F432615

General Info

Members Datasets Scaffolds Average Seq Length
393 306 786 410

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10107966|Ga0207689_101079661
Length 482
Sequence MSRVQLALNVDDLDAAIDFYSKLFSATPAKVRPGYANFAIAEPPLKLVLIENAGQGGSLNHLGVEVGSTDEVAAAQARLAGQGLPTATPEEVGLSSQKLARVTEAVKAEIAKGRYPGAVALVARRGKVAYFEAFGQRDPQSGAPMAKDAIFRLYSMTKPFTSVAAMMLVEDGRLLLSDPVSRHIPKLKDLQVSVPRLDPQTGKVVYTLVPAEREMTIQDLLRHTSGLVYGQNTSHLGVKEAYAKEGVDWNGVTAAEQIDRLARVPLVRHPGTAWEYSLSTDVLGRVVEAVSGMTLGQFFQERIFSPLKMTDTAFLVPNGKAARLAQPFAKDPVTGAEVKLLDVTQPQKNDAGGAGTAGTTMDYARFSQMLLNGGQLDRVRLLGRATVAQMSSDHVGDLPIASPVLARGYGFGLGFAVRKETGLNWVTGSAGEYRWGGAGGTAFWVDPKEHMVVVWMSQGQPGPRRGEDRDLFRQLVQAAIVD

Samples

Sample ID Description Type Environment
1 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
116 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
117 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
194 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
195 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
196 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
197 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
198 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
199 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
200 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
201 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
202 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
203 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
204 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
205 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
206 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
210 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
211 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
212 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
213 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
214 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
215 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
216 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
217 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
218 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
219 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
220 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
221 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
222 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
223 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
224 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
225 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
226 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
227 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
228 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
229 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
230 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
231 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
232 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
233 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
234 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
235 2922368715
236 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
237 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
238 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
239 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
240 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
241 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
242 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
243 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
244 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
245 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
246 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
247 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
248 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
249 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
250 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
251 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
252 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
253 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
254 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
255 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
256 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
257 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
258 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
259 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
260 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
261 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
262 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
263 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
264 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
265 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
266 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
267 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
268 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
269 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
270 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
271 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
272 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
273 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
274 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
275 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
276 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
277 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
278 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
279 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
280 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
281 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
282 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
283 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
284 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
285 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
286 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
287 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
288 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
289 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
290 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
291 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
292 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
293 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
294 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
295 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
296 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
297 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
298 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
299 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
300 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
301 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
302 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
303 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
304 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
305 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
306 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.51
Metatranscriptomes 0
Isolates 24.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.43
Nodule 21.12
Rhizoplane 2.54
Rhizosphere 60.56
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207689_10107966 3300025942 Bacteria 2287
2 JGI25406J46586_10009643 3300003203 Bacteria 4318
3 JGI25153J46596_10003434 3300003215 Bacteria 8874
4 JGI25160J50197_1001082 3300003354 Bacteria 13972
5 JGI25160J50197_1004295 3300003354 Bacteria 6179
6 Ga0065165_1005509 3300005262 Bacteria 7077
7 Ga0065165_1008489 3300005262 Bacteria 4789
8 Ga0065707_10146471 3300005295 Bacteria 1702
9 Ga0070676_10102892 3300005328 Bacteria 1767
10 Ga0068869_100000426 3300005334 Bacteria 23034
11 Ga0068869_100004925 3300005334 Bacteria 8353
12 Ga0070666_10036577 3300005335 Bacteria 3260
13 Ga0068868_100106006 3300005338 Bacteria 2280
14 Ga0070687_100018576 3300005343 Bacteria 3219
15 Ga0070692_10039258 3300005345 Archaea 2416
16 Ga0070669_100034304 3300005353 Bacteria 3673
17 Ga0070675_100118358 3300005354 Bacteria 2249
18 Ga0070675_100260156 3300005354 Bacteria 1521
19 Ga0070674_100042308 3300005356 Bacteria 3094
20 Ga0070667_100107631 3300005367 Bacteria 2414
21 Ga0070703_10010363 3300005406 Bacteria 2627
22 Ga0070711_100191521 3300005439 Bacteria 1572
23 Ga0070694_100019650 3300005444 Bacteria 4299
24 Ga0070694_100041076 3300005444 Bacteria 3084
25 Ga0070708_100029804 3300005445 Bacteria 4709
26 Ga0070663_100051256 3300005455 Bacteria 2939
27 Ga0070678_100027960 3300005456 Bacteria 3838
28 Ga0068867_100006118 3300005459 Bacteria 8518
29 Ga0070706_100008059 3300005467 Bacteria 9827
30 Ga0070706_100086072 3300005467 Bacteria 2912
31 Ga0070706_100272569 3300005467 Bacteria 1579
32 Ga0070707_100008551 3300005468 Bacteria 9514
33 Ga0070707_100027721 3300005468 Bacteria 5388
34 Ga0070698_100009629 3300005471 Bacteria 10335
35 Ga0070698_100112962 3300005471 Bacteria 2681
36 Ga0070699_100004893 3300005518 Bacteria 11807
37 Ga0070699_100026455 3300005518 Bacteria 5002
38 Ga0070699_100043990 3300005518 Bacteria 3865
39 Ga0070699_100072121 3300005518 Bacteria 3004
40 Ga0070697_100002217 3300005536 Bacteria 14910
41 Ga0070697_100002622 3300005536 Bacteria 13835
42 Ga0070697_100143543 3300005536 Bacteria 2008
43 Ga0070672_100022799 3300005543 Bacteria 4606
44 Ga0070686_100001314 3300005544 Bacteria 14051
45 Ga0070695_100005135 3300005545 Bacteria 7719
46 Ga0070696_100027835 3300005546 Bacteria 3855
47 Ga0070696_100048595 3300005546 Unclassified 2945
48 Ga0070696_100125594 3300005546 Bacteria 1861
49 Ga0070696_100160347 3300005546 Bacteria 1657
50 Ga0070665_100069431 3300005548 Bacteria 3531
51 Ga0070665_100136377 3300005548 Bacteria 2457
52 Ga0070665_100142428 3300005548 Bacteria 2400
53 Ga0070665_100143535 3300005548 Bacteria 2390
54 Ga0070704_100055168 3300005549 Bacteria 2816
55 Ga0070704_100176471 3300005549 Bacteria 1705
56 Ga0070702_100000187 3300005615 Bacteria 20119
57 Ga0068852_100026370 3300005616 Bacteria 4722
58 Ga0068859_100010048 3300005617 Bacteria 9544
59 Ga0068859_100034479 3300005617 Bacteria 5079
60 Ga0068864_100025779 3300005618 Bacteria 4956
61 Ga0068866_10000691 3300005718 Bacteria 15315
62 Ga0068861_100012611 3300005719 Bacteria 5897
63 Ga0068863_100057137 3300005841 Bacteria 3693
64 Ga0068858_100004697 3300005842 Bacteria 13390
65 Ga0068858_100062763 3300005842 Bacteria 3436
66 Ga0068860_100028772 3300005843 Bacteria 5348
67 Ga0068862_100011537 3300005844 Bacteria 7291
68 Ga0068862_100105960 3300005844 Bacteria 2464
69 Ga0068862_100271069 3300005844 Bacteria 1552
70 Ga0081455_10002963 3300005937 Bacteria 19856
71 Ga0081538_10041167 3300005981 Bacteria 2935
72 Ga0081539_10000396 3300005985 Bacteria 93686
73 Ga0075365_10007267 3300006038 Bacteria 6192
74 Ga0075368_10003110 3300006042 Bacteria 5507
75 Ga0075364_10028704 3300006051 Bacteria 3563
76 Ga0075364_10078724 3300006051 Bacteria 2177
77 Ga0070712_100006694 3300006175 Bacteria 7165
78 Ga0075362_10014981 3300006177 Bacteria 3144
79 Ga0075367_10093447 3300006178 Bacteria 1832
80 Ga0097621_100010678 3300006237 Bacteria 6729
81 Ga0068871_100049066 3300006358 Bacteria 3410
82 Ga0075430_100139565 3300006846 Bacteria 2018
83 Ga0075431_100029900 3300006847 Bacteria 5609
84 Ga0075433_10006119 3300006852 Bacteria 9479
85 Ga0075433_10018295 3300006852 Bacteria 5821
86 Ga0075434_100032499 3300006871 Bacteria 5145
87 Ga0075434_100246473 3300006871 Unclassified 1806
88 Ga0075434_100294344 3300006871 Bacteria 1643
89 Ga0075429_100019877 3300006880 Bacteria 5823
90 Ga0075429_100122663 3300006880 Bacteria 2271
91 Ga0068865_100000481 3300006881 Bacteria 22330
92 Ga0075436_100012448 3300006914 Bacteria 5831
93 Ga0075436_100020661 3300006914 Bacteria 4518
94 Ga0097620_100010048 3300006931 Bacteria 9544
95 Ga0097620_100034479 3300006931 Bacteria 5079
96 Ga0075435_100019844 3300007076 Bacteria 5142
97 Ga0075435_100034138 3300007076 Bacteria 4028
98 Ga0075435_100040795 3300007076 Bacteria 3708
99 Ga0075435_100092432 3300007076 Bacteria 2498
100 Ga0099794_10010183 3300007265 Bacteria 3983
101 Ga0099794_10053277 3300007265 Bacteria 1950
102 Ga0105240_10015981 3300009093 Bacteria 10174
103 Ga0111539_10008154 3300009094 Bacteria 13342
104 Ga0105245_10000569 3300009098 Bacteria 33604
105 Ga0105245_10227673 3300009098 Bacteria 1802
106 Ga0105247_10014990 3300009101 Bacteria 4648
107 Ga0105247_10052421 3300009101 Bacteria 2515
108 Ga0114129_10006712 3300009147 Bacteria 16339
109 Ga0114129_10073520 3300009147 Bacteria 4763
110 Ga0114129_10141296 3300009147 Bacteria 3300
111 Ga0114129_10247863 3300009147 Bacteria 2392
112 Ga0114129_10269446 3300009147 Bacteria 2279
113 Ga0105243_10241458 3300009148 Bacteria 1608
114 Ga0105242_10111913 3300009176 Bacteria 2329
115 Ga0105248_10013164 3300009177 Bacteria 9108
116 Ga0105248_10115722 3300009177 Bacteria 3024
117 Ga0105248_10167567 3300009177 Bacteria 2476
118 Ga0105237_10045106 3300009545 Bacteria 4438
119 Ga0105249_10026575 3300009553 Bacteria 5218
120 Ga0105239_10049639 3300010375 Bacteria 4601
121 Ga0105239_10050430 3300010375 Bacteria 4565
122 Ga0157374_10047919 3300013296 Bacteria 3963
123 Ga0157378_10124967 3300013297 Bacteria 2375
124 Ga0163162_10022565 3300013306 Bacteria 6204
125 Ga0163162_10205160 3300013306 Bacteria 2100
126 Ga0157375_10023079 3300013308 Bacteria 5735
127 Ga0163163_10138702 3300014325 Bacteria 2473
128 Ga0157380_10019063 3300014326 Bacteria 5107
129 Ga0157380_10340279 3300014326 Bacteria 1399
130 Ga0157376_10006466 3300014969 Bacteria 8280
131 Ga0209148_1000448 3300025254 Bacteria 45242
132 Ga0209233_1002466 3300025261 Bacteria 6792
133 Ga0209233_1003423 3300025261 Bacteria 5591
134 Ga0209233_1022951 3300025261 Bacteria 1589
135 Ga0209455_1000921 3300025272 Bacteria 15187
136 Ga0209564_1005472 3300025295 Bacteria 7237
137 Ga0209758_1004815 3300025297 Bacteria 10897
138 Ga0209256_1015400 3300025299 Bacteria 2677
139 Ga0207426_1000772 3300025302 Bacteria 35283
140 Ga0207426_1006849 3300025302 Bacteria 4872
141 Ga0207684_10000783 3300025910 Bacteria 36910
142 Ga0207684_10010622 3300025910 Bacteria 8092
143 Ga0207684_10021922 3300025910 Bacteria 5455
144 Ga0207684_10032661 3300025910 Bacteria 4426
145 Ga0207684_10121525 3300025910 Bacteria 2239
146 Ga0207654_10088797 3300025911 Bacteria 1879
147 Ga0207695_10000159 3300025913 Bacteria 201367
148 Ga0207671_10022191 3300025914 Bacteria 4803
149 Ga0207663_10100701 3300025916 Bacteria 1940
150 Ga0207662_10050124 3300025918 Bacteria 2479
151 Ga0207646_10006316 3300025922 Bacteria 12284
152 Ga0207646_10016851 3300025922 Bacteria 6853
153 Ga0207646_10029172 3300025922 Bacteria 5016
154 Ga0207646_10033747 3300025922 Bacteria 4627
155 Ga0207681_10045280 3300025923 Bacteria 2953
156 Ga0207687_10224282 3300025927 Unclassified 1481
157 Ga0207686_10003239 3300025934 Bacteria 8755
158 Ga0207709_10003768 3300025935 Bacteria 8908
159 Ga0207709_10121678 3300025935 Bacteria 1763
160 Ga0207670_10131411 3300025936 Bacteria 1835
161 Ga0207669_10080318 3300025937 Bacteria 2085
162 Ga0207704_10089332 3300025938 Bacteria 2019
163 Ga0207665_10001009 3300025939 Bacteria 19006
164 Ga0207691_10010363 3300025940 Bacteria 8940
165 Ga0207711_10026819 3300025941 Bacteria 4836
166 Ga0207711_10079148 3300025941 Bacteria 2868
167 Ga0207689_10000173 3300025942 Bacteria 56390
168 Ga0207689_10003107 3300025942 Bacteria 15253
169 Ga0207712_10069082 3300025961 Bacteria 2534
170 Ga0207703_10008061 3300026035 Bacteria 8325
171 Ga0207703_10019794 3300026035 Bacteria 5261
172 Ga0207708_10000350 3300026075 Bacteria 36165
173 Ga0207641_10101604 3300026088 Bacteria 2534
174 Ga0207648_10000730 3300026089 Bacteria 36815
175 Ga0207648_10157559 3300026089 Archaea 2004
176 Ga0207675_100000407 3300026118 Bacteria 41288
177 Ga0207675_100026845 3300026118 Bacteria 5359
178 Ga0207683_10308560 3300026121 Unclassified 1448
179 Ga0209489_120344 3300027361 Bacteria 1936
180 Ga0209700_100031 3300027363 Bacteria 207349
181 Ga0209995_1001377 3300027471 Bacteria 3746
182 Ga0209999_1001639 3300027543 Bacteria 3863
183 Ga0209970_1006249 3300027614 Bacteria 1951
184 Ga0209983_1007921 3300027665 Bacteria 2174
185 Ga0209971_1002077 3300027682 Bacteria 4879
186 Ga0209998_10001077 3300027717 Bacteria 6818
187 Ga0209974_10020144 3300027876 Bacteria 2211
188 Ga0207428_10006656 3300027907 Bacteria 10611
189 Ga0207428_10023506 3300027907 Bacteria 5184
190 Ga0268266_10134096 3300028379 Bacteria 2217
191 Ga0268265_10018021 3300028380 Bacteria 4887
192 Ga0268265_10092045 3300028380 Bacteria 2426
193 Ga0268264_10030566 3300028381 Bacteria 4415
194 Ga0268264_10124114 3300028381 Bacteria 2279
195 Ga0307508_10201328 3300031616 Bacteria 1592
196 Ga0395899_0075554 3300037312 Bacteria 2460
197 Ga0395900_0015621 3300037418 Bacteria 7739
198 Ga0395898_0024127 3300037466 Bacteria 6137
199 Ga0395898_0139236 3300037466 Bacteria 2323
200 Ga0395905_0175681 3300037471 Bacteria 2011
201 Ga0395905_0235988 3300037471 Bacteria 1709
202 Ga0395901_0019927 3300038443 Bacteria 6862
203 Ga0451577_0021360 3300042876 Bacteria 5925
204 Ga0453683_0011475 3300044673 Bacteria 5837
205 Ga0453683_0028592 3300044673 Bacteria 3528
206 Ga0466967_0214536 3300045976 Bacteria 1826
207 Ga0495603_0050181 3300046455 Bacteria 2482
208 Ga0495603_0068677 3300046455 Bacteria 2085
209 Ga0495580_0196149 3300046472 Bacteria 1392
210 Ga0495610_0044745 3300046512 Bacteria 2195
211 Ga0495652_0069203 3300046529 Bacteria 2955
212 Ga0495652_0262729 3300046529 Bacteria 1273
213 Ga0495625_0034775 3300046660 Bacteria 3717
214 Ga0495635_0017900 3300046663 Bacteria 4948
215 Ga0495669_0003037 3300046684 Bacteria 6900
216 Ga0495600_0027180 3300046809 Bacteria 3697
217 Ga0495604_0013945 3300047317 Bacteria 6411
218 Ga0495672_0069869 3300047320 Bacteria 1992
219 Ga0495687_058642 3300047443 Bacteria 1596
220 Ga0495686_0056010 3300047472 Bacteria 2464
221 Ga0495593_0039765 3300047673 Bacteria 2534
222 Ga0496102_0251015 3300048905 Bacteria 1668
223 Ga0496104_0001502 3300048907 Bacteria 20115
224 Ga0496104_0005705 3300048907 Bacteria 10892
225 Ga0496105_0013086 3300048908 Bacteria 6578
226 Ga0496105_0127955 3300048908 Bacteria 2094
227 Ga0496108_0021850 3300048911 Bacteria 5260
228 Ga0496109_0063540 3300048912 Bacteria 3377
229 Ga0496110_0225718 3300048913 Bacteria 1703
230 Ga0496112_0288272 3300048915 Bacteria 1588
231 Ga0496115_0004492 3300048918 Bacteria 10095
232 Ga0496119_0003888 3300048922 Bacteria 15205
233 Ga0496121_0038417 3300048924 Bacteria 4240
234 Ga0496124_0235315 3300048927 Bacteria 1366
235 Ga0496124_0247131 3300048927 Bacteria 1322
236 Ga0496126_0125374 3300048929 Bacteria 2223
237 Ga0495682_0019129 3300049460 Bacteria 2577
238 Ga0501034_0002205 3300049571 Bacteria 24104
239 Ga0501034_0110121 3300049571 Bacteria 2745
240 Ga0501034_0166045 3300049571 Bacteria 2176
241 Ga0501036_0028295 3300049572 Bacteria 4737
242 Ga0501038_0023967 3300049574 Bacteria 5450
243 Ga0501039_0164598 3300049575 Bacteria 1744
244 Ga0501040_0001069 3300049576 Bacteria 17320
245 Ga0501042_0005134 3300049578 Bacteria 8403
246 Ga0501046_0000381 3300049580 Bacteria 44344
247 Ga0501070_0086174 3300049586 Bacteria 2600
248 Ga0501073_0000752 3300049589 Bacteria 22939
249 Ga0501074_0007045 3300049590 Bacteria 8121
250 Ga0501076_0027857 3300049592 Bacteria 4382
251 Ga0501077_0022225 3300049593 Bacteria 4018
252 Ga0501079_0011590 3300049741 Bacteria 6731
253 Ga0501080_0000996 3300049742 Bacteria 23234
254 Ga0501081_0008381 3300049743 Bacteria 6710
255 Ga0501083_0038195 3300049744 Bacteria 3265
256 Ga0501083_0084453 3300049744 Bacteria 2102
257 Ga0501045_0005894 3300049824 Bacteria 8477
258 nmdc:mga03683_5610_c1 3300050489 Bacteria 3271
259 nmdc:mga00v17_3339_c1 3300050491 Bacteria 8282
260 nmdc:mga0yw44_4704_c1 3300050492 Bacteria 6023
261 nmdc:mga0k408_41074_c1 3300050493 Bacteria 2662
262 nmdc:mga06z11_60112_c1 3300050494 Bacteria 1977
263 nmdc:mga05p37_104606_c1 3300050507 Bacteria 3483
264 nmdc:mga05p37_313157_c1 3300050507 Bacteria 1860
265 nmdc:mga05p37_56350_c1 3300050507 Bacteria 4839
266 nmdc:mga05p37_93905_c1 3300050507 Bacteria 3696
267 nmdc:mga09592_10118_c1 3300050508 Bacteria 7672
268 nmdc:mga09592_63639_c1 3300050508 Bacteria 3122
269 nmdc:mga06r32_7039_c1 3300050510 Bacteria 10118
270 nmdc:mga0n895_3040_c1 3300050512 Bacteria 13351
271 nmdc:mga0n895_30710_c1 3300050512 Bacteria 5137
272 nmdc:mga0rr50_33846_c1 3300050513 Bacteria 3654
273 nmdc:mga0rr50_4618_c1 3300050513 Bacteria 8114
274 nmdc:mga0rr50_80034_c1 3300050513 Bacteria 2518
275 nmdc:mga08x19_15263_c1 3300050514 Bacteria 4672
276 nmdc:mga08x19_4018_c1 3300050514 Bacteria 8754
277 nmdc:mga0a205_14562_c1 3300050515 Bacteria 7339
278 Ga0495619_0135648 3300053085 Bacteria 1693
279 Ga0500643_000335 3300053087 Bacteria 37421
280 Ga0500555_003379 3300053103 Bacteria 4551
281 Ga0500557_000010 3300053105 Bacteria 118251
282 Ga0500569_009810 3300053109 Bacteria 2235
283 Ga0500607_033293 3300053121 Bacteria 2825
284 Ga0500608_037870 3300053122 Bacteria 2305
285 Ga0500642_0000206 3300053130 Bacteria 24090
286 Ga0500642_0018072 3300053130 Bacteria 2718
287 Ga0500559_0026314 3300053136 Bacteria 2477
288 Ga0500568_0054137 3300053139 Bacteria 1570
289 Ga0500590_130743 3300053148 Bacteria 1161
290 Ga0500634_0070874 3300053161 Bacteria 1824
291 Ga0500638_057732 3300053162 Bacteria 1869
292 Ga0500609_002425 3300053731 Bacteria 2658
293 Ga0500601_001446 3300053737 Bacteria 2607
294 Ga0501084_0000763 3300054114 Bacteria 24548
295 Ga0501082_0021193 3300060353 Bacteria 5606
296 Ga0530510_0013644 3300061734 Bacteria 5717
297 2508543835 2508501009 Bacteria 7784016
298 2508698371 2508501042 Bacteria 8719808
299 2511397001 2511231028 Bacteria 8046582
300 2513644566 2513237094 Bacteria 8789602
301 2513658360 2513237096 Bacteria 8722461
302 2513875906 2513237139 Bacteria 8737671
303 2513920148 2513237145 Bacteria 8979722
304 2514011430 2513237161 Bacteria 8871253
305 2528856303 2528768022 Bacteria 10457665
306 2793060200 2791355196 Bacteria 7323613
307 2805917564 2802429603 Bacteria 8777136
308 2824654913 2824653114 Bacteria 8493680
309 2824672530 2824671348 Bacteria 8369588
310 2824689137 2824687955 Bacteria 8360029
311 2824697476 2824696289 Bacteria 8335049
312 2844317973 2844315083 Bacteria 8138177
313 2847934809 2847930680 Bacteria 9342022
314 2847945346 2847939898 Bacteria 8606328
315 2874615702 2874612657 Bacteria 8252029
316 2874632665 2874628541 Bacteria 8630250
317 2879109268 2879099564 Bacteria 10442239
318 2888423249 2888419890 Bacteria 7857137
319 2903729717 2903727486 Bacteria 8281579
320 2906605866 2906602504 Bacteria 8295279
321 2906644176 2906643746 Bacteria 8722424
322 2922375246
323 2929615934 2929615660 Bacteria 9193770
324 2929630547 2929624759 Bacteria 9339455
325 2932792428 2932784394 Bacteria 9704911
326 2932800426 2932794094 Bacteria 7915132
327 2932804600 2932801729 Bacteria 7987968
328 2932813927 2932809354 Bacteria 9135765
329 2932819561 2932818245 Bacteria 9955613
330 2932833733 2932828146 Bacteria 9745859
331 2933578780 2933577622 Bacteria 9116884
332 2935618763 2935616580 Bacteria 9032984
333 2935644372 2935638405 Bacteria 10015038
334 2935648702 2935648319 Bacteria 8801166
335 2935657310 2935656913 Bacteria 8965014
336 2935674111 2935665750 Bacteria 9571747
337 2935678583 2935675223 Bacteria 9928132
338 2935687920 2935684952 Bacteria 9590419
339 2935701468 2935694250 Bacteria 9291695
340 2935708254 2935703347 Bacteria 10242284
341 2935714940 2935713505 Bacteria 9608509
342 2935726495 2935722832 Bacteria 9608746
343 2935733758 2935732158 Bacteria 9706831
344 2935743137 2935741537 Bacteria 9707219
345 2935754824 2935750917 Bacteria 9590372
346 2935765532 2935760218 Bacteria 9817913
347 2935775303 2935769743 Bacteria 7878163
348 2935779494 2935777560 Bacteria 8077691
349 2935791499 2935785616 Bacteria 7962367
350 2935799811 2935793552 Bacteria 8012592
351 2935805512 2935801545 Bacteria 9301974
352 2935816804 2935810662 Bacteria 9401221
353 2935833879 2935827899 Bacteria 10038562
354 2935839461 2935837841 Bacteria 9454360
355 2935857128 2935855204 Bacteria 9035059
356 2935864672 2935864058 Bacteria 9784707
357 2935876450 2935873716 Bacteria 9632195
358 2935889793 2935883170 Bacteria 7964738
359 2935966980 2935959822 Bacteria 7869783
360 2935989769 2935984226 Bacteria 8302647
361 2935997581 2935992306 Bacteria 9802711
362 2936007099 2936002035 Bacteria 9362176
363 2936011612 2936011229 Bacteria 8801034
364 2936020207 2936019824 Bacteria 8804134
365 2936028803 2936028420 Bacteria 8965941
366 2936042934 2936037263 Bacteria 9446081
367 2936046930 2936046547 Bacteria 8903709
368 2936058186 2936055302 Bacteria 8785755
369 2940559799 2940556831 Bacteria 9590747
370 2941536134 2941531003 Bacteria 7653939
371 2941540150 2941538514 Bacteria 9402094
372 3005598047 3005594810 Bacteria 8716512
373 3005713726 3005710791 Bacteria 7622528
374 3005721237 3005718088 Bacteria 8283608
375 8006930035 8006926726 Bacteria 6749210
376 8016514708 8016511872 Bacteria 9921665
377 8016530825 8016522445 Bacteria 8156687
378 8016591220 8016583857 Bacteria 10421953
379 8016621823 8016613128 Bacteria 8794220
380 8016628025 8016622563 Bacteria 7999408
381 8016632354 8016630954 Bacteria 9217207
382 8017061730 8017057580 Bacteria 10023680
383 8019543636 8019538911 Bacteria 7872763
384 8019555140 8019547302 Bacteria 7996444
385 8019581201 8019576017 Bacteria 10049540
386 8019588855 8019586578 Bacteria 10212056
387 8019602404 8019597564 Bacteria 10041141
388 8019643971 8019638758 Bacteria 9062356
389 8019656972 8019648815 Bacteria 10014479
390 8019663511 8019659431 Bacteria 8577854
391 8019683016 8019678201 Bacteria 8863603
392 8055747581 8055742211 Bacteria 9226248
393 8056972306 8056967851 Bacteria 9038162
394 Ga0207689_10107966
395 JGI25406J46586_10009643
396 JGI25153J46596_10003434
397 JGI25160J50197_1001082
398 JGI25160J50197_1004295
399 Ga0065165_1005509
400 Ga0065165_1008489
401 Ga0065707_10146471
402 Ga0070676_10102892
403 Ga0068869_100000426
404 Ga0068869_100004925
405 Ga0070666_10036577
406 Ga0068868_100106006
407 Ga0070687_100018576
408 Ga0070692_10039258
409 Ga0070669_100034304
410 Ga0070675_100118358
411 Ga0070675_100260156
412 Ga0070674_100042308
413 Ga0070667_100107631
414 Ga0070703_10010363
415 Ga0070711_100191521
416 Ga0070694_100019650
417 Ga0070694_100041076
418 Ga0070708_100029804
419 Ga0070663_100051256
420 Ga0070678_100027960
421 Ga0068867_100006118
422 Ga0070706_100008059
423 Ga0070706_100086072
424 Ga0070706_100272569
425 Ga0070707_100008551
426 Ga0070707_100027721
427 Ga0070698_100009629
428 Ga0070698_100112962
429 Ga0070699_100004893
430 Ga0070699_100026455
431 Ga0070699_100043990
432 Ga0070699_100072121
433 Ga0070697_100002217
434 Ga0070697_100002622
435 Ga0070697_100143543
436 Ga0070672_100022799
437 Ga0070686_100001314
438 Ga0070695_100005135
439 Ga0070696_100027835
440 Ga0070696_100048595
441 Ga0070696_100125594
442 Ga0070696_100160347
443 Ga0070665_100069431
444 Ga0070665_100136377
445 Ga0070665_100142428
446 Ga0070665_100143535
447 Ga0070704_100055168
448 Ga0070704_100176471
449 Ga0070702_100000187
450 Ga0068852_100026370
451 Ga0068859_100010048
452 Ga0068859_100034479
453 Ga0068864_100025779
454 Ga0068866_10000691
455 Ga0068861_100012611
456 Ga0068863_100057137
457 Ga0068858_100004697
458 Ga0068858_100062763
459 Ga0068860_100028772
460 Ga0068862_100011537
461 Ga0068862_100105960
462 Ga0068862_100271069
463 Ga0081455_10002963
464 Ga0081538_10041167
465 Ga0081539_10000396
466 Ga0075365_10007267
467 Ga0075368_10003110
468 Ga0075364_10028704
469 Ga0075364_10078724
470 Ga0070712_100006694
471 Ga0075362_10014981
472 Ga0075367_10093447
473 Ga0097621_100010678
474 Ga0068871_100049066
475 Ga0075430_100139565
476 Ga0075431_100029900
477 Ga0075433_10006119
478 Ga0075433_10018295
479 Ga0075434_100032499
480 Ga0075434_100246473
481 Ga0075434_100294344
482 Ga0075429_100019877
483 Ga0075429_100122663
484 Ga0068865_100000481
485 Ga0075436_100012448
486 Ga0075436_100020661
487 Ga0097620_100010048
488 Ga0097620_100034479
489 Ga0075435_100019844
490 Ga0075435_100034138
491 Ga0075435_100040795
492 Ga0075435_100092432
493 Ga0099794_10010183
494 Ga0099794_10053277
495 Ga0105240_10015981
496 Ga0111539_10008154
497 Ga0105245_10000569
498 Ga0105245_10227673
499 Ga0105247_10014990
500 Ga0105247_10052421
501 Ga0114129_10006712
502 Ga0114129_10073520
503 Ga0114129_10141296
504 Ga0114129_10247863
505 Ga0114129_10269446
506 Ga0105243_10241458
507 Ga0105242_10111913
508 Ga0105248_10013164
509 Ga0105248_10115722
510 Ga0105248_10167567
511 Ga0105237_10045106
512 Ga0105249_10026575
513 Ga0105239_10049639
514 Ga0105239_10050430
515 Ga0157374_10047919
516 Ga0157378_10124967
517 Ga0163162_10022565
518 Ga0163162_10205160
519 Ga0157375_10023079
520 Ga0163163_10138702
521 Ga0157380_10019063
522 Ga0157380_10340279
523 Ga0157376_10006466
524 Ga0209148_1000448
525 Ga0209233_1002466
526 Ga0209233_1003423
527 Ga0209233_1022951
528 Ga0209455_1000921
529 Ga0209564_1005472
530 Ga0209758_1004815
531 Ga0209256_1015400
532 Ga0207426_1000772
533 Ga0207426_1006849
534 Ga0207684_10000783
535 Ga0207684_10010622
536 Ga0207684_10021922
537 Ga0207684_10032661
538 Ga0207684_10121525
539 Ga0207654_10088797
540 Ga0207695_10000159
541 Ga0207671_10022191
542 Ga0207663_10100701
543 Ga0207662_10050124
544 Ga0207646_10006316
545 Ga0207646_10016851
546 Ga0207646_10029172
547 Ga0207646_10033747
548 Ga0207681_10045280
549 Ga0207687_10224282
550 Ga0207686_10003239
551 Ga0207709_10003768
552 Ga0207709_10121678
553 Ga0207670_10131411
554 Ga0207669_10080318
555 Ga0207704_10089332
556 Ga0207665_10001009
557 Ga0207691_10010363
558 Ga0207711_10026819
559 Ga0207711_10079148
560 Ga0207689_10000173
561 Ga0207689_10003107
562 Ga0207712_10069082
563 Ga0207703_10008061
564 Ga0207703_10019794
565 Ga0207708_10000350
566 Ga0207641_10101604
567 Ga0207648_10000730
568 Ga0207648_10157559
569 Ga0207675_100000407
570 Ga0207675_100026845
571 Ga0207683_10308560
572 Ga0209489_120344
573 Ga0209700_100031
574 Ga0209995_1001377
575 Ga0209999_1001639
576 Ga0209970_1006249
577 Ga0209983_1007921
578 Ga0209971_1002077
579 Ga0209998_10001077
580 Ga0209974_10020144
581 Ga0207428_10006656
582 Ga0207428_10023506
583 Ga0268266_10134096
584 Ga0268265_10018021
585 Ga0268265_10092045
586 Ga0268264_10030566
587 Ga0268264_10124114
588 Ga0307508_10201328
589 Ga0395899_0075554
590 Ga0395900_0015621
591 Ga0395898_0024127
592 Ga0395898_0139236
593 Ga0395905_0175681
594 Ga0395905_0235988
595 Ga0395901_0019927
596 Ga0451577_0021360
597 Ga0453683_0011475
598 Ga0453683_0028592
599 Ga0466967_0214536
600 Ga0495603_0050181
601 Ga0495603_0068677
602 Ga0495580_0196149
603 Ga0495610_0044745
604 Ga0495652_0069203
605 Ga0495652_0262729
606 Ga0495625_0034775
607 Ga0495635_0017900
608 Ga0495669_0003037
609 Ga0495600_0027180
610 Ga0495604_0013945
611 Ga0495672_0069869
612 Ga0495687_058642
613 Ga0495686_0056010
614 Ga0495593_0039765
615 Ga0496102_0251015
616 Ga0496104_0001502
617 Ga0496104_0005705
618 Ga0496105_0013086
619 Ga0496105_0127955
620 Ga0496108_0021850
621 Ga0496109_0063540
622 Ga0496110_0225718
623 Ga0496112_0288272
624 Ga0496115_0004492
625 Ga0496119_0003888
626 Ga0496121_0038417
627 Ga0496124_0235315
628 Ga0496124_0247131
629 Ga0496126_0125374
630 Ga0495682_0019129
631 Ga0501034_0002205
632 Ga0501034_0110121
633 Ga0501034_0166045
634 Ga0501036_0028295
635 Ga0501038_0023967
636 Ga0501039_0164598
637 Ga0501040_0001069
638 Ga0501042_0005134
639 Ga0501046_0000381
640 Ga0501070_0086174
641 Ga0501073_0000752
642 Ga0501074_0007045
643 Ga0501076_0027857
644 Ga0501077_0022225
645 Ga0501079_0011590
646 Ga0501080_0000996
647 Ga0501081_0008381
648 Ga0501083_0038195
649 Ga0501083_0084453
650 Ga0501045_0005894
651 nmdc:mga03683_5610_c1
652 nmdc:mga00v17_3339_c1
653 nmdc:mga0yw44_4704_c1
654 nmdc:mga0k408_41074_c1
655 nmdc:mga06z11_60112_c1
656 nmdc:mga05p37_104606_c1
657 nmdc:mga05p37_313157_c1
658 nmdc:mga05p37_56350_c1
659 nmdc:mga05p37_93905_c1
660 nmdc:mga09592_10118_c1
661 nmdc:mga09592_63639_c1
662 nmdc:mga06r32_7039_c1
663 nmdc:mga0n895_3040_c1
664 nmdc:mga0n895_30710_c1
665 nmdc:mga0rr50_33846_c1
666 nmdc:mga0rr50_4618_c1
667 nmdc:mga0rr50_80034_c1
668 nmdc:mga08x19_15263_c1
669 nmdc:mga08x19_4018_c1
670 nmdc:mga0a205_14562_c1
671 Ga0495619_0135648
672 Ga0500643_000335
673 Ga0500555_003379
674 Ga0500557_000010
675 Ga0500569_009810
676 Ga0500607_033293
677 Ga0500608_037870
678 Ga0500642_0000206
679 Ga0500642_0018072
680 Ga0500559_0026314
681 Ga0500568_0054137
682 Ga0500590_130743
683 Ga0500634_0070874
684 Ga0500638_057732
685 Ga0500609_002425
686 Ga0500601_001446
687 Ga0501084_0000763
688 Ga0501082_0021193
689 Ga0530510_0013644
690 2508543835
691 2508698371
692 2511397001
693 2513644566
694 2513658360
695 2513875906
696 2513920148
697 2514011430
698 2528856303
699 2793060200
700 2805917564
701 2824654913
702 2824672530
703 2824689137
704 2824697476
705 2844317973
706 2847934809
707 2847945346
708 2874615702
709 2874632665
710 2879109268
711 2888423249
712 2903729717
713 2906605866
714 2906644176
715 2922375246
716 2929615934
717 2929630547
718 2932792428
719 2932800426
720 2932804600
721 2932813927
722 2932819561
723 2932833733
724 2933578780
725 2935618763
726 2935644372
727 2935648702
728 2935657310
729 2935674111
730 2935678583
731 2935687920
732 2935701468
733 2935708254
734 2935714940
735 2935726495
736 2935733758
737 2935743137
738 2935754824
739 2935765532
740 2935775303
741 2935779494
742 2935791499
743 2935799811
744 2935805512
745 2935816804
746 2935833879
747 2935839461
748 2935857128
749 2935864672
750 2935876450
751 2935889793
752 2935966980
753 2935989769
754 2935997581
755 2936007099
756 2936011612
757 2936020207
758 2936028803
759 2936042934
760 2936046930
761 2936058186
762 2940559799
763 2941536134
764 2941540150
765 3005598047
766 3005713726
767 3005721237
768 8006930035
769 8016514708
770 8016530825
771 8016591220
772 8016621823
773 8016628025
774 8016632354
775 8017061730
776 8019543636
777 8019555140
778 8019581201
779 8019588855
780 8019602404
781 8019643971
782 8019656972
783 8019663511
784 8019683016
785 8055747581
786 8056972306

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

3

102

0.94

PF00144

Beta-lactamase

Beta-lactamase

102

478

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ivi-assembly1.cif.gz_A crystal structure of a family viii carboxylesterase. 0.9319 22 420
4ivi-assembly1.cif.gz_A crystal structure of a family viii carboxylesterase. 0.9185 22 420
7pp8-assembly1.cif.gz_A structure of ester-hydrolase eh7 from metagenome of marine sediments at milazzo harbor (sicily, italy) complexed with a derivative of methyl 4-nitrophenyl hexylphosphonate 0.9162 31 420
7uda-assembly1.cif.gz_A structure of the estg 0.9125 22 418
7u1b-assembly1.cif.gz_A crystal structure of estg in complex with tantalum cluster 0.9085 22 420
ID Description Score Start End Superfamily
4ivkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9298 21 420 3.40.710.10
4ivkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9186 21 420 3.40.710.10
af_P9WLZ3_5_376_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8823 44 405 3.40.710.10
af_P9WLZ3_5_376_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8577 44 405 3.40.710.10
af_A0A1D8PKX8_25_403_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8386 54 413 3.40.710.10
ID Description Score Start End GO Terms
AF-G8N7M8-F1-model_v4 deleted 0.9657 32 418
AF-B2AJE0-F1-model_v4 Beta-lactamase 0.9571 25 255
AF-A0A4Q3NVJ2-F1-model_v4 deleted 0.9468 260 417
AF-A0A5S9ITB1-F1-model_v4 Serine hydrolase 0.9364 32 420 GO:0016787
AF-A0A6B0W310-F1-model_v4 deleted 0.9348 23 420

Map