 | Ga0070688_1001615522 | 179 |
| 34 | 3300005365 | Ga0070688_100383932 | Ga0070688_1003839322 | 179 |
| 35 | 3300005440 | Ga0070705_100231305 | Ga0070705_1002313052 | 179 |
| 36 | 3300005441 | Ga0070700_100674901 | Ga0070700_1006749011 | 179 |
| 37 | 3300005467 | Ga0070706_100690179 | Ga0070706_1006901792 | 179 |
| 38 | 3300005518 | Ga0070699_100156562 | Ga0070699_1001565621 | 179 |
| 39 | 3300006871 | Ga0075434_100269786 | Ga0075434_1002697862 | 179 |
| 40 | 3300009094 | Ga0111539_11189521 | Ga0111539_111895211 | 179 |
| 41 | 3300009148 | Ga0105243_10009791 | Ga0105243_100097915 | 179 |
| 42 | 3300009174 | Ga0105241_10146998 | Ga0105241_101469982 | 179 |
| 43 | 3300009176 | Ga0105242_10002254 | Ga0105242_100022543 | 179 |
| 44 | 3300009177 | Ga0105248_10963662 | Ga0105248_109636621 | 179 |
| 45 | 3300009553 | Ga0105249_10418214 | Ga0105249_104182142 | 179 |
| 46 | 3300010375 | Ga0105239_10072581 | Ga0105239_100725812 | 179 |
| 47 | 3300013297 | Ga0157378_10049903 | Ga0157378_100499033 | 179 |
| 48 | 3300013306 | Ga0163162_10833729 | Ga0163162_108337291 | 179 |
| 49 | 3300013308 | Ga0157375_10160198 | Ga0157375_101601982 | 179 |
| 50 | 3300014325 | Ga0163163_10019568 | Ga0163163_100195685 | 179 |
| 51 | 3300014326 | Ga0157380_10071103 | Ga0157380_100711033 | 179 |
| 52 | 3300014969 | Ga0157376_10025069 | Ga0157376_100250692 | 179 |
| 53 | 3300038443 | Ga0395901_0171042 | Ga0395901_0171042_1049_1588 | 179 |
| 54 | 3300045051 | Ga0451576_0585005 | Ga0451576_0585005_254_793 | 179 |
| 55 | 3300046512 | Ga0495610_0071711 | Ga0495610_0071711_592_1131 | 179 |
| 56 | 3300046525 | Ga0495663_0000808 | Ga0495663_0000808_2680_3219 | 179 |
| 57 | 3300046539 | Ga0495621_0000089 | Ga0495621_0000089_17469_18008 | 179 |
| 58 | 3300050507 | nmdc:mga05p37_137016_c1 | nmdc:mga05p37_137016_c1_35_574 | 179 |
| 59 | 3300050511 | nmdc:mga08y16_943233_c1 | nmdc:mga08y16_943233_c1_163_708 | 179 |
| 60 | 3300005293 | Ga0065715_10387078 | Ga0065715_103870781 | 180 |
| 61 | 3300005331 | Ga0070670_100311712 | Ga0070670_1003117122 | 180 |
| 62 | 3300005337 | Ga0070682_100000051 | Ga0070682_10000005116 | 180 |
| 63 | 3300005355 | Ga0070671_100268139 | Ga0070671_1002681392 | 180 |
| 64 | 3300005467 | Ga0070706_100043141 | Ga0070706_1000431414 | 180 |
| 65 | 3300005563 | Ga0068855_100214929 | Ga0068855_1002149295 | 180 |
| 66 | 3300005618 | Ga0068864_100658728 | Ga0068864_1006587282 | 180 |
| 67 | 3300006237 | Ga0097621_100741048 | Ga0097621_1007410482 | 180 |
| 68 | 3300006358 | Ga0068871_100260577 | Ga0068871_1002605771 | 180 |
| 69 | 3300009093 | Ga0105240_10348150 | Ga0105240_103481502 | 180 |
| 70 | 3300009093 | Ga0105240_10773580 | Ga0105240_107735801 | 180 |
| 71 | 3300013308 | Ga0157375_11741620 | Ga0157375_117416201 | 180 |
| 72 | 3300014745 | Ga0157377_10626032 | Ga0157377_106260321 | 180 |
| 73 | 3300020077 | Ga0206351_10013487 | Ga0206351_100134872 | 180 |
| 74 | 3300021377 | Ga0213874_10020580 | Ga0213874_100205803 | 180 |
| 75 | 3300025910 | Ga0207684_10143688 | Ga0207684_101436882 | 180 |
| 76 | 3300025913 | Ga0207695_10693218 | Ga0207695_106932181 | 180 |
| 77 | 3300025933 | Ga0207706_10631365 | Ga0207706_106313651 | 180 |
| 78 | 3300026116 | Ga0207674_10431892 | Ga0207674_104318921 | 180 |
| 79 | 3300031247 | Ga0265340_10089538 | Ga0265340_100895381 | 180 |
| 80 | 3300037418 | Ga0395900_0568254 | Ga0395900_0568254_197_751 | 180 |
| 81 | 3300037471 | Ga0395905_0012907 | Ga0395905_0012907_3590_4144 | 180 |
| 82 | 3300037471 | Ga0395905_0418904 | Ga0395905_0418904_152_706 | 180 |
| 83 | 3300038443 | Ga0395901_0494493 | Ga0395901_0494493_516_1070 | 180 |
| 84 | 3300039450 | Ga0436363_0504700 | Ga0436363_0504700_39_596 | 180 |
| 85 | 3300039450 | Ga0436363_0506728 | Ga0436363_0506728_110_676 | 180 |
| 86 | 3300039450 | Ga0436363_0608791 | Ga0436363_0608791_168_725 | 180 |
| 87 | 3300039450 | Ga0436363_1332270 | Ga0436363_1332270_52_609 | 180 |
| 88 | 3300039450 | Ga0436363_1413874 | Ga0436363_1413874_1109_1666 | 180 |
| 89 | 3300039453 | Ga0436362_0823235 | Ga0436362_0823235_89_646 | 180 |
| 90 | 3300046537 | Ga0495598_0000259 | Ga0495598_0000259_6652_7218 | 180 |
| 91 | 3300046615 | Ga0495656_0191297 | Ga0495656_0191297_242_808 | 180 |
| 92 | 3300046616 | Ga0495668_0251830 | Ga0495668_0251830_65_631 | 180 |
| 93 | 3300049588 | Ga0501072_0231312 | Ga0501072_0231312_919_1461 | 180 |
| 94 | 3300053136 | Ga0500559_0087644 | Ga0500559_0087644_138_701 | 180 |
| 95 | 3300059645 | Ga0587076_078938 | Ga0587076_078938_52_606 | 180 |
| 96 | 3300004800 | Ga0058861_11383358 | Ga0058861_113833581 | 181 |
| 97 | 3300004803 | Ga0058862_12798699 | Ga0058862_127986991 | 181 |
| 98 | 3300014968 | Ga0157379_10000302 | Ga0157379_1000030216 | 181 |
| 99 | 3300020076 | Ga0206355_1032658 | Ga0206355_10326581 | 181 |
| 100 | 3300021388 | Ga0213875_10021861 | Ga0213875_100218612 | 181 |
| 101 | 3300022467 | Ga0224712_10405814 | Ga0224712_104058141 | 181 |
| 102 | 3300025941 | Ga0207711_10185821 | Ga0207711_101858212 | 181 |
| 103 | 3300028800 | Ga0265338_10056935 | Ga0265338_100569351 | 181 |
| 104 | 3300039450 | Ga0436363_0931737 | Ga0436363_0931737_776_1342 | 181 |
| 105 | 3300046557 | Ga0495622_0014424 | Ga0495622_0014424_3036_3602 | 181 |
| 106 | 3300046663 | Ga0495635_0175505 | Ga0495635_0175505_166_777 | 181 |
| 107 | 3300046809 | Ga0495600_0349129 | Ga0495600_0349129_206_817 | 181 |
| 108 | 3300047322 | Ga0495680_0539112 | Ga0495680_0539112_95_766 | 181 |
| 109 | 3300047471 | Ga0495684_0019080 | Ga0495684_0019080_2809_3420 | 181 |
| 110 | 3300048918 | Ga0496115_0595256 | Ga0496115_0595256_141_701 | 181 |
| 111 | 3300049823 | Ga0501044_0434928 | Ga0501044_0434928_612_1169 | 181 |
| 112 | 3300050510 | nmdc:mga06r32_1045216_c1 | nmdc:mga06r32_1045216_c1_161_706 | 181 |
| 113 | 3300053119 | Ga0500595_010322 | Ga0500595_010322_2431_2997 | 181 |
| 114 | 3300005435 | Ga0070714_100040876 | Ga0070714_1000408762 | 182 |
| 115 | 3300005440 | Ga0070705_100626277 | Ga0070705_1006262771 | 182 |
| 116 | 3300005536 | Ga0070697_100594135 | Ga0070697_1005941352 | 182 |
| 117 | 3300006914 | Ga0075436_100161690 | Ga0075436_1001616902 | 182 |
| 118 | 3300021358 | Ga0213873_10057123 | Ga0213873_100571231 | 182 |
| 119 | 3300021384 | Ga0213876_10236980 | Ga0213876_102369801 | 182 |
| 120 | 3300021441 | Ga0213871_10008909 | Ga0213871_100089093 | 182 |
| 121 | 3300024225 | Ga0224572_1004184 | Ga0224572_10041842 | 182 |
| 122 | 3300025885 | Ga0207653_10087637 | Ga0207653_100876372 | 182 |
| 123 | 3300025929 | Ga0207664_10415809 | Ga0207664_104158092 | 182 |
| 124 | 3300026116 | Ga0207674_10174075 | Ga0207674_101740753 | 182 |
| 125 | 3300037853 | Ga0436364_1149520 | Ga0436364_1149520_5934_6497 | 182 |
| 126 | 3300037853 | Ga0436364_1373065 | Ga0436364_1373065_137_703 | 182 |
| 127 | 3300039437 | Ga0436365_0818086 | Ga0436365_0818086_227_802 | 182 |
| 128 | 3300039437 | Ga0436365_1774095 | Ga0436365_1774095_176_742 | 182 |
| 129 | 3300039438 | Ga0436360_0501955 | Ga0436360_0501955_943_1515 | 182 |
| 130 | 3300039453 | Ga0436362_0304886 | Ga0436362_0304886_488_1060 | 182 |
| 131 | 3300039453 | Ga0436362_0868538 | Ga0436362_0868538_189_761 | 182 |
| 132 | 3300050507 | nmdc:mga05p37_469491_c1 | nmdc:mga05p37_469491_c1_31_579 | 182 |
| 133 | 3300050512 | nmdc:mga0n895_755058_c1 | nmdc:mga0n895_755058_c1_400_948 | 182 |
| 134 | 3300050514 | nmdc:mga08x19_116730_c1 | nmdc:mga08x19_116730_c1_340_888 | 182 |
| 135 | 3300003215 | JGI25153J46596_10001380 | JGI25153J46596_1000138013 | 183 |
| 136 | 3300004803 | Ga0058862_10062104 | Ga0058862_100621042 | 183 |
| 137 | 3300005327 | Ga0070658_10010818 | Ga0070658_100108185 | 183 |
| 138 | 3300005329 | Ga0070683_100202211 | Ga0070683_1002022113 | 183 |
| 139 | 3300005329 | Ga0070683_100263413 | Ga0070683_1002634131 | 183 |
| 140 | 3300005335 | Ga0070666_10057065 | Ga0070666_100570653 | 183 |
| 141 | 3300005335 | Ga0070666_10095832 | Ga0070666_100958322 | 183 |
| 142 | 3300005335 | Ga0070666_10387746 | Ga0070666_103877461 | 183 |
| 143 | 3300005336 | Ga0070680_100009878 | Ga0070680_1000098786 | 183 |
| 144 | 3300005336 | Ga0070680_100121777 | Ga0070680_1001217772 | 183 |
| 145 | 3300005337 | Ga0070682_100075660 | Ga0070682_1000756602 | 183 |
| 146 | 3300005339 | Ga0070660_100154645 | Ga0070660_1001546452 | 183 |
| 147 | 3300005339 | Ga0070660_100914323 | Ga0070660_1009143231 | 183 |
| 148 | 3300005340 | Ga0070689_101019727 | Ga0070689_1010197271 | 183 |
| 149 | 3300005344 | Ga0070661_100003057 | Ga0070661_1000030571 | 183 |
| 150 | 3300005354 | Ga0070675_100384839 | Ga0070675_1003848392 | 183 |
| 151 | 3300005356 | Ga0070674_100841785 | Ga0070674_1008417851 | 183 |
| 152 | 3300005364 | Ga0070673_101199772 | Ga0070673_1011997721 | 183 |
| 153 | 3300005366 | Ga0070659_100451906 | Ga0070659_1004519061 | 183 |
| 154 | 3300005435 | Ga0070714_100082989 | Ga0070714_1000829891 | 183 |
| 155 | 3300005435 | Ga0070714_100113434 | Ga0070714_1001134341 | 183 |
| 156 | 3300005435 | Ga0070714_100148804 | Ga0070714_1001488042 | 183 |
| 157 | 3300005455 | Ga0070663_100339548 | Ga0070663_1003395483 | 183 |
| 158 | 3300005456 | Ga0070678_100772979 | Ga0070678_1007729792 | 183 |
| 159 | 3300005456 | Ga0070678_100870718 | Ga0070678_1008707181 | 183 |
| 160 | 3300005457 | Ga0070662_100219887 | Ga0070662_1002198873 | 183 |
| 161 | 3300005458 | Ga0070681_10021846 | Ga0070681_100218467 | 183 |
| 162 | 3300005458 | Ga0070681_10047357 | Ga0070681_100473574 | 183 |
| 163 | 3300005458 | Ga0070681_10228765 | Ga0070681_102287652 | 183 |
| 164 | 3300005458 | Ga0070681_10404211 | Ga0070681_104042112 | 183 |
| 165 | 3300005530 | Ga0070679_100053410 | Ga0070679_1000534101 | 183 |
| 166 | 3300005530 | Ga0070679_100069932 | Ga0070679_1000699323 | 183 |
| 167 | 3300005535 | Ga0070684_100066578 | Ga0070684_1000665782 | 183 |
| 168 | 3300005535 | Ga0070684_100101532 | Ga0070684_1001015323 | 183 |
| 169 | 3300005536 | Ga0070697_100716360 | Ga0070697_1007163601 | 183 |
| 170 | 3300005539 | Ga0068853_100066306 | Ga0068853_1000663064 | 183 |
| 171 | 3300005539 | Ga0068853_100708109 | Ga0068853_1007081091 | 183 |
| 172 | 3300005547 | Ga0070693_100092969 | Ga0070693_1000929693 | 183 |
| 173 | 3300005548 | Ga0070665_100178040 | Ga0070665_1001780403 | 183 |
| 174 | 3300005548 | Ga0070665_100285686 | Ga0070665_1002856863 | 183 |
| 175 | 3300005563 | Ga0068855_100236694 | Ga0068855_1002366942 | 183 |
| 176 | 3300005563 | Ga0068855_100540416 | Ga0068855_1005404162 | 183 |
| 177 | 3300005563 | Ga0068855_100838614 | Ga0068855_1008386142 | 183 |
| 178 | 3300005563 | Ga0068855_101436880 | Ga0068855_1014368801 | 183 |
| 179 | 3300005564 | Ga0070664_100005931 | Ga0070664_1000059318 | 183 |
| 180 | 3300005564 | Ga0070664_100661866 | Ga0070664_1006618661 | 183 |
| 181 | 3300005577 | Ga0068857_100063545 | Ga0068857_1000635454 | 183 |
| 182 | 3300005578 | Ga0068854_100297718 | Ga0068854_1002977182 | 183 |
| 183 | 3300005578 | Ga0068854_101385572 | Ga0068854_1013855721 | 183 |
| 184 | 3300005614 | Ga0068856_100042213 | Ga0068856_1000422136 | 183 |
| 185 | 3300005614 | Ga0068856_100171712 | Ga0068856_1001717121 | 183 |
| 186 | 3300005616 | Ga0068852_100197317 | Ga0068852_1001973174 | 183 |
| 187 | 3300005618 | Ga0068864_100089603 | Ga0068864_1000896033 | 183 |
| 188 | 3300005719 | Ga0068861_100098668 | Ga0068861_1000986683 | 183 |
| 189 | 3300005842 | Ga0068858_100575926 | Ga0068858_1005759262 | 183 |
| 190 | 3300005843 | Ga0068860_100032686 | Ga0068860_1000326862 | 183 |
| 191 | 3300005844 | Ga0068862_100550992 | Ga0068862_1005509922 | 183 |
| 192 | 3300005985 | Ga0081539_10100678 | Ga0081539_101006782 | 183 |
| 193 | 3300006028 | Ga0070717_10104934 | Ga0070717_101049342 | 183 |
| 194 | 3300006051 | Ga0075364_10474850 | Ga0075364_104748502 | 183 |
| 195 | 3300006163 | Ga0070715_10177020 | Ga0070715_101770202 | 183 |
| 196 | 3300006173 | Ga0070716_100450971 | Ga0070716_1004509711 | 183 |
| 197 | 3300006175 | Ga0070712_100916318 | Ga0070712_1009163181 | 183 |
| 198 | 3300006881 | Ga0068865_100876889 | Ga0068865_1008768892 | 183 |
| 199 | 3300009093 | Ga0105240_10010977 | Ga0105240_1001097712 | 183 |
| 200 | 3300009093 | Ga0105240_10253794 | Ga0105240_102537943 | 183 |
| 201 | 3300009093 | Ga0105240_10256781 | Ga0105240_102567812 | 183 |
| 202 | 3300009093 | Ga0105240_10318737 | Ga0105240_103187372 | 183 |
| 203 | 3300009093 | Ga0105240_10365163 | Ga0105240_103651633 | 183 |
| 204 | 3300009093 | Ga0105240_10397950 | Ga0105240_103979501 | 183 |
| 205 | 3300009093 | Ga0105240_10401836 | Ga0105240_104018362 | 183 |
| 206 | 3300009174 | Ga0105241_10181938 | Ga0105241_101819381 | 183 |
| 207 | 3300009176 | Ga0105242_10069861 | Ga0105242_100698612 | 183 |
| 208 | 3300009177 | Ga0105248_10363312 | Ga0105248_103633122 | 183 |
| 209 | 3300009177 | Ga0105248_10562201 | Ga0105248_105622012 | 183 |
| 210 | 3300009545 | Ga0105237_10056440 | Ga0105237_100564404 | 183 |
| 211 | 3300009551 | Ga0105238_10084285 | Ga0105238_100842852 | 183 |
| 212 | 3300009551 | Ga0105238_10122384 | Ga0105238_101223842 | 183 |
| 213 | 3300009551 | Ga0105238_10354352 | Ga0105238_103543522 | 183 |
| 214 | 3300009551 | Ga0105238_10380106 | Ga0105238_103801062 | 183 |
| 215 | 3300009551 | Ga0105238_10616538 | Ga0105238_106165381 | 183 |
| 216 | 3300009553 | Ga0105249_10176021 | Ga0105249_101760213 | 183 |
| 217 | 3300009553 | Ga0105249_10784987 | Ga0105249_107849871 | 183 |
| 218 | 3300010159 | Ga0099796_10125127 | Ga0099796_101251272 | 183 |
| 219 | 3300010375 | Ga0105239_10361437 | Ga0105239_103614373 | 183 |
| 220 | 3300010375 | Ga0105239_10720349 | Ga0105239_107203491 | 183 |
| 221 | 3300013100 | Ga0157373_10474584 | Ga0157373_104745841 | 183 |
| 222 | 3300013102 | Ga0157371_10192342 | Ga0157371_101923422 | 183 |
| 223 | 3300013105 | Ga0157369_10036464 | Ga0157369_100364642 | 183 |
| 224 | 3300013297 | Ga0157378_10502863 | Ga0157378_105028632 | 183 |
| 225 | 3300013306 | Ga0163162_10907950 | Ga0163162_109079501 | 183 |
| 226 | 3300013307 | Ga0157372_10178995 | Ga0157372_101789953 | 183 |
| 227 | 3300013307 | Ga0157372_10192916 | Ga0157372_101929162 | 183 |
| 228 | 3300013307 | Ga0157372_10515554 | Ga0157372_105155542 | 183 |
| 229 | 3300013307 | Ga0157372_11949502 | Ga0157372_119495021 | 183 |
| 230 | 3300013308 | Ga0157375_10713633 | Ga0157375_107136332 | 183 |
| 231 | 3300013308 | Ga0157375_11465647 | Ga0157375_114656471 | 183 |
| 232 | 3300014325 | Ga0163163_10437719 | Ga0163163_104377192 | 183 |
| 233 | 3300014969 | Ga0157376_10305504 | Ga0157376_103055042 | 183 |
| 234 | 3300020069 | Ga0197907_10516917 | Ga0197907_105169171 | 183 |
| 235 | 3300020069 | Ga0197907_10911782 | Ga0197907_109117822 | 183 |
| 236 | 3300020075 | Ga0206349_1390521 | Ga0206349_13905211 | 183 |
| 237 | 3300020076 | Ga0206355_1550509 | Ga0206355_15505092 | 183 |
| 238 | 3300020078 | Ga0206352_11155686 | Ga0206352_111556861 | 183 |
| 239 | 3300020080 | Ga0206350_10613185 | Ga0206350_106131851 | 183 |
| 240 | 3300020081 | Ga0206354_10441615 | Ga0206354_104416152 | 183 |
| 241 | 3300020082 | Ga0206353_11630308 | Ga0206353_116303081 | 183 |
| 242 | 3300021358 | Ga0213873_10003876 | Ga0213873_100038762 | 183 |
| 243 | 3300021361 | Ga0213872_10002472 | Ga0213872_100024724 | 183 |
| 244 | 3300021361 | Ga0213872_10025385 | Ga0213872_100253852 | 183 |
| 245 | 3300021377 | Ga0213874_10000119 | Ga0213874_100001193 | 183 |
| 246 | 3300021377 | Ga0213874_10029066 | Ga0213874_100290662 | 183 |
| 247 | 3300021377 | Ga0213874_10193024 | Ga0213874_101930241 | 183 |
| 248 | 3300021384 | Ga0213876_10006268 | Ga0213876_100062685 | 183 |
| 249 | 3300021384 | Ga0213876_10228507 | Ga0213876_102285072 | 183 |
| 250 | 3300021388 | Ga0213875_10000001 | Ga0213875_10000001238 | 183 |
| 251 | 3300021388 | Ga0213875_10003662 | Ga0213875_100036627 | 183 |
| 252 | 3300021388 | Ga0213875_10358513 | Ga0213875_103585131 | 183 |
| 253 | 3300021441 | Ga0213871_10043574 | Ga0213871_100435741 | 183 |
| 254 | 3300022467 | Ga0224712_10052178 | Ga0224712_100521781 | 183 |
| 255 | 3300022467 | Ga0224712_10274948 | Ga0224712_102749481 | 183 |
| 256 | 3300025297 | Ga0209758_1000008 | Ga0209758_1000008900 | 183 |
| 257 | 3300025903 | Ga0207680_10164896 | Ga0207680_101648962 | 183 |
| 258 | 3300025904 | Ga0207647_10568477 | Ga0207647_105684771 | 183 |
| 259 | 3300025906 | Ga0207699_10195481 | Ga0207699_101954812 | 183 |
| 260 | 3300025909 | Ga0207705_10125801 | Ga0207705_101258011 | 183 |
| 261 | 3300025912 | Ga0207707_10025674 | Ga0207707_100256744 | 183 |
| 262 | 3300025912 | Ga0207707_10170854 | Ga0207707_101708541 | 183 |
| 263 | 3300025913 | Ga0207695_10001655 | Ga0207695_1000165530 | 183 |
| 264 | 3300025913 | Ga0207695_10176885 | Ga0207695_101768852 | 183 |
| 265 | 3300025913 | Ga0207695_10435819 | Ga0207695_104358193 | 183 |
| 266 | 3300025913 | Ga0207695_10768715 | Ga0207695_107687152 | 183 |
| 267 | 3300025914 | Ga0207671_10067003 | Ga0207671_100670034 | 183 |
| 268 | 3300025914 | Ga0207671_10279324 | Ga0207671_102793242 | 183 |
| 269 | 3300025915 | Ga0207693_10110747 | Ga0207693_101107472 | 183 |
| 270 | 3300025917 | Ga0207660_10020944 | Ga0207660_100209443 | 183 |
| 271 | 3300025917 | Ga0207660_10237950 | Ga0207660_102379501 | 183 |
| 272 | 3300025919 | Ga0207657_10005146 | Ga0207657_100051468 | 183 |
| 273 | 3300025920 | Ga0207649_10080104 | Ga0207649_100801042 | 183 |
| 274 | 3300025921 | Ga0207652_10068061 | Ga0207652_100680613 | 183 |
| 275 | 3300025921 | Ga0207652_10111209 | Ga0207652_101112092 | 183 |
| 276 | 3300025924 | Ga0207694_10078411 | Ga0207694_100784113 | 183 |
| 277 | 3300025924 | Ga0207694_10104864 | Ga0207694_101048643 | 183 |
| 278 | 3300025925 | Ga0207650_10347522 | Ga0207650_103475222 | 183 |
| 279 | 3300025929 | Ga0207664_10024463 | Ga0207664_100244636 | 183 |
| 280 | 3300025932 | Ga0207690_10248942 | Ga0207690_102489422 | 183 |
| 281 | 3300025933 | Ga0207706_10178624 | Ga0207706_101786243 | 183 |
| 282 | 3300025934 | Ga0207686_10089637 | Ga0207686_100896373 | 183 |
| 283 | 3300025934 | Ga0207686_10346195 | Ga0207686_103461952 | 183 |
| 284 | 3300025938 | Ga0207704_10472555 | Ga0207704_104725551 | 183 |
| 285 | 3300025939 | Ga0207665_10358828 | Ga0207665_103588282 | 183 |
| 286 | 3300025941 | Ga0207711_10215562 | Ga0207711_102155623 | 183 |
| 287 | 3300025941 | Ga0207711_10232109 | Ga0207711_102321092 | 183 |
| 288 | 3300025944 | Ga0207661_10334801 | Ga0207661_103348011 | 183 |
| 289 | 3300025945 | Ga0207679_10005382 | Ga0207679_100053829 | 183 |
| 290 | 3300025945 | Ga0207679_10593056 | Ga0207679_105930561 | 183 |
| 291 | 3300025949 | Ga0207667_10739015 | Ga0207667_107390152 | 183 |
| 292 | 3300025961 | Ga0207712_10120159 | Ga0207712_101201593 | 183 |
| 293 | 3300026035 | Ga0207703_10316499 | Ga0207703_103164992 | 183 |
| 294 | 3300026041 | Ga0207639_10058420 | Ga0207639_100584203 | 183 |
| 295 | 3300026067 | Ga0207678_10236391 | Ga0207678_102363912 | 183 |
| 296 | 3300026078 | Ga0207702_10115282 | Ga0207702_101152822 | 183 |
| 297 | 3300026116 | Ga0207674_10263093 | Ga0207674_102630932 | 183 |
| 298 | 3300026118 | Ga0207675_100953425 | Ga0207675_1009534252 | 183 |
| 299 | 3300026121 | Ga0207683_10166074 | Ga0207683_101660743 | 183 |
| 300 | 3300026121 | Ga0207683_10351765 | Ga0207683_103517651 | 183 |
| 301 | 3300026121 | Ga0207683_11148105 | Ga0207683_111481051 | 183 |
| 302 | 3300026142 | Ga0207698_10146827 | Ga0207698_101468274 | 183 |
| 303 | 3300027907 | Ga0207428_10319885 | Ga0207428_103198851 | 183 |
| 304 | 3300028379 | Ga0268266_10181107 | Ga0268266_101811071 | 183 |
| 305 | 3300028379 | Ga0268266_11257130 | Ga0268266_112571301 | 183 |
| 306 | 3300028381 | Ga0268264_10022213 | Ga0268264_100222133 | 183 |
| 307 | 3300028577 | Ga0265318_10140842 | Ga0265318_101408421 | 183 |
| 308 | 3300028800 | Ga0265338_10000193 | Ga0265338_1000019380 | 183 |
| 309 | 3300028800 | Ga0265338_10236680 | Ga0265338_102366802 | 183 |
| 310 | 3300031238 | Ga0265332_10061548 | Ga0265332_100615481 | 183 |
| 311 | 3300031241 | Ga0265325_10001717 | Ga0265325_100017173 | 183 |
| 312 | 3300031249 | Ga0265339_10048650 | Ga0265339_100486503 | 183 |
| 313 | 3300031250 | Ga0265331_10065696 | Ga0265331_100656962 | 183 |
| 314 | 3300031251 | Ga0265327_10169719 | Ga0265327_101697192 | 183 |
| 315 | 3300031344 | Ga0265316_10114783 | Ga0265316_101147833 | 183 |
| 316 | 3300031595 | Ga0265313_10000039 | Ga0265313_10000039104 | 183 |
| 317 | 3300031711 | Ga0265314_10055372 | Ga0265314_100553722 | 183 |
| 318 | 3300031711 | Ga0265314_10396416 | Ga0265314_103964161 | 183 |
| 319 | 3300031712 | Ga0265342_10002123 | Ga0265342_100021236 | 183 |
| 320 | 3300035089 | Ga0373944_0204441 | Ga0373944_0204441_46_618 | 183 |
| 321 | 3300036401 | Ga0373937_0186355 | Ga0373937_0186355_551_1114 | 183 |
| 322 | 3300036401 | Ga0373937_0454311 | Ga0373937_0454311_253_813 | 183 |
| 323 | 3300037068 | Ga0373925_0002920 | Ga0373925_0002920_3776_4348 | 183 |
| 324 | 3300037312 | Ga0395899_0000070 | Ga0395899_0000070_165923_166555 | 183 |
| 325 | 3300037418 | Ga0395900_0088550 | Ga0395900_0088550_1633_2214 | 183 |
| 326 | 3300037418 | Ga0395900_0237214 | Ga0395900_0237214_627_1211 | 183 |
| 327 | 3300037466 | Ga0395898_0004784 | Ga0395898_0004784_11774_12352 | 183 |
| 328 | 3300037466 | Ga0395898_0005032 | Ga0395898_0005032_6933_7511 | 183 |
| 329 | 3300037466 | Ga0395898_0055232 | Ga0395898_0055232_1083_1664 | 183 |
| 330 | 3300037853 | Ga0436364_0273345 | Ga0436364_0273345_216948_217511 | 183 |
| 331 | 3300037853 | Ga0436364_1148342 | Ga0436364_1148342_263_850 | 183 |
| 332 | 3300037853 | Ga0436364_1450991 | Ga0436364_1450991_13074_13640 | 183 |
| 333 | 3300038443 | Ga0395901_0267948 | Ga0395901_0267948_493_1077 | 183 |
| 334 | 3300039437 | Ga0436365_0218820 | Ga0436365_0218820_11953_12540 | 183 |
| 335 | 3300039437 | Ga0436365_0343078 | Ga0436365_0343078_2338_2901 | 183 |
| 336 | 3300039437 | Ga0436365_1553829 | Ga0436365_1553829_6004_6567 | 183 |
| 337 | 3300039438 | Ga0436360_0365988 | Ga0436360_0365988_124_702 | 183 |
| 338 | 3300039438 | Ga0436360_0372078 | Ga0436360_0372078_445_1023 | 183 |
| 339 | 3300039438 | Ga0436360_0857744 | Ga0436360_0857744_1331_1924 | 183 |
| 340 | 3300039438 | Ga0436360_0867561 | Ga0436360_0867561_219_791 | 183 |
| 341 | 3300039438 | Ga0436360_1272743 | Ga0436360_1272743_1112_1705 | 183 |
| 342 | 3300039447 | Ga0436361_0003286 | Ga0436361_0003286_37_600 | 183 |
| 343 | 3300039447 | Ga0436361_0011345 | Ga0436361_0011345_18329_18913 | 183 |
| 344 | 3300039447 | Ga0436361_0156093 | Ga0436361_0156093_340_903 | 183 |
| 345 | 3300039447 | Ga0436361_0592342 | Ga0436361_0592342_15206_15769 | 183 |
| 346 | 3300039447 | Ga0436361_1116328 | Ga0436361_1116328_346_918 | 183 |
| 347 | 3300039447 | Ga0436361_1146136 | Ga0436361_1146136_427_1020 | 183 |
| 348 | 3300039450 | Ga0436363_0650287 | Ga0436363_0650287_862_1425 | 183 |
| 349 | 3300039450 | Ga0436363_0789833 | Ga0436363_0789833_13598_14161 | 183 |
| 350 | 3300039453 | Ga0436362_0271798 | Ga0436362_0271798_3307_3870 | 183 |
| 351 | 3300039453 | Ga0436362_0315812 | Ga0436362_0315812_2100_2693 | 183 |
| 352 | 3300039453 | Ga0436362_0358793 | Ga0436362_0358793_111_671 | 183 |
| 353 | 3300039453 | Ga0436362_0552020 | Ga0436362_0552020_80_643 | 183 |
| 354 | 3300041496 | Ga0451839_0368439 | Ga0451839_0368439_81_632 | 183 |
| 355 | 3300044712 | Ga0453684_1438898 | Ga0453684_1438898_34_594 | 183 |
| 356 | 3300045051 | Ga0451576_0162067 | Ga0451576_0162067_141_701 | 183 |
| 357 | 3300046459 | Ga0495629_0052919 | Ga0495629_0052919_141_713 | 183 |
| 358 | 3300046472 | Ga0495580_0082123 | Ga0495580_0082123_1413_1985 | 183 |
| 359 | 3300046524 | Ga0495648_0187439 | Ga0495648_0187439_11_583 | 183 |
| 360 | 3300046539 | Ga0495621_0112960 | Ga0495621_0112960_259_831 | 183 |
| 361 | 3300046615 | Ga0495656_0124802 | Ga0495656_0124802_176_748 | 183 |
| 362 | 3300046663 | Ga0495635_0103583 | Ga0495635_0103583_782_1354 | 183 |
| 363 | 3300046665 | Ga0495661_0123746 | Ga0495661_0123746_782_1354 | 183 |
| 364 | 3300046683 | Ga0495658_0009144 | Ga0495658_0009144_1366_1938 | 183 |
| 365 | 3300046691 | Ga0495670_0174166 | Ga0495670_0174166_448_1020 | 183 |
| 366 | 3300047318 | Ga0495636_0044842 | Ga0495636_0044842_919_1491 | 183 |
| 367 | 3300047319 | Ga0495674_0592510 | Ga0495674_0592510_218_790 | 183 |
| 368 | 3300047470 | Ga0495681_0187549 | Ga0495681_0187549_31_603 | 183 |
| 369 | 3300047471 | Ga0495684_0332160 | Ga0495684_0332160_117_689 | 183 |
| 370 | 3300048903 | Ga0496100_0314434 | Ga0496100_0314434_336_899 | 183 |
| 371 | 3300048903 | Ga0496100_0357932 | Ga0496100_0357932_270_842 | 183 |
| 372 | 3300048904 | Ga0496101_1070817 | Ga0496101_1070817_26_589 | 183 |
| 373 | 3300048907 | Ga0496104_0478816 | Ga0496104_0478816_349_912 | 183 |
| 374 | 3300048909 | Ga0496106_0274221 | Ga0496106_0274221_720_1283 | 183 |
| 375 | 3300048910 | Ga0496107_0199090 | Ga0496107_0199090_26_589 | 183 |
| 376 | 3300048911 | Ga0496108_0809269 | Ga0496108_0809269_155_718 | 183 |
| 377 | 3300048912 | Ga0496109_0475682 | Ga0496109_0475682_32_595 | 183 |
| 378 | 3300048923 | Ga0496120_0092138 | Ga0496120_0092138_74_646 | 183 |
| 379 | 3300049581 | Ga0501047_0537042 | Ga0501047_0537042_272_934 | 183 |
| 380 | 3300050491 | nmdc:mga00v17_143827_c1 | nmdc:mga00v17_143827_c1_96_647 | 183 |
| 381 | 3300050514 | nmdc:mga08x19_631358_c1 | nmdc:mga08x19_631358_c1_14_577 | 183 |
| 382 | 3300053108 | Ga0500562_080122 | Ga0500562_080122_106_681 | 183 |
| 383 | 3300053119 | Ga0500595_006794 | Ga0500595_006794_2418_2990 | 183 |
| 384 | 3300053140 | Ga0500573_0000009 | Ga0500573_0000009_77894_78466 | 183 |
| 385 | 3300053730 | Ga0500645_043787 | Ga0500645_043787_347_919 | 183 |
| 386 | 3300059655 | Ga0587114_021826 | Ga0587114_021826_90_677 | 183 |
| 387 | 3300003187 | JGI25151J46595_10081408 | JGI25151J46595_100814081 | 184 |
| 388 | 3300003775 | Ga0055524_1014743 | Ga0055524_10147432 | 184 |
| 389 | 3300025263 | Ga0209565_1001699 | Ga0209565_10016997 | 184 |
| 390 | 3300025291 | Ga0209675_1010332 | Ga0209675_10103322 | 184 |
| 391 | 3300025294 | Ga0209025_1003194 | Ga0209025_10031946 | 184 |
| 392 | 3300025299 | Ga0209256_1000905 | Ga0209256_100090525 | 184 |
| 393 | 3300025303 | Ga0209051_1001616 | Ga0209051_100161615 | 184 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2chp-assembly1.cif.gz_A | crystal structure of the dodecameric ferritin mrga from b. subtilis 168 | 0.9543 | 35 | 175 |
| 2vzb-assembly1.cif.gz_A | a dodecameric thioferritin in the bacterial domain, characterization of the bacterioferritin-related protein from bacteroides fragilis | 0.9526 | 32 | 177 |
| 8ff9-assembly1.cif.gz_B | crystal structure of apo dps protein (pa0962) from pseudomonas aeruginosa (orthorhombic form) | 0.9519 | 34 | 175 |
| 4m34-assembly1.cif.gz_B | crystal structure of gated-pore mutant d138h of second dna-binding protein under starvation from mycobacterium smegmatis | 0.9478 | 37 | 168 |
| 2d5k-assembly1.cif.gz_B | crystal structure of dps from staphylococcus aureus | 0.9474 | 38 | 175 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2chpA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9543 | 35 | 175 | 1.20.1260.10 |
| 2vzbB00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9526 | 32 | 177 | 1.20.1260.10 |
| 2c41C01 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9487 | 36 | 175 | 1.20.1260.10 |
| 2yw7F00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9478 | 35 | 171 | 1.20.1260.10 |
| 4cyaA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9451 | 35 | 175 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F1VVE5-F1-model_v4 | Putative bacterioferritin | 0.9973 | 42 | 177 |
GO:0004322
GO:0005829 GO:0006880 GO:0008199 GO:0020037 |
| AF-A0A3M5D710-F1-model_v4 | Ferritin-like diiron domain-containing protein | 0.9945 | 84 | 179 |
GO:0004322
GO:0005829 GO:0006880 GO:0008199 GO:0020037 |
| AF-E6PIX5-F1-model_v4 | Putative bacterioferritin (Cytochrome b1) | 0.9917 | 23 | 179 |
GO:0004322
GO:0005829 GO:0006880 GO:0008199 GO:0020037 |
| AF-A0A656GYT0-F1-model_v4 | deleted | 0.9908 | 43 | 177 |
|
| AF-A0A0N1JPV0-F1-model_v4 | ferroxidase (EC 1.16.3.1) | 0.9863 | 27 | 177 |
GO:0004322
GO:0005829 GO:0006826 GO:0006880 GO:0008199 GO:0020037 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar