F432647

General Info

Members Datasets Scaffolds Average Seq Length
393 229 786 193

Family's Representative Sequence

Representative Sequence 3300035118|Ga0373954_0020719|Ga0373954_0020719_879_1535
Length 218
Sequence LVADHFPDVAVTTSVVADNASQRSTEMGKIVITTNVSLDGVVQDPDGEEGFRLGGWFGQFGGKDLQQWARVETDEALGAEALLLGRRSDEWFASRWSSRSGEWADKLNSMPKYVVSSTLEHPRWSNATVLKGGVVAGVSKLKQEFDGEILVYASYQLVRTLMEYDLVDELRLVVFPVVLGAGERLFGETSDNKPLRLLSTRTIGDGLAFLTYELVRDA

Samples

Sample ID Description Type Environment
1 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
119 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
120 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
121 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
128 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
133 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
227 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
228 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
229 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0.25
Rhizoplane 5.6
Rhizosphere 90.59
Stem 0
Stem Tuber 0
Unclassified 7.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373954_0020719 3300035118 Bacteria 2976
2 Ga0070683_101293089 3300005329 Bacteria 701
3 Ga0068869_100344008 3300005334 Unclassified 1214
4 Ga0068869_100362649 3300005334 Bacteria 1184
5 Ga0068868_100087516 3300005338 Bacteria 2505
6 Ga0070661_100185939 3300005344 Bacteria 1583
7 Ga0070675_100109091 3300005354 Bacteria 2339
8 Ga0070671_100052382 3300005355 Bacteria 3393
9 Ga0070674_100077443 3300005356 Bacteria 2367
10 Ga0070659_100024814 3300005366 Bacteria 4599
11 Ga0070659_100147015 3300005366 Bacteria 1921
12 Ga0070667_100466421 3300005367 Bacteria 1155
13 Ga0070667_101240534 3300005367 Unclassified 698
14 Ga0070714_100211721 3300005435 Bacteria 1777
15 Ga0070714_100215592 3300005435 Bacteria 1762
16 Ga0070714_100297270 3300005435 Bacteria 1504
17 Ga0070713_100173205 3300005436 Bacteria 1934
18 Ga0070713_100302493 3300005436 Bacteria 1473
19 Ga0070713_100332965 3300005436 Bacteria 1405
20 Ga0070713_100384160 3300005436 Bacteria 1309
21 Ga0070713_100766012 3300005436 Unclassified 924
22 Ga0070711_100972791 3300005439 Bacteria 727
23 Ga0070700_100005760 3300005441 Bacteria 6575
24 Ga0070708_100225424 3300005445 Bacteria 1758
25 Ga0070708_100240679 3300005445 Bacteria 1699
26 Ga0070678_100610470 3300005456 Bacteria 975
27 Ga0070681_10530941 3300005458 Bacteria 1090
28 Ga0070685_10070185 3300005466 Bacteria 2074
29 Ga0070706_100001281 3300005467 Bacteria 26829
30 Ga0070706_100060531 3300005467 Bacteria 3495
31 Ga0070707_100037198 3300005468 Bacteria 4645
32 Ga0070707_100041348 3300005468 Bacteria 4412
33 Ga0070707_100214314 3300005468 Bacteria 1876
34 Ga0070698_100033534 3300005471 Bacteria 5317
35 Ga0070699_100001763 3300005518 Bacteria 19727
36 Ga0070699_100660114 3300005518 Bacteria 955
37 Ga0070684_100022718 3300005535 Bacteria 5236
38 Ga0070684_100210243 3300005535 Bacteria 1773
39 Ga0070672_100063574 3300005543 Bacteria 2915
40 Ga0070672_100430205 3300005543 Bacteria 1135
41 Ga0070693_100122982 3300005547 Bacteria 1612
42 Ga0070665_100141519 3300005548 Bacteria 2409
43 Ga0070665_100649101 3300005548 Bacteria 1068
44 Ga0070704_100527005 3300005549 Unclassified 1029
45 Ga0068855_100102627 3300005563 Bacteria 3292
46 Ga0068857_100500910 3300005577 Bacteria 1140
47 Ga0068854_100120037 3300005578 Bacteria 1994
48 Ga0068856_100002350 3300005614 Bacteria 19453
49 Ga0068856_100608464 3300005614 Bacteria 1114
50 Ga0068852_100126764 3300005616 Bacteria 2345
51 Ga0068864_100109390 3300005618 Bacteria 2460
52 Ga0068864_100514253 3300005618 Unclassified 1153
53 Ga0068866_10057876 3300005718 Bacteria 1999
54 Ga0068866_10397912 3300005718 Bacteria 888
55 Ga0068851_10482864 3300005834 Unclassified 741
56 Ga0068858_100060851 3300005842 Bacteria 3491
57 Ga0068860_100814207 3300005843 Unclassified 948
58 Ga0081455_10139187 3300005937 Bacteria 1887
59 Ga0081455_10168750 3300005937 Bacteria 1669
60 Ga0070717_10071662 3300006028 Bacteria 2891
61 Ga0070717_10080108 3300006028 Bacteria 2739
62 Ga0070715_10098498 3300006163 Bacteria 1359
63 Ga0070716_100031643 3300006173 Bacteria 2879
64 Ga0070716_100091330 3300006173 Bacteria 1844
65 Ga0070712_100160105 3300006175 Bacteria 1738
66 Ga0070712_100348177 3300006175 Unclassified 1212
67 Ga0070712_100462854 3300006175 Bacteria 1058
68 Ga0075367_10107831 3300006178 Bacteria 1707
69 Ga0068871_100757600 3300006358 Bacteria 893
70 Ga0075428_100015367 3300006844 Bacteria 8489
71 Ga0075431_100201132 3300006847 Bacteria 2038
72 Ga0075431_100389422 3300006847 Bacteria 1396
73 Ga0075431_100559696 3300006847 Bacteria 1130
74 Ga0075433_10185188 3300006852 Bacteria 1852
75 Ga0075434_100022582 3300006871 Bacteria 6128
76 Ga0075434_100028306 3300006871 Bacteria 5504
77 Ga0075434_100749090 3300006871 Bacteria 994
78 Ga0075429_100023263 3300006880 Bacteria 5374
79 Ga0068865_100065021 3300006881 Bacteria 2569
80 Ga0075436_100017128 3300006914 Bacteria 4959
81 Ga0075435_100006560 3300007076 Bacteria 8232
82 Ga0075435_100007744 3300007076 Bacteria 7675
83 Ga0111539_10011521 3300009094 Bacteria 11096
84 Ga0111539_10260748 3300009094 Bacteria 2017
85 Ga0105245_10021283 3300009098 Bacteria 5686
86 Ga0114129_10235239 3300009147 Bacteria 2465
87 Ga0105243_10638025 3300009148 Bacteria 1031
88 Ga0105243_10728327 3300009148 Bacteria 970
89 Ga0105241_10269979 3300009174 Unclassified 1449
90 Ga0105242_10438876 3300009176 Unclassified 1228
91 Ga0105248_10660155 3300009177 Unclassified 1180
92 Ga0105249_10045017 3300009553 Bacteria 4013
93 Ga0105249_10649786 3300009553 Bacteria 1112
94 Ga0105239_10015291 3300010375 Bacteria 8505
95 Ga0105246_10006797 3300011119 Bacteria 6992
96 Ga0157370_11282835 3300013104 Unclassified 660
97 Ga0157374_10002259 3300013296 Bacteria 16223
98 Ga0163162_11395266 3300013306 Unclassified 797
99 Ga0157372_10005495 3300013307 Bacteria 13464
100 Ga0157375_10014181 3300013308 Bacteria 7105
101 Ga0157375_10386975 3300013308 Bacteria 1565
102 Ga0163163_10305792 3300014325 Bacteria 1642
103 Ga0163163_11638737 3300014325 Bacteria 704
104 Ga0157380_10610299 3300014326 Unclassified 1081
105 Ga0157380_10648932 3300014326 Bacteria 1052
106 Ga0157377_10001156 3300014745 Bacteria 11197
107 Ga0157379_10819673 3300014968 Unclassified 879
108 Ga0157376_10015589 3300014969 Bacteria 5746
109 Ga0224572_1004942 3300024225 Bacteria 2355
110 Ga0207656_10345735 3300025321 Unclassified 742
111 Ga0207692_10013223 3300025898 Bacteria 3574
112 Ga0207692_10480152 3300025898 Unclassified 786
113 Ga0207688_10001058 3300025901 Bacteria 14077
114 Ga0207688_10026680 3300025901 Bacteria 3178
115 Ga0207685_10008643 3300025905 Bacteria 2914
116 Ga0207705_10610055 3300025909 Bacteria 848
117 Ga0207684_10001352 3300025910 Bacteria 26867
118 Ga0207684_10358078 3300025910 Bacteria 1256
119 Ga0207654_10639553 3300025911 Unclassified 761
120 Ga0207671_10570908 3300025914 Bacteria 902
121 Ga0207693_10023218 3300025915 Bacteria 4925
122 Ga0207693_10057325 3300025915 Bacteria 3053
123 Ga0207693_10422798 3300025915 Bacteria 1041
124 Ga0207693_10617026 3300025915 Bacteria 844
125 Ga0207693_10990252 3300025915 Bacteria 642
126 Ga0207663_10029012 3300025916 Bacteria 3245
127 Ga0207663_10032553 3300025916 Bacteria 3096
128 Ga0207646_10071389 3300025922 Bacteria 3101
129 Ga0207646_10110789 3300025922 Bacteria 2463
130 Ga0207646_10113515 3300025922 Bacteria 2432
131 Ga0207681_10919649 3300025923 Bacteria 733
132 Ga0207659_10178757 3300025926 Unclassified 1679
133 Ga0207687_10091399 3300025927 Bacteria 2220
134 Ga0207687_10589420 3300025927 Bacteria 936
135 Ga0207700_10159674 3300025928 Bacteria 1871
136 Ga0207664_11005602 3300025929 Bacteria 747
137 Ga0207690_10398349 3300025932 Unclassified 1097
138 Ga0207690_10433799 3300025932 Bacteria 1053
139 Ga0207706_10009097 3300025933 Bacteria 9132
140 Ga0207709_10370238 3300025935 Bacteria 1087
141 Ga0207669_10105925 3300025937 Unclassified 1872
142 Ga0207704_10049834 3300025938 Bacteria 2523
143 Ga0207665_10005018 3300025939 Bacteria 8834
144 Ga0207665_10013160 3300025939 Bacteria 5440
145 Ga0207691_10170495 3300025940 Bacteria 1906
146 Ga0207691_10185123 3300025940 Bacteria 1818
147 Ga0207711_10198196 3300025941 Bacteria 1832
148 Ga0207689_10584674 3300025942 Bacteria 939
149 Ga0207689_10923790 3300025942 Unclassified 736
150 Ga0207679_10400936 3300025945 Unclassified 1207
151 Ga0207651_10619294 3300025960 Unclassified 948
152 Ga0207712_10108492 3300025961 Bacteria 2077
153 Ga0207712_10116276 3300025961 Bacteria 2015
154 Ga0207668_10768733 3300025972 Bacteria 851
155 Ga0207658_10634640 3300025986 Bacteria 962
156 Ga0207677_10259273 3300026023 Unclassified 1416
157 Ga0207703_10034293 3300026035 Bacteria 4027
158 Ga0207639_10891474 3300026041 Bacteria 831
159 Ga0207708_10002239 3300026075 Bacteria 14260
160 Ga0207702_10187062 3300026078 Bacteria 1910
161 Ga0207648_10093331 3300026089 Bacteria 2632
162 Ga0207676_10095800 3300026095 Bacteria 2448
163 Ga0207674_10176751 3300026116 Bacteria 2087
164 Ga0207675_100064407 3300026118 Bacteria 3426
165 Ga0207675_101622828 3300026118 Bacteria 667
166 Ga0207683_10199219 3300026121 Bacteria 1819
167 Ga0268266_10029852 3300028379 Bacteria 4633
168 Ga0268266_11010692 3300028379 Bacteria 805
169 Ga0268265_10073802 3300028380 Bacteria 2666
170 Ga0307509_10302991 3300031507 Bacteria 1345
171 Ga0307407_10832808 3300031903 Bacteria 704
172 Ga0373948_0003597 3300034817 Bacteria 2395
173 Ga0373934_0018886 3300035086 Bacteria 2641
174 Ga0373934_0235700 3300035086 Bacteria 756
175 Ga0373944_0014185 3300035089 Bacteria 2222
176 Ga0373949_0089133 3300035090 Bacteria 832
177 Ga0373923_0010542 3300035111 Bacteria 3366
178 Ga0373923_0018313 3300035111 Bacteria 2693
179 Ga0373936_0005237 3300035113 Bacteria 4879
180 Ga0373945_0000629 3300035116 Bacteria 10146
181 Ga0373953_0031585 3300035117 Bacteria 2060
182 Ga0373954_0051973 3300035118 Bacteria 1925
183 Ga0373956_0013025 3300035119 Bacteria 3457
184 Ga0373956_0040376 3300035119 Bacteria 2069
185 Ga0373957_0001658 3300035120 Bacteria 6099
186 Ga0373960_0046887 3300035121 Bacteria 1269
187 Ga0373943_0103099 3300035170 Bacteria 1495
188 Ga0373943_0356049 3300035170 Bacteria 839
189 Ga0373946_0000348 3300035171 Bacteria 14964
190 Ga0373955_0046429 3300035172 Bacteria 2348
191 Ga0373955_0060316 3300035172 Bacteria 2092
192 Ga0373955_0069702 3300035172 Bacteria 1962
193 Ga0373962_0005643 3300035242 Bacteria 3022
194 Ga0373924_0007118 3300035410 Bacteria 4032
195 Ga0373924_0107501 3300035410 Bacteria 1203
196 Ga0373931_0346745 3300035691 Bacteria 929
197 Ga0373931_0412635 3300035691 Bacteria 857
198 Ga0373935_0001355 3300035692 Bacteria 13558
199 Ga0373935_0008871 3300035692 Bacteria 6017
200 Ga0373927_0003290 3300035695 Bacteria 11624
201 Ga0373927_0295497 3300035695 Bacteria 1066
202 Ga0373933_0013412 3300035724 Bacteria 4541
203 Ga0373933_0110315 3300035724 Bacteria 1715
204 Ga0373933_0113082 3300035724 Bacteria 1695
205 Ga0373947_0021116 3300035725 Bacteria 3767
206 Ga0373947_0584314 3300035725 Bacteria 761
207 Ga0373937_0006610 3300036401 Bacteria 10013
208 Ga0373937_0084471 3300036401 Bacteria 2937
209 Ga0373937_0185442 3300036401 Bacteria 1954
210 Ga0373937_0315611 3300036401 Bacteria 1478
211 Ga0373925_0005071 3300037068 Bacteria 9853
212 Ga0373925_0069567 3300037068 Bacteria 2659
213 Ga0373925_0356575 3300037068 Bacteria 1188
214 Ga0395901_1337278 3300038443 Bacteria 677
215 Ga0436361_1217152 3300039447 Unclassified 1430
216 Ga0436363_0760983 3300039450 Bacteria 2325
217 Ga0436363_1364711 3300039450 Bacteria 824
218 Ga0436363_1672748 3300039450 Bacteria 758
219 Ga0436362_1112319 3300039453 Unclassified 800
220 Ga0451849_0239845 3300041505 Bacteria 799
221 Ga0466969_0018813 3300044656 Bacteria 3596
222 Ga0466966_0004717 3300044684 Bacteria 8971
223 Ga0466961_0010073 3300044693 Bacteria 6023
224 Ga0466961_0246857 3300044693 Bacteria 1097
225 Ga0466963_0148432 3300044694 Bacteria 1628
226 Ga0466963_0188209 3300044694 Bacteria 1442
227 Ga0466968_0025086 3300044735 Bacteria 2440
228 Ga0466957_0092224 3300044842 Bacteria 1899
229 Ga0466959_0009333 3300045049 Bacteria 6972
230 Ga0466959_0050016 3300045049 Bacteria 3070
231 Ga0466959_0317262 3300045049 Bacteria 1066
232 Ga0466958_0000560 3300045836 Bacteria 15813
233 Ga0466958_0101150 3300045836 Bacteria 1792
234 Ga0466967_0130839 3300045976 Bacteria 2329
235 Ga0466967_0181277 3300045976 Bacteria 1987
236 Ga0495592_0059107 3300046454 Bacteria 2825
237 Ga0495592_0061577 3300046454 Bacteria 2757
238 Ga0495629_0014237 3300046459 Bacteria 5728
239 Ga0495629_0500542 3300046459 Bacteria 819
240 Ga0495651_0004509 3300046462 Bacteria 10656
241 Ga0495651_0015703 3300046462 Bacteria 5863
242 Ga0495651_0018898 3300046462 Bacteria 5339
243 Ga0495651_0020706 3300046462 Bacteria 5106
244 Ga0495653_0042459 3300046463 Bacteria 3542
245 Ga0495653_0063444 3300046463 Bacteria 2788
246 Ga0495653_0290075 3300046463 Bacteria 1070
247 Ga0495582_0096645 3300046473 Bacteria 1651
248 Ga0495639_0110341 3300046475 Bacteria 1305
249 Ga0495639_0160783 3300046475 Bacteria 1087
250 Ga0495639_0231977 3300046475 Bacteria 909
251 Ga0495662_0014615 3300046476 Bacteria 3816
252 Ga0495664_0010641 3300046477 Bacteria 5164
253 Ga0495664_0023521 3300046477 Bacteria 3576
254 Ga0495664_0249142 3300046477 Bacteria 1074
255 Ga0495608_0018861 3300046511 Bacteria 4753
256 Ga0495608_0020575 3300046511 Bacteria 4536
257 Ga0495618_0008190 3300046514 Bacteria 6330
258 Ga0495618_0263631 3300046514 Bacteria 1078
259 Ga0495628_0074557 3300046516 Bacteria 2643
260 Ga0495628_0085080 3300046516 Bacteria 2453
261 Ga0495628_0186790 3300046516 Bacteria 1566
262 Ga0495628_0707078 3300046516 Bacteria 711
263 Ga0495628_0754665 3300046516 Bacteria 683
264 Ga0495628_0974908 3300046516 Bacteria 584
265 Ga0495630_0126157 3300046517 Bacteria 1942
266 Ga0495630_0343290 3300046517 Bacteria 1143
267 Ga0495666_0055407 3300046526 Bacteria 1900
268 Ga0495652_0014369 3300046529 Bacteria 7107
269 Ga0495652_0016186 3300046529 Bacteria 6668
270 Ga0495652_0224100 3300046529 Bacteria 1411
271 Ga0495652_0226904 3300046529 Bacteria 1399
272 Ga0495665_0040668 3300046531 Bacteria 2475
273 Ga0495665_0058983 3300046531 Bacteria 2026
274 Ga0495640_0040575 3300046533 Bacteria 3258
275 Ga0495586_0110817 3300046535 Bacteria 1527
276 Ga0495587_0017576 3300046536 Bacteria 4442
277 Ga0495587_0037187 3300046536 Bacteria 2924
278 Ga0495587_0336859 3300046536 Bacteria 842
279 Ga0495645_0076534 3300046543 Bacteria 2407
280 Ga0495645_0107366 3300046543 Bacteria 1979
281 Ga0495667_0019717 3300046559 Bacteria 4550
282 Ga0495667_0069860 3300046559 Bacteria 2292
283 Ga0495667_0083502 3300046559 Bacteria 2074
284 Ga0495667_0084007 3300046559 Bacteria 2067
285 Ga0495634_0030350 3300046642 Bacteria 3733
286 Ga0495634_0032569 3300046642 Bacteria 3585
287 Ga0495634_0085736 3300046642 Bacteria 2052
288 Ga0495635_0028681 3300046663 Bacteria 3869
289 Ga0495635_0239803 3300046663 Bacteria 1223
290 Ga0495635_0334238 3300046663 Bacteria 1012
291 Ga0495635_0610856 3300046663 Bacteria 711
292 Ga0495657_0004943 3300046675 Bacteria 10598
293 Ga0495657_0051604 3300046675 Bacteria 2761
294 Ga0495657_0057219 3300046675 Bacteria 2593
295 Ga0495657_0077352 3300046675 Bacteria 2159
296 Ga0495599_0094143 3300046678 Bacteria 1868
297 Ga0495623_0005618 3300046679 Bacteria 8186
298 Ga0495623_0128940 3300046679 Bacteria 1516
299 Ga0495646_0018237 3300046680 Bacteria 4444
300 Ga0495658_0028342 3300046683 Bacteria 3022
301 Ga0495613_0008136 3300046689 Bacteria 7800
302 Ga0495613_0008345 3300046689 Bacteria 7692
303 Ga0495613_0020584 3300046689 Bacteria 4918
304 Ga0495624_0100059 3300046690 Bacteria 1785
305 Ga0495624_0124079 3300046690 Bacteria 1585
306 Ga0495600_0058559 3300046809 Bacteria 2516
307 Ga0495600_0063421 3300046809 Bacteria 2415
308 Ga0495581_0005214 3300047315 Bacteria 7520
309 Ga0495581_0171225 3300047315 Bacteria 1270
310 Ga0495604_0003632 3300047317 Bacteria 12306
311 Ga0495604_0007588 3300047317 Bacteria 8586
312 Ga0495604_0020082 3300047317 Bacteria 5339
313 Ga0495674_0009266 3300047319 Bacteria 9355
314 Ga0495674_0224298 3300047319 Bacteria 1552
315 Ga0495674_0247736 3300047319 Bacteria 1467
316 Ga0495674_0363267 3300047319 Bacteria 1173
317 Ga0495676_0044367 3300047321 Bacteria 3629
318 Ga0495676_0109969 3300047321 Bacteria 2024
319 Ga0495680_0008481 3300047322 Bacteria 9337
320 Ga0495680_0040108 3300047322 Bacteria 3731
321 Ga0495680_0184783 3300047322 Bacteria 1502
322 Ga0495687_016418 3300047443 Bacteria 3723
323 Ga0495675_0009442 3300047444 Bacteria 6069
324 Ga0495675_0031356 3300047444 Bacteria 3393
325 Ga0495675_0101120 3300047444 Bacteria 1804
326 Ga0495675_0375897 3300047444 Bacteria 832
327 Ga0495684_0053543 3300047471 Bacteria 3079
328 Ga0495684_0057335 3300047471 Bacteria 2968
329 Ga0495684_0065847 3300047471 Bacteria 2754
330 Ga0495684_0293123 3300047471 Bacteria 1170
331 Ga0495593_0010714 3300047673 Bacteria 5286
332 Ga0495593_0049136 3300047673 Bacteria 2239
333 Ga0495602_0007072 3300048088 Bacteria 11782
334 Ga0495602_0016197 3300048088 Bacteria 7500
335 Ga0495602_0353674 3300048088 Bacteria 1059
336 Ga0495602_0629880 3300048088 Bacteria 734
337 Ga0495614_0006908 3300048089 Bacteria 5075
338 Ga0496100_0789852 3300048903 Bacteria 743
339 Ga0496102_0065780 3300048905 Bacteria 3323
340 Ga0496102_0313924 3300048905 Bacteria 1477
341 Ga0496102_0372207 3300048905 Bacteria 1344
342 Ga0496103_0096226 3300048906 Bacteria 1871
343 Ga0496104_0005702 3300048907 Bacteria 10899
344 Ga0496105_0024554 3300048908 Bacteria 4898
345 Ga0496105_0148123 3300048908 Bacteria 1930
346 Ga0496105_0579645 3300048908 Bacteria 873
347 Ga0496107_0062654 3300048910 Bacteria 2694
348 Ga0496108_0051892 3300048911 Bacteria 3435
349 Ga0496108_0583875 3300048911 Bacteria 974
350 Ga0496109_0010800 3300048912 Bacteria 7818
351 Ga0496110_0028232 3300048913 Bacteria 4816
352 Ga0496112_0176320 3300048915 Bacteria 2102
353 Ga0496112_0273343 3300048915 Bacteria 1638
354 Ga0496112_0311554 3300048915 Bacteria 1519
355 Ga0496113_0076676 3300048916 Bacteria 2554
356 Ga0496114_0397368 3300048917 Bacteria 1221
357 Ga0496114_0633738 3300048917 Unclassified 941
358 Ga0496115_0402725 3300048918 Bacteria 1110
359 Ga0496115_0554267 3300048918 Unclassified 918
360 Ga0496116_0000133 3300048919 Bacteria 153938
361 Ga0496116_0097979 3300048919 Bacteria 1761
362 Ga0496117_0005646 3300048920 Bacteria 13056
363 Ga0496118_0000762 3300048921 Bacteria 51756
364 Ga0496119_0003356 3300048922 Bacteria 16670
365 Ga0496120_0095887 3300048923 Bacteria 1576
366 Ga0501042_0025592 3300049578 Bacteria 4146
367 nmdc:mga05p37_1476_c1 3300050507 Bacteria 27323
368 nmdc:mga05p37_28122_c1 3300050507 Bacteria 6852
369 nmdc:mga09592_65101_c1 3300050508 Bacteria 3087
370 nmdc:mga08y16_232647_c1 3300050511 Bacteria 1906
371 nmdc:mga08y16_27357_c1 3300050511 Bacteria 6008
372 nmdc:mga0n895_15165_c1 3300050512 Bacteria 7022
373 nmdc:mga0n895_3711_c1 3300050512 Bacteria 12350
374 nmdc:mga0n895_3719_c1 3300050512 Bacteria 12341
375 nmdc:mga0n895_429270_c1 3300050512 Bacteria 1335
376 nmdc:mga0n895_815147_c1 3300050512 Bacteria 923
377 nmdc:mga0n895_972610_c1 3300050512 Bacteria 831
378 nmdc:mga0rr50_18569_c1 3300050513 Bacteria 4674
379 nmdc:mga0rr50_35744_c1 3300050513 Bacteria 3571
380 nmdc:mga0rr50_6529_c1 3300050513 Bacteria 7112
381 nmdc:mga0a205_11994_c1 3300050515 Bacteria 8004
382 nmdc:mga0a205_206042_c1 3300050515 Bacteria 1856
383 nmdc:mga0a205_29170_c1 3300050515 Bacteria 5281
384 Ga0495601_0068239 3300053077 Bacteria 2266
385 Ga0495612_0022220 3300053078 Bacteria 2543
386 Ga0495595_0006512 3300053084 Bacteria 4764
387 Ga0495595_0025522 3300053084 Bacteria 2620
388 Ga0495619_0002063 3300053085 Bacteria 13346
389 Ga0500620_028715 3300053155 Bacteria 1742
390 Ga0466962_0008965 3300061719 Bacteria 4793
391 2616702447 2616644814 Bacteria 11555299
392 2870784994 2870782633 Bacteria 9624083
393 8002790810 8002784119 Bacteria 9788632
394 Ga0373954_0020719
395 Ga0070683_101293089
396 Ga0068869_100344008
397 Ga0068869_100362649
398 Ga0068868_100087516
399 Ga0070661_100185939
400 Ga0070675_100109091
401 Ga0070671_100052382
402 Ga0070674_100077443
403 Ga0070659_100024814
404 Ga0070659_100147015
405 Ga0070667_100466421
406 Ga0070667_101240534
407 Ga0070714_100211721
408 Ga0070714_100215592
409 Ga0070714_100297270
410 Ga0070713_100173205
411 Ga0070713_100302493
412 Ga0070713_100332965
413 Ga0070713_100384160
414 Ga0070713_100766012
415 Ga0070711_100972791
416 Ga0070700_100005760
417 Ga0070708_100225424
418 Ga0070708_100240679
419 Ga0070678_100610470
420 Ga0070681_10530941
421 Ga0070685_10070185
422 Ga0070706_100001281
423 Ga0070706_100060531
424 Ga0070707_100037198
425 Ga0070707_100041348
426 Ga0070707_100214314
427 Ga0070698_100033534
428 Ga0070699_100001763
429 Ga0070699_100660114
430 Ga0070684_100022718
431 Ga0070684_100210243
432 Ga0070672_100063574
433 Ga0070672_100430205
434 Ga0070693_100122982
435 Ga0070665_100141519
436 Ga0070665_100649101
437 Ga0070704_100527005
438 Ga0068855_100102627
439 Ga0068857_100500910
440 Ga0068854_100120037
441 Ga0068856_100002350
442 Ga0068856_100608464
443 Ga0068852_100126764
444 Ga0068864_100109390
445 Ga0068864_100514253
446 Ga0068866_10057876
447 Ga0068866_10397912
448 Ga0068851_10482864
449 Ga0068858_100060851
450 Ga0068860_100814207
451 Ga0081455_10139187
452 Ga0081455_10168750
453 Ga0070717_10071662
454 Ga0070717_10080108
455 Ga0070715_10098498
456 Ga0070716_100031643
457 Ga0070716_100091330
458 Ga0070712_100160105
459 Ga0070712_100348177
460 Ga0070712_100462854
461 Ga0075367_10107831
462 Ga0068871_100757600
463 Ga0075428_100015367
464 Ga0075431_100201132
465 Ga0075431_100389422
466 Ga0075431_100559696
467 Ga0075433_10185188
468 Ga0075434_100022582
469 Ga0075434_100028306
470 Ga0075434_100749090
471 Ga0075429_100023263
472 Ga0068865_100065021
473 Ga0075436_100017128
474 Ga0075435_100006560
475 Ga0075435_100007744
476 Ga0111539_10011521
477 Ga0111539_10260748
478 Ga0105245_10021283
479 Ga0114129_10235239
480 Ga0105243_10638025
481 Ga0105243_10728327
482 Ga0105241_10269979
483 Ga0105242_10438876
484 Ga0105248_10660155
485 Ga0105249_10045017
486 Ga0105249_10649786
487 Ga0105239_10015291
488 Ga0105246_10006797
489 Ga0157370_11282835
490 Ga0157374_10002259
491 Ga0163162_11395266
492 Ga0157372_10005495
493 Ga0157375_10014181
494 Ga0157375_10386975
495 Ga0163163_10305792
496 Ga0163163_11638737
497 Ga0157380_10610299
498 Ga0157380_10648932
499 Ga0157377_10001156
500 Ga0157379_10819673
501 Ga0157376_10015589
502 Ga0224572_1004942
503 Ga0207656_10345735
504 Ga0207692_10013223
505 Ga0207692_10480152
506 Ga0207688_10001058
507 Ga0207688_10026680
508 Ga0207685_10008643
509 Ga0207705_10610055
510 Ga0207684_10001352
511 Ga0207684_10358078
512 Ga0207654_10639553
513 Ga0207671_10570908
514 Ga0207693_10023218
515 Ga0207693_10057325
516 Ga0207693_10422798
517 Ga0207693_10617026
518 Ga0207693_10990252
519 Ga0207663_10029012
520 Ga0207663_10032553
521 Ga0207646_10071389
522 Ga0207646_10110789
523 Ga0207646_10113515
524 Ga0207681_10919649
525 Ga0207659_10178757
526 Ga0207687_10091399
527 Ga0207687_10589420
528 Ga0207700_10159674
529 Ga0207664_11005602
530 Ga0207690_10398349
531 Ga0207690_10433799
532 Ga0207706_10009097
533 Ga0207709_10370238
534 Ga0207669_10105925
535 Ga0207704_10049834
536 Ga0207665_10005018
537 Ga0207665_10013160
538 Ga0207691_10170495
539 Ga0207691_10185123
540 Ga0207711_10198196
541 Ga0207689_10584674
542 Ga0207689_10923790
543 Ga0207679_10400936
544 Ga0207651_10619294
545 Ga0207712_10108492
546 Ga0207712_10116276
547 Ga0207668_10768733
548 Ga0207658_10634640
549 Ga0207677_10259273
550 Ga0207703_10034293
551 Ga0207639_10891474
552 Ga0207708_10002239
553 Ga0207702_10187062
554 Ga0207648_10093331
555 Ga0207676_10095800
556 Ga0207674_10176751
557 Ga0207675_100064407
558 Ga0207675_101622828
559 Ga0207683_10199219
560 Ga0268266_10029852
561 Ga0268266_11010692
562 Ga0268265_10073802
563 Ga0307509_10302991
564 Ga0307407_10832808
565 Ga0373948_0003597
566 Ga0373934_0018886
567 Ga0373934_0235700
568 Ga0373944_0014185
569 Ga0373949_0089133
570 Ga0373923_0010542
571 Ga0373923_0018313
572 Ga0373936_0005237
573 Ga0373945_0000629
574 Ga0373953_0031585
575 Ga0373954_0051973
576 Ga0373956_0013025
577 Ga0373956_0040376
578 Ga0373957_0001658
579 Ga0373960_0046887
580 Ga0373943_0103099
581 Ga0373943_0356049
582 Ga0373946_0000348
583 Ga0373955_0046429
584 Ga0373955_0060316
585 Ga0373955_0069702
586 Ga0373962_0005643
587 Ga0373924_0007118
588 Ga0373924_0107501
589 Ga0373931_0346745
590 Ga0373931_0412635
591 Ga0373935_0001355
592 Ga0373935_0008871
593 Ga0373927_0003290
594 Ga0373927_0295497
595 Ga0373933_0013412
596 Ga0373933_0110315
597 Ga0373933_0113082
598 Ga0373947_0021116
599 Ga0373947_0584314
600 Ga0373937_0006610
601 Ga0373937_0084471
602 Ga0373937_0185442
603 Ga0373937_0315611
604 Ga0373925_0005071
605 Ga0373925_0069567
606 Ga0373925_0356575
607 Ga0395901_1337278
608 Ga0436361_1217152
609 Ga0436363_0760983
610 Ga0436363_1364711
611 Ga0436363_1672748
612 Ga0436362_1112319
613 Ga0451849_0239845
614 Ga0466969_0018813
615 Ga0466966_0004717
616 Ga0466961_0010073
617 Ga0466961_0246857
618 Ga0466963_0148432
619 Ga0466963_0188209
620 Ga0466968_0025086
621 Ga0466957_0092224
622 Ga0466959_0009333
623 Ga0466959_0050016
624 Ga0466959_0317262
625 Ga0466958_0000560
626 Ga0466958_0101150
627 Ga0466967_0130839
628 Ga0466967_0181277
629 Ga0495592_0059107
630 Ga0495592_0061577
631 Ga0495629_0014237
632 Ga0495629_0500542
633 Ga0495651_0004509
634 Ga0495651_0015703
635 Ga0495651_0018898
636 Ga0495651_0020706
637 Ga0495653_0042459
638 Ga0495653_0063444
639 Ga0495653_0290075
640 Ga0495582_0096645
641 Ga0495639_0110341
642 Ga0495639_0160783
643 Ga0495639_0231977
644 Ga0495662_0014615
645 Ga0495664_0010641
646 Ga0495664_0023521
647 Ga0495664_0249142
648 Ga0495608_0018861
649 Ga0495608_0020575
650 Ga0495618_0008190
651 Ga0495618_0263631
652 Ga0495628_0074557
653 Ga0495628_0085080
654 Ga0495628_0186790
655 Ga0495628_0707078
656 Ga0495628_0754665
657 Ga0495628_0974908
658 Ga0495630_0126157
659 Ga0495630_0343290
660 Ga0495666_0055407
661 Ga0495652_0014369
662 Ga0495652_0016186
663 Ga0495652_0224100
664 Ga0495652_0226904
665 Ga0495665_0040668
666 Ga0495665_0058983
667 Ga0495640_0040575
668 Ga0495586_0110817
669 Ga0495587_0017576
670 Ga0495587_0037187
671 Ga0495587_0336859
672 Ga0495645_0076534
673 Ga0495645_0107366
674 Ga0495667_0019717
675 Ga0495667_0069860
676 Ga0495667_0083502
677 Ga0495667_0084007
678 Ga0495634_0030350
679 Ga0495634_0032569
680 Ga0495634_0085736
681 Ga0495635_0028681
682 Ga0495635_0239803
683 Ga0495635_0334238
684 Ga0495635_0610856
685 Ga0495657_0004943
686 Ga0495657_0051604
687 Ga0495657_0057219
688 Ga0495657_0077352
689 Ga0495599_0094143
690 Ga0495623_0005618
691 Ga0495623_0128940
692 Ga0495646_0018237
693 Ga0495658_0028342
694 Ga0495613_0008136
695 Ga0495613_0008345
696 Ga0495613_0020584
697 Ga0495624_0100059
698 Ga0495624_0124079
699 Ga0495600_0058559
700 Ga0495600_0063421
701 Ga0495581_0005214
702 Ga0495581_0171225
703 Ga0495604_0003632
704 Ga0495604_0007588
705 Ga0495604_0020082
706 Ga0495674_0009266
707 Ga0495674_0224298
708 Ga0495674_0247736
709 Ga0495674_0363267
710 Ga0495676_0044367
711 Ga0495676_0109969
712 Ga0495680_0008481
713 Ga0495680_0040108
714 Ga0495680_0184783
715 Ga0495687_016418
716 Ga0495675_0009442
717 Ga0495675_0031356
718 Ga0495675_0101120
719 Ga0495675_0375897
720 Ga0495684_0053543
721 Ga0495684_0057335
722 Ga0495684_0065847
723 Ga0495684_0293123
724 Ga0495593_0010714
725 Ga0495593_0049136
726 Ga0495602_0007072
727 Ga0495602_0016197
728 Ga0495602_0353674
729 Ga0495602_0629880
730 Ga0495614_0006908
731 Ga0496100_0789852
732 Ga0496102_0065780
733 Ga0496102_0313924
734 Ga0496102_0372207
735 Ga0496103_0096226
736 Ga0496104_0005702
737 Ga0496105_0024554
738 Ga0496105_0148123
739 Ga0496105_0579645
740 Ga0496107_0062654
741 Ga0496108_0051892
742 Ga0496108_0583875
743 Ga0496109_0010800
744 Ga0496110_0028232
745 Ga0496112_0176320
746 Ga0496112_0273343
747 Ga0496112_0311554
748 Ga0496113_0076676
749 Ga0496114_0397368
750 Ga0496114_0633738
751 Ga0496115_0402725
752 Ga0496115_0554267
753 Ga0496116_0000133
754 Ga0496116_0097979
755 Ga0496117_0005646
756 Ga0496118_0000762
757 Ga0496119_0003356
758 Ga0496120_0095887
759 Ga0501042_0025592
760 nmdc:mga05p37_1476_c1
761 nmdc:mga05p37_28122_c1
762 nmdc:mga09592_65101_c1
763 nmdc:mga08y16_232647_c1
764 nmdc:mga08y16_27357_c1
765 nmdc:mga0n895_15165_c1
766 nmdc:mga0n895_3711_c1
767 nmdc:mga0n895_3719_c1
768 nmdc:mga0n895_429270_c1
769 nmdc:mga0n895_815147_c1
770 nmdc:mga0n895_972610_c1
771 nmdc:mga0rr50_18569_c1
772 nmdc:mga0rr50_35744_c1
773 nmdc:mga0rr50_6529_c1
774 nmdc:mga0a205_11994_c1
775 nmdc:mga0a205_206042_c1
776 nmdc:mga0a205_29170_c1
777 Ga0495601_0068239
778 Ga0495612_0022220
779 Ga0495595_0006512
780 Ga0495595_0025522
781 Ga0495619_0002063
782 Ga0500620_028715
783 Ga0466962_0008965
784 2616702447
785 2870784994
786 8002790810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

28

209

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7885 1 187
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7763 1 187
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7722 1 187
1vdr-assembly1.cif.gz_A dihydrofolate reductase 0.7715 3 189
1vdr-assembly1.cif.gz_A dihydrofolate reductase 0.7672 3 189
ID Description Score Start End Superfamily
af_Q23122_583_750_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.7814 169 190 3.30.980.10
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7715 3 189 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7691 1 187 3.40.430.10
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7672 3 189 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7612 3 186 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A538J2D1-F1-model_v4 Dihydrofolate reductase 0.9407 43 191 GO:0008703
GO:0009231
AF-A0A3S1EWK5-F1-model_v4 Dihydrofolate reductase 0.9381 42 192 GO:0008703
GO:0009231
AF-E3JD59-F1-model_v4 Bifunctional deaminase-reductase domain protein 0.933 1 190 GO:0008703
GO:0009231
AF-A0A3N5K9Y5-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9319 53 190 GO:0008703
GO:0009231
AF-A0A7K0DSD3-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.931 1 191 GO:0008703
GO:0009231

Map