F432586

General Info

Members Datasets Scaffolds Average Seq Length
393 230 393 157

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10150444|Ga0105238_101504442
Length 190
Sequence MMSVAFRRESDEEHKEPKFELPLPPGPNLVTPRGLALIEAKVVELEAFIAAHADDPEIEAARRELRYWLTRQATAQPAPPPEPGVVAFGTHVTFLLNGRERRIDIVGDDEADPANDRLAFSAPLSQALMGGEAGDLIDFNGKAEAIEIVAIEAIWDRASGGLTRSLVSYNDTAPTARRANIRTELRYKHD

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
155 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
156 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
157 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
193 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
194 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
195 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
199 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
200 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
201 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
202 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
203 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
204 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
205 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
206 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
207 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
208 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
211 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
212 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
213 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
214 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
217 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
218 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
219 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
220 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
221 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
222 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
223 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
224 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
225 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
226 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
229 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
230 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.92
Nodule 0
Rhizoplane 3.31
Rhizosphere 80.66
Stem 0
Stem Tuber 0
Unclassified 6.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_815195 2162886006 Bacteria 1762
2 SwRhRL2b_contig_1925373 2162886007 Bacteria 1253
3 JGI24736J21556_1000093 3300001904 Bacteria 14675
4 JGI24752J21851_1000078 3300001976 Bacteria 13010
5 JGI24752J21851_1000881 3300001976 Bacteria 4075
6 JGI24740J21852_10020722 3300001979 Bacteria 2288
7 JGI24737J22298_10018222 3300001990 Bacteria 2255
8 JGI24735J21928_10118046 3300002067 Bacteria 763
9 JGI24750J21931_1000140 3300002070 Bacteria 11710
10 JGI24748J21848_1000072 3300002074 Bacteria 34695
11 JGI24738J21930_10028132 3300002075 Bacteria 1151
12 JGI24749J21850_1001996 3300002076 Bacteria 2885
13 JGI24034J26672_10000028 3300002239 Bacteria 105058
14 JGI25150J39212_1000416 3300002774 Bacteria 19628
15 JGI25151J46595_10066892 3300003187 Bacteria 1110
16 JGI25153J46596_10000153 3300003215 Bacteria 69588
17 Ga0055526_1004471 3300003771 Bacteria 8384
18 Ga0055530_10000510 3300003791 Bacteria 33802
19 Ga0055530_10027811 3300003791 Bacteria 1538
20 Ga0055531_10000319 3300003794 Bacteria 47189
21 Ga0055531_10035977 3300003794 Bacteria 1538
22 Ga0065165_1035817 3300005262 Bacteria 1520
23 Ga0065704_10074105 3300005289 Bacteria 6527
24 Ga0065707_10082480 3300005295 Bacteria 14624
25 Ga0065707_10107754 3300005295 Bacteria 2540
26 Ga0065707_10326076 3300005295 Bacteria 958
27 Ga0070658_10003127 3300005327 Bacteria 13663
28 Ga0070658_10192633 3300005327 Bacteria 1719
29 Ga0070683_100586145 3300005329 Bacteria 1067
30 Ga0070690_100000003 3300005330 Bacteria 144748
31 Ga0070670_100002186 3300005331 Bacteria 16069
32 Ga0070670_100018732 3300005331 Bacteria 5935
33 Ga0070670_100037654 3300005331 Bacteria 4161
34 Ga0070670_100101408 3300005331 Bacteria 2478
35 Ga0070677_10004459 3300005333 Bacteria 4575
36 Ga0070666_10000006 3300005335 Bacteria 319173
37 Ga0070682_100938375 3300005337 Bacteria 714
38 Ga0070660_100058260 3300005339 Bacteria 2994
39 Ga0070661_100001752 3300005344 Bacteria 15061
40 Ga0070661_100110801 3300005344 Bacteria 2049
41 Ga0070661_100557069 3300005344 Bacteria 923
42 Ga0070668_100154889 3300005347 Bacteria 1856
43 Ga0070669_100000014 3300005353 Bacteria 206875
44 Ga0070669_100030664 3300005353 Bacteria 3881
45 Ga0070675_100320258 3300005354 Unclassified 1370
46 Ga0070671_100009386 3300005355 Bacteria 7855
47 Ga0070671_100276819 3300005355 Bacteria 1427
48 Ga0070674_100060977 3300005356 Bacteria 2631
49 Ga0070674_101488000 3300005356 Bacteria 608
50 Ga0070673_100156569 3300005364 Bacteria 1934
51 Ga0070673_100252019 3300005364 Bacteria 1539
52 Ga0070688_100002513 3300005365 Bacteria 9273
53 Ga0070659_100432186 3300005366 Bacteria 1114
54 Ga0070667_100000127 3300005367 Bacteria 95853
55 Ga0070663_100497822 3300005455 Bacteria 1011
56 Ga0070678_100339458 3300005456 Bacteria 1288
57 Ga0070662_100007854 3300005457 Bacteria 6930
58 Ga0070662_100081873 3300005457 Bacteria 2405
59 Ga0068867_101131071 3300005459 Bacteria 716
60 Ga0070685_10000034 3300005466 Bacteria 81799
61 Ga0070679_100696938 3300005530 Bacteria 958
62 Ga0068853_100008551 3300005539 Bacteria 8225
63 Ga0068853_100288541 3300005539 Bacteria 1514
64 Ga0068853_100313536 3300005539 Bacteria 1453
65 Ga0068853_100834103 3300005539 Bacteria 884
66 Ga0068853_100962798 3300005539 Bacteria 821
67 Ga0070672_100469170 3300005543 Bacteria 1086
68 Ga0070672_101491758 3300005543 Bacteria 606
69 Ga0070686_100000022 3300005544 Bacteria 131168
70 Ga0070665_100000019 3300005548 Bacteria 413972
71 Ga0070665_100000296 3300005548 Bacteria 78411
72 Ga0070665_100004005 3300005548 Bacteria 15534
73 Ga0068855_100008418 3300005563 Bacteria 12475
74 Ga0068855_100802905 3300005563 Bacteria 1000
75 Ga0068855_100992813 3300005563 Bacteria 882
76 Ga0068857_100005865 3300005577 Bacteria 10487
77 Ga0068857_100073886 3300005577 Bacteria 3038
78 Ga0068857_100728405 3300005577 Bacteria 943
79 Ga0068857_100733087 3300005577 Bacteria 940
80 Ga0068857_100832263 3300005577 Bacteria 882
81 Ga0068854_100170428 3300005578 Bacteria 1693
82 Ga0068854_100523425 3300005578 Bacteria 1002
83 Ga0068856_100225507 3300005614 Bacteria 1889
84 Ga0068856_100235719 3300005614 Bacteria 1845
85 Ga0068856_101481886 3300005614 Bacteria 692
86 Ga0068852_100325766 3300005616 Bacteria 1493
87 Ga0068852_100524537 3300005616 Bacteria 1182
88 Ga0068859_100012387 3300005617 Bacteria 8580
89 Ga0068859_100115167 3300005617 Bacteria 2753
90 Ga0068864_100000062 3300005618 Bacteria 121206
91 Ga0068864_100021582 3300005618 Bacteria 5393
92 Ga0068861_100014139 3300005719 Bacteria 5597
93 Ga0068851_10009490 3300005834 Bacteria 4527
94 Ga0068851_10756225 3300005834 Bacteria 601
95 Ga0068863_100000048 3300005841 Bacteria 135912
96 Ga0068863_100000064 3300005841 Bacteria 118153
97 Ga0068863_100014905 3300005841 Bacteria 7467
98 Ga0068863_100259462 3300005841 Unclassified 1680
99 Ga0068863_100324813 3300005841 Bacteria 1495
100 Ga0068858_100000959 3300005842 Bacteria 29853
101 Ga0068858_100002183 3300005842 Bacteria 19831
102 Ga0068860_100000014 3300005843 Bacteria 319437
103 Ga0068860_100070417 3300005843 Bacteria 3325
104 Ga0068862_100000079 3300005844 Bacteria 113551
105 Ga0068862_100000195 3300005844 Bacteria 66918
106 Ga0068862_100000653 3300005844 Bacteria 35801
107 Ga0081455_10121881 3300005937 Bacteria 2053
108 Ga0068865_100037673 3300006881 Bacteria 3267
109 Ga0097620_100012387 3300006931 Bacteria 8580
110 Ga0097620_100115165 3300006931 Bacteria 2753
111 Ga0105251_10001956 3300009011 Bacteria 16841
112 Ga0105240_10056845 3300009093 Bacteria 4894
113 Ga0105240_10067457 3300009093 Bacteria 4434
114 Ga0105240_10956222 3300009093 Bacteria 918
115 Ga0105240_11096988 3300009093 Bacteria 847
116 Ga0105240_11270362 3300009093 Bacteria 777
117 Ga0105247_10023456 3300009101 Bacteria 3717
118 Ga0105247_10023478 3300009101 Bacteria 3715
119 Ga0105247_10165140 3300009101 Bacteria 1468
120 Ga0105243_10316521 3300009148 Bacteria 1420
121 Ga0105241_10614181 3300009174 Bacteria 983
122 Ga0105248_10000014 3300009177 Bacteria 324729
123 Ga0105248_10022033 3300009177 Bacteria 7060
124 Ga0105248_10043249 3300009177 Bacteria 5051
125 Ga0105237_10005719 3300009545 Bacteria 13977
126 Ga0105237_11095258 3300009545 Bacteria 803
127 Ga0105238_10150444 3300009551 Bacteria 2303
128 Ga0105238_10266355 3300009551 Bacteria 1694
129 Ga0105238_10607292 3300009551 Bacteria 1102
130 Ga0105238_11023132 3300009551 Bacteria 847
131 Ga0105238_11024770 3300009551 Bacteria 847
132 Ga0105249_10000104 3300009553 Bacteria 118213
133 Ga0105249_10000169 3300009553 Bacteria 76875
134 Ga0105249_10000253 3300009553 Bacteria 58707
135 Ga0105239_11662452 3300010375 Bacteria 739
136 Ga0105246_10025347 3300011119 Bacteria 3865
137 Ga0157373_10326216 3300013100 Bacteria 1093
138 Ga0157371_10304828 3300013102 Bacteria 1154
139 Ga0157370_10030422 3300013104 Bacteria 5290
140 Ga0157370_10071999 3300013104 Unclassified 3261
141 Ga0157370_10086704 3300013104 Bacteria 2941
142 Ga0157370_10524403 3300013104 Bacteria 1087
143 Ga0157369_10000202 3300013105 Bacteria 82819
144 Ga0157369_10000782 3300013105 Bacteria 41020
145 Ga0157369_10007143 3300013105 Bacteria 12870
146 Ga0157369_10223173 3300013105 Bacteria 1972
147 Ga0157378_10333662 3300013297 Bacteria 1476
148 Ga0157378_10831208 3300013297 Bacteria 951
149 Ga0163162_10093853 3300013306 Bacteria 3086
150 Ga0163162_10212975 3300013306 Bacteria 2062
151 Ga0157372_10534909 3300013307 Bacteria 1366
152 Ga0163163_10055651 3300014325 Bacteria 3910
153 Ga0163163_10452731 3300014325 Bacteria 1344
154 Ga0163163_11059738 3300014325 Bacteria 874
155 Ga0157380_10016912 3300014326 Bacteria 5386
156 Ga0157380_10153491 3300014326 Bacteria 1993
157 Ga0157380_10520974 3300014326 Bacteria 1159
158 Ga0157379_10020386 3300014968 Bacteria 5860
159 Ga0163161_10000020 3300017792 Bacteria 214642
160 Ga0207672_1000927 3300025223 Bacteria 2891
161 Ga0209233_1000052 3300025261 Bacteria 445813
162 Ga0209676_1000174 3300025292 Bacteria 153292
163 Ga0209564_1000686 3300025295 Bacteria 49885
164 Ga0209758_1051562 3300025297 Bacteria 1431
165 Ga0209050_1000010 3300025298 Bacteria 980454
166 Ga0209257_1000027 3300025304 Bacteria 703541
167 Ga0207656_10564964 3300025321 Bacteria 580
168 Ga0207713_1003618 3300025735 Bacteria 10413
169 Ga0207710_10016166 3300025900 Bacteria 3156
170 Ga0207680_10000011 3300025903 Bacteria 391225
171 Ga0207705_10002619 3300025909 Bacteria 13795
172 Ga0207654_10007857 3300025911 Bacteria 5378
173 Ga0207654_10146857 3300025911 Bacteria 1510
174 Ga0207695_10007495 3300025913 Bacteria 13855
175 Ga0207695_10013684 3300025913 Bacteria 9657
176 Ga0207695_10021936 3300025913 Bacteria 7268
177 Ga0207695_10245720 3300025913 Bacteria 1690
178 Ga0207695_10386715 3300025913 Bacteria 1284
179 Ga0207695_10862800 3300025913 Bacteria 785
180 Ga0207671_10012007 3300025914 Bacteria 7000
181 Ga0207671_10012049 3300025914 Bacteria 6985
182 Ga0207671_10169732 3300025914 Bacteria 1694
183 Ga0207649_10000285 3300025920 Bacteria 39556
184 Ga0207649_10322689 3300025920 Bacteria 1135
185 Ga0207681_10000045 3300025923 Bacteria 128454
186 Ga0207694_10088993 3300025924 Bacteria 2434
187 Ga0207694_10429438 3300025924 Bacteria 1101
188 Ga0207694_10543242 3300025924 Bacteria 975
189 Ga0207694_10553927 3300025924 Bacteria 965
190 Ga0207694_11086054 3300025924 Bacteria 677
191 Ga0207650_10000513 3300025925 Bacteria 32232
192 Ga0207650_10034432 3300025925 Bacteria 3673
193 Ga0207650_10059637 3300025925 Bacteria 2845
194 Ga0207650_10257985 3300025925 Bacteria 1413
195 Ga0207659_10501361 3300025926 Unclassified 1028
196 Ga0207687_10003579 3300025927 Bacteria 10455
197 Ga0207644_10004174 3300025931 Bacteria 9368
198 Ga0207644_10254665 3300025931 Bacteria 1402
199 Ga0207644_10687913 3300025931 Unclassified 852
200 Ga0207690_10490832 3300025932 Bacteria 992
201 Ga0207690_10580475 3300025932 Bacteria 913
202 Ga0207706_10112923 3300025933 Bacteria 2390
203 Ga0207706_10135357 3300025933 Bacteria 2167
204 Ga0207706_10151793 3300025933 Bacteria 2037
205 Ga0207706_10433532 3300025933 Bacteria 1138
206 Ga0207709_10241081 3300025935 Bacteria 1315
207 Ga0207709_10871357 3300025935 Bacteria 730
208 Ga0207669_10034959 3300025937 Bacteria 2854
209 Ga0207704_10327349 3300025938 Bacteria 1184
210 Ga0207691_10172370 3300025940 Bacteria 1894
211 Ga0207711_10000021 3300025941 Bacteria 355952
212 Ga0207711_10008089 3300025941 Bacteria 8802
213 Ga0207711_10012979 3300025941 Bacteria 6921
214 Ga0207711_10025298 3300025941 Bacteria 4981
215 Ga0207661_10272042 3300025944 Bacteria 1512
216 Ga0207661_10948173 3300025944 Bacteria 793
217 Ga0207679_10683683 3300025945 Bacteria 930
218 Ga0207667_10004347 3300025949 Bacteria 17355
219 Ga0207667_10004937 3300025949 Bacteria 16289
220 Ga0207667_10374423 3300025949 Bacteria 1451
221 Ga0207667_10860765 3300025949 Bacteria 900
222 Ga0207651_10282243 3300025960 Bacteria 1373
223 Ga0207712_10000013 3300025961 Bacteria 391208
224 Ga0207712_10000137 3300025961 Bacteria 76898
225 Ga0207712_10000199 3300025961 Bacteria 60814
226 Ga0207668_10122215 3300025972 Bacteria 1973
227 Ga0207640_10107467 3300025981 Bacteria 1970
228 Ga0207640_10224599 3300025981 Bacteria 1440
229 Ga0207658_10000184 3300025986 Bacteria 67062
230 Ga0207658_10062986 3300025986 Bacteria 2777
231 Ga0207703_10002410 3300026035 Bacteria 16248
232 Ga0207703_10004250 3300026035 Bacteria 11790
233 Ga0207639_10002451 3300026041 Bacteria 12445
234 Ga0207639_10083993 3300026041 Bacteria 2528
235 Ga0207639_10226527 3300026041 Bacteria 1618
236 Ga0207639_10348413 3300026041 Bacteria 1322
237 Ga0207678_10060233 3300026067 Bacteria 3265
238 Ga0207702_10013739 3300026078 Bacteria 6726
239 Ga0207702_10198270 3300026078 Bacteria 1859
240 Ga0207702_10198504 3300026078 Bacteria 1858
241 Ga0207641_10000107 3300026088 Bacteria 121220
242 Ga0207641_10000143 3300026088 Bacteria 102398
243 Ga0207641_10002355 3300026088 Bacteria 17454
244 Ga0207641_10022478 3300026088 Bacteria 5190
245 Ga0207641_10235006 3300026088 Bacteria 1705
246 Ga0207648_10276007 3300026089 Bacteria 1502
247 Ga0207676_10000057 3300026095 Bacteria 121220
248 Ga0207676_10006613 3300026095 Bacteria 8200
249 Ga0207676_10227303 3300026095 Unclassified 1666
250 Ga0207674_10004573 3300026116 Bacteria 16617
251 Ga0207674_10006677 3300026116 Bacteria 13554
252 Ga0207675_100000613 3300026118 Bacteria 34803
253 Ga0207675_100003385 3300026118 Bacteria 15581
254 Ga0207698_10274100 3300026142 Bacteria 1557
255 Ga0207698_10402208 3300026142 Bacteria 1309
256 Ga0268266_10000025 3300028379 Bacteria 477143
257 Ga0268266_10000489 3300028379 Bacteria 56827
258 Ga0268266_10002211 3300028379 Bacteria 21259
259 Ga0268265_10000080 3300028380 Bacteria 121220
260 Ga0268265_10000213 3300028380 Bacteria 67883
261 Ga0268265_10007234 3300028380 Bacteria 7502
262 Ga0268264_10000037 3300028381 Bacteria 391116
263 Ga0268264_10019877 3300028381 Bacteria 5487
264 Ga0307517_10134258 3300028786 Bacteria 1767
265 Ga0307513_10092852 3300031456 Bacteria 3070
266 Ga0307513_10219830 3300031456 Bacteria 1722
267 Ga0307513_10324016 3300031456 Bacteria 1298
268 Ga0307408_101005255 3300031548 Bacteria 769
269 Ga0307405_10094415 3300031731 Bacteria 1989
270 Ga0307405_10972613 3300031731 Bacteria 722
271 Ga0307412_10214137 3300031911 Bacteria 1472
272 Ga0307412_11625701 3300031911 Bacteria 590
273 Ga0307412_11829047 3300031911 Bacteria 559
274 Ga0307409_100336429 3300031995 Bacteria 1419
275 Ga0307416_100859005 3300032002 Bacteria 1006
276 Ga0307414_10447070 3300032004 Bacteria 1133
277 Ga0307411_11072391 3300032005 Bacteria 725
278 Ga0307415_102043226 3300032126 Bacteria 559
279 Ga0307510_10084584 3300033180 Bacteria 3054
280 Ga0373931_0218675 3300035691 Bacteria 1146
281 Ga0395900_0687339 3300037418 Unclassified 957
282 Ga0395898_0011565 3300037466 Bacteria 9164
283 Ga0395905_0471796 3300037471 Bacteria 1154
284 Ga0395905_0963510 3300037471 Bacteria 756
285 Ga0395901_1061701 3300038443 Unclassified 782
286 Ga0237816_02984 3300039145 Bacteria 1264
287 Ga0451787_000246 3300041441 Bacteria 560
288 Ga0450923_064463 3300042125 Bacteria 804
289 Ga0439434_0327486 3300042435 Bacteria 532
290 Ga0466966_0000019 3300044684 Bacteria 120521
291 Ga0495607_0052242 3300046501 Bacteria 2368
292 Ga0495583_0195544 3300046506 Bacteria 823
293 Ga0495606_0415616 3300046507 Bacteria 697
294 Ga0495616_0036615 3300046513 Bacteria 2531
295 Ga0495643_0009254 3300046522 Bacteria 6138
296 Ga0495648_0326145 3300046524 Bacteria 710
297 Ga0495663_0012860 3300046525 Bacteria 2336
298 Ga0495663_0031151 3300046525 Bacteria 1583
299 Ga0495663_0079030 3300046525 Bacteria 1057
300 Ga0495654_0002239 3300046530 Bacteria 12527
301 Ga0495633_0306806 3300046558 Unclassified 721
302 Ga0495668_0003540 3300046616 Bacteria 11620
303 Ga0495668_0193950 3300046616 Bacteria 1112
304 Ga0495625_0000054 3300046660 Bacteria 187599
305 Ga0495625_0046341 3300046660 Bacteria 3138
306 Ga0495625_0051249 3300046660 Bacteria 2959
307 Ga0495625_0112698 3300046660 Bacteria 1858
308 Ga0495670_0000006 3300046691 Bacteria 255322
309 Ga0495670_0668633 3300046691 Unclassified 566
310 Ga0495671_0040489 3300046692 Bacteria 2350
311 Ga0495589_0204023 3300046794 Bacteria 932
312 Ga0495677_0288449 3300047445 Bacteria 644
313 Ga0495685_043273 3300047447 Bacteria 1537
314 Ga0495686_0024527 3300047472 Bacteria 3961
315 Ga0495686_0164595 3300047472 Bacteria 1293
316 Ga0496100_0192667 3300048903 Bacteria 1481
317 Ga0496101_0922752 3300048904 Bacteria 687
318 Ga0496102_0022838 3300048905 Bacteria 5546
319 Ga0496102_0300121 3300048905 Bacteria 1514
320 Ga0496102_0327808 3300048905 Bacteria 1442
321 Ga0496103_0000312 3300048906 Bacteria 44885
322 Ga0496103_0019884 3300048906 Bacteria 4033
323 Ga0496103_0043758 3300048906 Bacteria 2758
324 Ga0496106_0474151 3300048909 Bacteria 1005
325 Ga0496109_0502910 3300048912 Bacteria 1144
326 Ga0496111_0502882 3300048914 Bacteria 892
327 Ga0496113_0685176 3300048916 Bacteria 819
328 Ga0496116_0035933 3300048919 Bacteria 3475
329 Ga0496117_0008655 3300048920 Bacteria 9626
330 Ga0496117_0012015 3300048920 Bacteria 7690
331 Ga0496117_0027766 3300048920 Bacteria 4398
332 Ga0496117_0059928 3300048920 Bacteria 2626
333 Ga0496118_0000597 3300048921 Bacteria 59798
334 Ga0496118_0016053 3300048921 Bacteria 6893
335 Ga0496118_0027094 3300048921 Bacteria 4859
336 Ga0496118_0061325 3300048921 Bacteria 2785
337 Ga0496121_0000584 3300048924 Bacteria 68507
338 Ga0496121_0159848 3300048924 Bacteria 1649
339 Ga0496121_0586575 3300048924 Bacteria 690
340 Ga0496123_0349069 3300048926 Bacteria 689
341 Ga0496124_0460776 3300048927 Bacteria 864
342 Ga0496125_0219652 3300048928 Bacteria 1226
343 Ga0496126_0006167 3300048929 Bacteria 13420
344 Ga0496126_0167102 3300048929 Bacteria 1877
345 Ga0496126_0279224 3300048929 Bacteria 1384
346 Ga0495678_038503 3300049459 Bacteria 1934
347 Ga0501292_000004 3300049515 Bacteria 159565
348 Ga0501294_000180 3300049517 Bacteria 7721
349 Ga0501300_000345 3300049523 Bacteria 7058
350 Ga0501034_0150729 3300049571 Bacteria 2301
351 Ga0501070_0063180 3300049586 Bacteria 3067
352 Ga0501206_000465 3300049653 Bacteria 4887
353 Ga0501222_009966 3300049662 Bacteria 1254
354 Ga0501224_003240 3300049664 Bacteria 2263
355 Ga0501227_002542 3300049665 Bacteria 4025
356 Ga0501236_016472 3300049670 Bacteria 1047
357 Ga0501257_002768 3300049686 Bacteria 3709
358 Ga0501259_000472 3300049688 Bacteria 6427
359 Ga0501261_000053 3300049690 Bacteria 22071
360 Ga0501221_007416 3300049704 Unclassified 1881
361 Ga0501225_0022321 3300049705 Unclassified 1747
362 Ga0501225_0171108 3300049705 Bacteria 673
363 Ga0501245_000332 3300049708 Bacteria 5625
364 Ga0501080_0282080 3300049742 Bacteria 1510
365 Ga0501241_003602 3300049758 Bacteria 2923
366 Ga0501267_005070 3300049764 Bacteria 1239
367 Ga0501279_000005 3300049775 Bacteria 153858
368 Ga0501281_00005 3300049777 Bacteria 36194
369 Ga0501282_000034 3300049778 Bacteria 18514
370 nmdc:mga0k408_410563_c1 3300050493 Bacteria 805
371 nmdc:mga07m45_56827_c1 3300050496 Bacteria 2212
372 Ga0500643_000474 3300053087 Bacteria 29409
373 Ga0500646_0019256 3300053090 Bacteria 1805
374 Ga0500566_0009288 3300053094 Bacteria 5815
375 Ga0500641_0016784 3300053096 Bacteria 2729
376 Ga0500641_0018107 3300053096 Bacteria 2645
377 Ga0500592_000025 3300053116 Bacteria 49551
378 Ga0500652_140370 3300053131 Bacteria 1006
379 Ga0500658_0073143 3300053134 Bacteria 1451
380 Ga0500559_0039257 3300053136 Bacteria 2059
381 Ga0500559_0101450 3300053136 Bacteria 1326
382 Ga0500568_0142307 3300053139 Bacteria 889
383 Ga0500604_0000108 3300053151 Bacteria 25410
384 Ga0500604_0004043 3300053151 Bacteria 3909
385 Ga0500604_0017220 3300053151 Bacteria 1997
386 Ga0500604_0049431 3300053151 Bacteria 1293
387 Ga0500616_0000161 3300053153 Bacteria 111424
388 Ga0500616_0070586 3300053153 Bacteria 1782
389 Ga0500627_0000249 3300053158 Bacteria 15378
390 Ga0500627_0000510 3300053158 Bacteria 10451
391 Ga0500627_0013767 3300053158 Bacteria 3079
392 Ga0500611_003082 3300053727 Bacteria 2090
393 Ga0500587_000583 3300053739 Bacteria 4530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100018732 Ga0070670_1000187327 151
2 3300005333 Ga0070677_10004459 Ga0070677_100044598 151
3 3300005344 Ga0070661_100557069 Ga0070661_1005570692 151
4 3300005347 Ga0070668_100154889 Ga0070668_1001548892 151
5 3300005353 Ga0070669_100030664 Ga0070669_1000306646 151
6 3300005356 Ga0070674_101488000 Ga0070674_1014880001 151
7 3300005364 Ga0070673_100252019 Ga0070673_1002520192 151
8 3300005456 Ga0070678_100339458 Ga0070678_1003394582 151
9 3300005457 Ga0070662_100081873 Ga0070662_1000818731 151
10 3300005543 Ga0070672_101491758 Ga0070672_1014917581 151
11 3300014326 Ga0157380_10153491 Ga0157380_101534912 151
12 3300041441 Ga0451787_000246 Ga0451787_000246_76_543 152
13 3300049571 Ga0501034_0150729 Ga0501034_0150729_721_1182 152
14 3300049586 Ga0501070_0063180 Ga0501070_0063180_2052_2513 152
15 3300049742 Ga0501080_0282080 Ga0501080_0282080_880_1341 152
16 3300001904 JGI24736J21556_1000093 JGI24736J21556_100009312 153
17 3300001976 JGI24752J21851_1000078 JGI24752J21851_10000784 153
18 3300001979 JGI24740J21852_10020722 JGI24740J21852_100207223 153
19 3300001990 JGI24737J22298_10018222 JGI24737J22298_100182222 153
20 3300002067 JGI24735J21928_10118046 JGI24735J21928_101180462 153
21 3300002070 JGI24750J21931_1000140 JGI24750J21931_100014012 153
22 3300002074 JGI24748J21848_1000072 JGI24748J21848_10000728 153
23 3300002075 JGI24738J21930_10028132 JGI24738J21930_100281322 153
24 3300002076 JGI24749J21850_1001996 JGI24749J21850_10019963 153
25 3300002239 JGI24034J26672_10000028 JGI24034J26672_100000288 153
26 3300005327 Ga0070658_10003127 Ga0070658_1000312716 153
27 3300005327 Ga0070658_10192633 Ga0070658_101926333 153
28 3300005330 Ga0070690_100000003 Ga0070690_10000000337 153
29 3300005331 Ga0070670_100037654 Ga0070670_1000376544 153
30 3300005331 Ga0070670_100101408 Ga0070670_1001014082 153
31 3300005335 Ga0070666_10000006 Ga0070666_100000062 153
32 3300005337 Ga0070682_100938375 Ga0070682_1009383751 153
33 3300005339 Ga0070660_100058260 Ga0070660_1000582603 153
34 3300005344 Ga0070661_100001752 Ga0070661_10000175219 153
35 3300005344 Ga0070661_100110801 Ga0070661_1001108013 153
36 3300005353 Ga0070669_100000014 Ga0070669_100000014119 153
37 3300005354 Ga0070675_100320258 Ga0070675_1003202582 153
38 3300005355 Ga0070671_100009386 Ga0070671_1000093866 153
39 3300005356 Ga0070674_100060977 Ga0070674_1000609771 153
40 3300005365 Ga0070688_100002513 Ga0070688_1000025134 153
41 3300005366 Ga0070659_100432186 Ga0070659_1004321862 153
42 3300005455 Ga0070663_100497822 Ga0070663_1004978222 153
43 3300005466 Ga0070685_10000034 Ga0070685_1000003416 153
44 3300005539 Ga0068853_100288541 Ga0068853_1002885412 153
45 3300005544 Ga0070686_100000022 Ga0070686_100000022127 153
46 3300005548 Ga0070665_100000019 Ga0070665_100000019386 153
47 3300005563 Ga0068855_100008418 Ga0068855_1000084187 153
48 3300005563 Ga0068855_100992813 Ga0068855_1009928132 153
49 3300005577 Ga0068857_100005865 Ga0068857_1000058652 153
50 3300005577 Ga0068857_100733087 Ga0068857_1007330871 153
51 3300005577 Ga0068857_100832263 Ga0068857_1008322631 153
52 3300005614 Ga0068856_100225507 Ga0068856_1002255073 153
53 3300005614 Ga0068856_100235719 Ga0068856_1002357192 153
54 3300005614 Ga0068856_101481886 Ga0068856_1014818861 153
55 3300005616 Ga0068852_100325766 Ga0068852_1003257662 153
56 3300005618 Ga0068864_100021582 Ga0068864_1000215823 153
57 3300005719 Ga0068861_100014139 Ga0068861_1000141393 153
58 3300005834 Ga0068851_10009490 Ga0068851_100094903 153
59 3300005834 Ga0068851_10756225 Ga0068851_107562252 153
60 3300005841 Ga0068863_100000048 Ga0068863_100000048119 153
61 3300005841 Ga0068863_100259462 Ga0068863_1002594623 153
62 3300005842 Ga0068858_100000959 Ga0068858_10000095931 153
63 3300005843 Ga0068860_100000014 Ga0068860_1000000143 153
64 3300005844 Ga0068862_100000195 Ga0068862_10000019537 153
65 3300009093 Ga0105240_10067457 Ga0105240_100674573 153
66 3300009093 Ga0105240_10956222 Ga0105240_109562222 153
67 3300009093 Ga0105240_11096988 Ga0105240_110969881 153
68 3300009093 Ga0105240_11270362 Ga0105240_112703621 153
69 3300009101 Ga0105247_10165140 Ga0105247_101651402 153
70 3300009174 Ga0105241_10614181 Ga0105241_106141811 153
71 3300009545 Ga0105237_11095258 Ga0105237_110952581 153
72 3300009551 Ga0105238_11023132 Ga0105238_110231321 153
73 3300009551 Ga0105238_11024770 Ga0105238_110247702 153
74 3300009553 Ga0105249_10000104 Ga0105249_10000104116 153
75 3300011119 Ga0105246_10025347 Ga0105246_100253474 153
76 3300013100 Ga0157373_10326216 Ga0157373_103262161 153
77 3300013102 Ga0157371_10304828 Ga0157371_103048282 153
78 3300013104 Ga0157370_10030422 Ga0157370_100304229 153
79 3300013104 Ga0157370_10071999 Ga0157370_100719994 153
80 3300013104 Ga0157370_10086704 Ga0157370_100867043 153
81 3300013104 Ga0157370_10524403 Ga0157370_105244032 153
82 3300013105 Ga0157369_10000202 Ga0157369_1000020217 153
83 3300013105 Ga0157369_10000782 Ga0157369_1000078229 153
84 3300013105 Ga0157369_10007143 Ga0157369_100071431 153
85 3300013105 Ga0157369_10223173 Ga0157369_102231732 153
86 3300013306 Ga0163162_10212975 Ga0163162_102129751 153
87 3300013307 Ga0157372_10534909 Ga0157372_105349091 153
88 3300014325 Ga0163163_10055651 Ga0163163_100556512 153
89 3300014325 Ga0163163_11059738 Ga0163163_110597381 153
90 3300014968 Ga0157379_10020386 Ga0157379_100203866 153
91 3300017792 Ga0163161_10000020 Ga0163161_10000020113 153
92 3300025223 Ga0207672_1000927 Ga0207672_10009273 153
93 3300025321 Ga0207656_10564964 Ga0207656_105649641 153
94 3300025903 Ga0207680_10000011 Ga0207680_100000113 153
95 3300025909 Ga0207705_10002619 Ga0207705_1000261916 153
96 3300025911 Ga0207654_10007857 Ga0207654_100078573 153
97 3300025911 Ga0207654_10146857 Ga0207654_101468572 153
98 3300025913 Ga0207695_10007495 Ga0207695_1000749511 153
99 3300025913 Ga0207695_10245720 Ga0207695_102457202 153
100 3300025913 Ga0207695_10386715 Ga0207695_103867152 153
101 3300025913 Ga0207695_10862800 Ga0207695_108628001 153
102 3300025914 Ga0207671_10012007 Ga0207671_100120073 153
103 3300025914 Ga0207671_10169732 Ga0207671_101697322 153
104 3300025920 Ga0207649_10000285 Ga0207649_1000028522 153
105 3300025923 Ga0207681_10000045 Ga0207681_1000004525 153
106 3300025924 Ga0207694_10429438 Ga0207694_104294381 153
107 3300025924 Ga0207694_10553927 Ga0207694_105539272 153
108 3300025924 Ga0207694_11086054 Ga0207694_110860541 153
109 3300025925 Ga0207650_10034432 Ga0207650_100344324 153
110 3300025925 Ga0207650_10059637 Ga0207650_100596371 153
111 3300025925 Ga0207650_10257985 Ga0207650_102579852 153
112 3300025926 Ga0207659_10501361 Ga0207659_105013612 153
113 3300025931 Ga0207644_10004174 Ga0207644_100041748 153
114 3300025931 Ga0207644_10687913 Ga0207644_106879132 153
115 3300025932 Ga0207690_10490832 Ga0207690_104908321 153
116 3300025932 Ga0207690_10580475 Ga0207690_105804751 153
117 3300025933 Ga0207706_10151793 Ga0207706_101517933 153
118 3300025933 Ga0207706_10433532 Ga0207706_104335322 153
119 3300025937 Ga0207669_10034959 Ga0207669_100349594 153
120 3300025941 Ga0207711_10008089 Ga0207711_100080891 153
121 3300025945 Ga0207679_10683683 Ga0207679_106836832 153
122 3300025949 Ga0207667_10004347 Ga0207667_1000434716 153
123 3300025949 Ga0207667_10004937 Ga0207667_100049372 153
124 3300025949 Ga0207667_10860765 Ga0207667_108607651 153
125 3300025961 Ga0207712_10000013 Ga0207712_100000133 153
126 3300025972 Ga0207668_10122215 Ga0207668_101222152 153
127 3300025981 Ga0207640_10224599 Ga0207640_102245992 153
128 3300025986 Ga0207658_10062986 Ga0207658_100629862 153
129 3300026035 Ga0207703_10004250 Ga0207703_1000425010 153
130 3300026041 Ga0207639_10083993 Ga0207639_100839932 153
131 3300026041 Ga0207639_10226527 Ga0207639_102265272 153
132 3300026041 Ga0207639_10348413 Ga0207639_103484131 153
133 3300026067 Ga0207678_10060233 Ga0207678_100602332 153
134 3300026078 Ga0207702_10013739 Ga0207702_100137399 153
135 3300026078 Ga0207702_10198270 Ga0207702_101982702 153
136 3300026078 Ga0207702_10198504 Ga0207702_101985042 153
137 3300026088 Ga0207641_10000143 Ga0207641_1000014324 153
138 3300026088 Ga0207641_10022478 Ga0207641_100224784 153
139 3300026095 Ga0207676_10006613 Ga0207676_100066133 153
140 3300026095 Ga0207676_10227303 Ga0207676_102273032 153
141 3300026116 Ga0207674_10004573 Ga0207674_1000457313 153
142 3300026118 Ga0207675_100003385 Ga0207675_1000033853 153
143 3300026142 Ga0207698_10274100 Ga0207698_102741001 153
144 3300028379 Ga0268266_10000025 Ga0268266_10000025119 153
145 3300028380 Ga0268265_10007234 Ga0268265_100072344 153
146 3300028381 Ga0268264_10000037 Ga0268264_100000373 153
147 3300031995 Ga0307409_100336429 Ga0307409_1003364292 153
148 3300032005 Ga0307411_11072391 Ga0307411_110723912 153
149 3300037418 Ga0395900_0687339 Ga0395900_0687339_426_887 153
150 3300037466 Ga0395898_0011565 Ga0395898_0011565_2145_2606 153
151 3300037471 Ga0395905_0471796 Ga0395905_0471796_656_1117 153
152 3300038443 Ga0395901_1061701 Ga0395901_1061701_43_504 153
153 3300042125 Ga0450923_064463 Ga0450923_064463_180_641 153
154 3300042435 Ga0439434_0327486 Ga0439434_0327486_42_503 153
155 3300044684 Ga0466966_0000019 Ga0466966_0000019_48552_49013 153
156 3300046501 Ga0495607_0052242 Ga0495607_0052242_626_1087 153
157 3300046506 Ga0495583_0195544 Ga0495583_0195544_51_512 153
158 3300046507 Ga0495606_0415616 Ga0495606_0415616_102_563 153
159 3300046522 Ga0495643_0009254 Ga0495643_0009254_229_690 153
160 3300046558 Ga0495633_0306806 Ga0495633_0306806_242_703 153
161 3300046660 Ga0495625_0051249 Ga0495625_0051249_370_831 153
162 3300046691 Ga0495670_0668633 Ga0495670_0668633_23_484 153
163 3300047445 Ga0495677_0288449 Ga0495677_0288449_76_537 153
164 3300048903 Ga0496100_0192667 Ga0496100_0192667_111_575 153
165 3300048904 Ga0496101_0922752 Ga0496101_0922752_154_618 153
166 3300048905 Ga0496102_0022838 Ga0496102_0022838_2150_2614 153
167 3300048906 Ga0496103_0000312 Ga0496103_0000312_33085_33549 153
168 3300048909 Ga0496106_0474151 Ga0496106_0474151_206_670 153
169 3300048912 Ga0496109_0502910 Ga0496109_0502910_657_1121 153
170 3300048914 Ga0496111_0502882 Ga0496111_0502882_388_852 153
171 3300048916 Ga0496113_0685176 Ga0496113_0685176_276_740 153
172 3300048919 Ga0496116_0035933 Ga0496116_0035933_1802_2266 153
173 3300048920 Ga0496117_0012015 Ga0496117_0012015_5187_5651 153
174 3300048920 Ga0496117_0059928 Ga0496117_0059928_2126_2590 153
175 3300048921 Ga0496118_0016053 Ga0496118_0016053_2274_2738 153
176 3300048921 Ga0496118_0061325 Ga0496118_0061325_198_662 153
177 3300048924 Ga0496121_0159848 Ga0496121_0159848_289_753 153
178 3300048928 Ga0496125_0219652 Ga0496125_0219652_42_506 153
179 3300048929 Ga0496126_0167102 Ga0496126_0167102_1002_1463 153
180 3300050493 nmdc:mga0k408_410563_c1 nmdc:mga0k408_410563_c1_87_548 153
181 3300005543 Ga0070672_100469170 Ga0070672_1004691702 154
182 3300005548 Ga0070665_100000296 Ga0070665_10000029634 154
183 3300025940 Ga0207691_10172370 Ga0207691_101723702 154
184 3300025944 Ga0207661_10272042 Ga0207661_102720422 154
185 3300028379 Ga0268266_10002211 Ga0268266_100022119 154
186 3300033180 Ga0307510_10084584 Ga0307510_100845844 154
187 3300035691 Ga0373931_0218675 Ga0373931_0218675_155_619 154
188 3300047472 Ga0495686_0164595 Ga0495686_0164595_322_786 154
189 3300050496 nmdc:mga07m45_56827_c1 nmdc:mga07m45_56827_c1_1443_1907 154
190 3300053096 Ga0500641_0016784 Ga0500641_0016784_1921_2385 154
191 3300002774 JGI25150J39212_1000416 JGI25150J39212_100041610 155
192 3300003187 JGI25151J46595_10066892 JGI25151J46595_100668922 155
193 3300003215 JGI25153J46596_10000153 JGI25153J46596_1000015324 155
194 3300003771 Ga0055526_1004471 Ga0055526_10044712 155
195 3300003791 Ga0055530_10000510 Ga0055530_1000051014 155
196 3300003791 Ga0055530_10027811 Ga0055530_100278111 155
197 3300003794 Ga0055531_10000319 Ga0055531_1000031926 155
198 3300003794 Ga0055531_10035977 Ga0055531_100359771 155
199 3300005262 Ga0065165_1035817 Ga0065165_10358172 155
200 3300005355 Ga0070671_100276819 Ga0070671_1002768192 155
201 3300005539 Ga0068853_100962798 Ga0068853_1009627981 155
202 3300005548 Ga0070665_100004005 Ga0070665_1000040058 155
203 3300005841 Ga0068863_100014905 Ga0068863_1000149056 155
204 3300005841 Ga0068863_100324813 Ga0068863_1003248132 155
205 3300005843 Ga0068860_100070417 Ga0068860_1000704175 155
206 3300005844 Ga0068862_100000653 Ga0068862_10000065321 155
207 3300009093 Ga0105240_10056845 Ga0105240_100568455 155
208 3300009101 Ga0105247_10023478 Ga0105247_100234786 155
209 3300009177 Ga0105248_10043249 Ga0105248_100432491 155
210 3300009545 Ga0105237_10005719 Ga0105237_100057193 155
211 3300009553 Ga0105249_10000169 Ga0105249_1000016949 155
212 3300013297 Ga0157378_10333662 Ga0157378_103336622 155
213 3300014326 Ga0157380_10520974 Ga0157380_105209742 155
214 3300025295 Ga0209564_1000686 Ga0209564_100068621 155
215 3300025297 Ga0209758_1051562 Ga0209758_10515622 155
216 3300025298 Ga0209050_1000010 Ga0209050_1000010743 155
217 3300025304 Ga0209257_1000027 Ga0209257_1000027385 155
218 3300025913 Ga0207695_10021936 Ga0207695_100219365 155
219 3300025914 Ga0207671_10012049 Ga0207671_100120496 155
220 3300025931 Ga0207644_10254665 Ga0207644_102546652 155
221 3300025933 Ga0207706_10135357 Ga0207706_101353571 155
222 3300025941 Ga0207711_10025298 Ga0207711_100252985 155
223 3300025944 Ga0207661_10948173 Ga0207661_109481732 155
224 3300025961 Ga0207712_10000137 Ga0207712_1000013749 155
225 3300026088 Ga0207641_10002355 Ga0207641_100023559 155
226 3300026088 Ga0207641_10235006 Ga0207641_102350062 155
227 3300026089 Ga0207648_10276007 Ga0207648_102760072 155
228 3300028379 Ga0268266_10000489 Ga0268266_1000048968 155
229 3300028380 Ga0268265_10000213 Ga0268265_1000021342 155
230 3300028381 Ga0268264_10019877 Ga0268264_100198773 155
231 3300031456 Ga0307513_10219830 Ga0307513_102198302 155
232 3300031456 Ga0307513_10324016 Ga0307513_103240164 155
233 3300032002 Ga0307416_100859005 Ga0307416_1008590052 155
234 3300032004 Ga0307414_10447070 Ga0307414_104470703 155
235 3300032126 Ga0307415_102043226 Ga0307415_1020432261 155
236 3300046513 Ga0495616_0036615 Ga0495616_0036615_894_1361 155
237 3300046525 Ga0495663_0012860 Ga0495663_0012860_751_1218 155
238 3300046525 Ga0495663_0079030 Ga0495663_0079030_461_928 155
239 3300046530 Ga0495654_0002239 Ga0495654_0002239_716_1183 155
240 3300046616 Ga0495668_0003540 Ga0495668_0003540_715_1182 155
241 3300046616 Ga0495668_0193950 Ga0495668_0193950_84_551 155
242 3300046794 Ga0495589_0204023 Ga0495589_0204023_130_597 155
243 3300047447 Ga0495685_043273 Ga0495685_043273_217_684 155
244 3300048905 Ga0496102_0327808 Ga0496102_0327808_49_519 155
245 3300048906 Ga0496103_0043758 Ga0496103_0043758_1597_2067 155
246 3300048920 Ga0496117_0027766 Ga0496117_0027766_2577_3044 155
247 3300048927 Ga0496124_0460776 Ga0496124_0460776_323_790 155
248 3300048929 Ga0496126_0279224 Ga0496126_0279224_679_1185 155
249 3300049459 Ga0495678_038503 Ga0495678_038503_926_1393 155
250 3300049758 Ga0501241_003602 Ga0501241_003602_355_822 155
251 3300049764 Ga0501267_005070 Ga0501267_005070_287_754 155
252 3300053087 Ga0500643_000474 Ga0500643_000474_23765_24235 155
253 3300053094 Ga0500566_0009288 Ga0500566_0009288_3848_4315 155
254 3300053116 Ga0500592_000025 Ga0500592_000025_5033_5578 155
255 3300053136 Ga0500559_0101450 Ga0500559_0101450_230_697 155
256 3300053151 Ga0500604_0004043 Ga0500604_0004043_1160_1627 155
257 3300053151 Ga0500604_0017220 Ga0500604_0017220_91_645 155
258 3300053151 Ga0500604_0049431 Ga0500604_0049431_548_1015 155
259 3300053158 Ga0500627_0000249 Ga0500627_0000249_7072_7539 155
260 3300053158 Ga0500627_0000510 Ga0500627_0000510_4824_5369 155
261 3300053158 Ga0500627_0013767 Ga0500627_0013767_1979_2533 155
262 3300053727 Ga0500611_003082 Ga0500611_003082_1044_1511 155
263 3300053739 Ga0500587_000583 Ga0500587_000583_1224_1691 155
264 2162886007 SwRhRL2b_contig_1925373 SwRhRL2b_0935.00007770 156
265 3300001976 JGI24752J21851_1000881 JGI24752J21851_10008813 156
266 3300005289 Ga0065704_10074105 Ga0065704_100741053 156
267 3300005295 Ga0065707_10107754 Ga0065707_101077543 156
268 3300005331 Ga0070670_100002186 Ga0070670_10000218612 156
269 3300005367 Ga0070667_100000127 Ga0070667_10000012745 156
270 3300005457 Ga0070662_100007854 Ga0070662_1000078541 156
271 3300005530 Ga0070679_100696938 Ga0070679_1006969382 156
272 3300005539 Ga0068853_100008551 Ga0068853_1000085514 156
273 3300005539 Ga0068853_100834103 Ga0068853_1008341031 156
274 3300005563 Ga0068855_100802905 Ga0068855_1008029051 156
275 3300005577 Ga0068857_100073886 Ga0068857_1000738862 156
276 3300005577 Ga0068857_100728405 Ga0068857_1007284052 156
277 3300005578 Ga0068854_100170428 Ga0068854_1001704283 156
278 3300005616 Ga0068852_100524537 Ga0068852_1005245372 156
279 3300005617 Ga0068859_100115167 Ga0068859_1001151674 156
280 3300005618 Ga0068864_100000062 Ga0068864_10000006269 156
281 3300005841 Ga0068863_100000064 Ga0068863_10000006466 156
282 3300005844 Ga0068862_100000079 Ga0068862_10000007955 156
283 3300005937 Ga0081455_10121881 Ga0081455_101218813 156
284 3300006931 Ga0097620_100115165 Ga0097620_1001151654 156
285 3300009011 Ga0105251_10001956 Ga0105251_100019569 156
286 3300009101 Ga0105247_10023456 Ga0105247_100234563 156
287 3300009177 Ga0105248_10000014 Ga0105248_10000014239 156
288 3300009551 Ga0105238_10266355 Ga0105238_102663552 156
289 3300009553 Ga0105249_10000253 Ga0105249_1000025349 156
290 3300010375 Ga0105239_11662452 Ga0105239_116624521 156
291 3300013306 Ga0163162_10093853 Ga0163162_100938534 156
292 3300014325 Ga0163163_10452731 Ga0163163_104527312 156
293 3300025735 Ga0207713_1003618 Ga0207713_100361810 156
294 3300025900 Ga0207710_10016166 Ga0207710_100161664 156
295 3300025924 Ga0207694_10088993 Ga0207694_100889933 156
296 3300025925 Ga0207650_10000513 Ga0207650_1000051312 156
297 3300025933 Ga0207706_10112923 Ga0207706_101129232 156
298 3300025941 Ga0207711_10000021 Ga0207711_1000002190 156
299 3300025949 Ga0207667_10374423 Ga0207667_103744231 156
300 3300025961 Ga0207712_10000199 Ga0207712_1000019919 156
301 3300025986 Ga0207658_10000184 Ga0207658_1000018418 156
302 3300026041 Ga0207639_10002451 Ga0207639_1000245115 156
303 3300026088 Ga0207641_10000107 Ga0207641_1000010770 156
304 3300026095 Ga0207676_10000057 Ga0207676_1000005770 156
305 3300026116 Ga0207674_10006677 Ga0207674_100066771 156
306 3300026142 Ga0207698_10402208 Ga0207698_104022082 156
307 3300028380 Ga0268265_10000080 Ga0268265_1000008070 156
308 3300028786 Ga0307517_10134258 Ga0307517_101342582 156
309 3300031548 Ga0307408_101005255 Ga0307408_1010052551 156
310 3300031731 Ga0307405_10094415 Ga0307405_100944151 156
311 3300031731 Ga0307405_10972613 Ga0307405_109726132 156
312 3300031911 Ga0307412_10214137 Ga0307412_102141373 156
313 3300031911 Ga0307412_11625701 Ga0307412_116257011 156
314 3300031911 Ga0307412_11829047 Ga0307412_118290471 156
315 3300046691 Ga0495670_0000006 Ga0495670_0000006_57664_58134 156
316 3300048905 Ga0496102_0300121 Ga0496102_0300121_483_953 156
317 3300048906 Ga0496103_0019884 Ga0496103_0019884_3375_3845 156
318 3300048920 Ga0496117_0008655 Ga0496117_0008655_9103_9573 156
319 3300048921 Ga0496118_0000597 Ga0496118_0000597_49885_50355 156
320 3300053090 Ga0500646_0019256 Ga0500646_0019256_1162_1650 156
321 3300053096 Ga0500641_0018107 Ga0500641_0018107_238_720 156
322 3300053131 Ga0500652_140370 Ga0500652_140370_313_783 156
323 3300053134 Ga0500658_0073143 Ga0500658_0073143_589_1059 156
324 3300053136 Ga0500559_0039257 Ga0500559_0039257_1534_2004 156
325 3300053139 Ga0500568_0142307 Ga0500568_0142307_143_625 156
326 3300053151 Ga0500604_0000108 Ga0500604_0000108_14661_15149 156
327 3300053153 Ga0500616_0070586 Ga0500616_0070586_1038_1520 156
328 2162886006 SwRhRL3b_contig_815195 SwRhRL3b_0121.00002360 157
329 3300005295 Ga0065707_10082480 Ga0065707_1008248014 157
330 3300005295 Ga0065707_10326076 Ga0065707_103260762 157
331 3300005329 Ga0070683_100586145 Ga0070683_1005861452 157
332 3300005364 Ga0070673_100156569 Ga0070673_1001565692 157
333 3300005459 Ga0068867_101131071 Ga0068867_1011310712 157
334 3300005539 Ga0068853_100313536 Ga0068853_1003135362 157
335 3300005578 Ga0068854_100523425 Ga0068854_1005234252 157
336 3300005617 Ga0068859_100012387 Ga0068859_1000123877 157
337 3300005842 Ga0068858_100002183 Ga0068858_10000218314 157
338 3300006881 Ga0068865_100037673 Ga0068865_1000376733 157
339 3300006931 Ga0097620_100012387 Ga0097620_1000123878 157
340 3300009148 Ga0105243_10316521 Ga0105243_103165213 157
341 3300009177 Ga0105248_10022033 Ga0105248_100220335 157
342 3300009551 Ga0105238_10150444 Ga0105238_101504442 157
343 3300009551 Ga0105238_10607292 Ga0105238_106072921 157
344 3300013297 Ga0157378_10831208 Ga0157378_108312082 157
345 3300014326 Ga0157380_10016912 Ga0157380_100169125 157
346 3300025261 Ga0209233_1000052 Ga0209233_100005224 157
347 3300025292 Ga0209676_1000174 Ga0209676_1000174135 157
348 3300025913 Ga0207695_10013684 Ga0207695_100136842 157
349 3300025920 Ga0207649_10322689 Ga0207649_103226892 157
350 3300025924 Ga0207694_10543242 Ga0207694_105432422 157
351 3300025927 Ga0207687_10003579 Ga0207687_100035795 157
352 3300025935 Ga0207709_10241081 Ga0207709_102410813 157
353 3300025935 Ga0207709_10871357 Ga0207709_108713571 157
354 3300025938 Ga0207704_10327349 Ga0207704_103273491 157
355 3300025941 Ga0207711_10012979 Ga0207711_100129795 157
356 3300025960 Ga0207651_10282243 Ga0207651_102822432 157
357 3300025981 Ga0207640_10107467 Ga0207640_101074674 157
358 3300026035 Ga0207703_10002410 Ga0207703_100024104 157
359 3300026118 Ga0207675_100000613 Ga0207675_10000061317 157
360 3300031456 Ga0307513_10092852 Ga0307513_100928524 157
361 3300037471 Ga0395905_0963510 Ga0395905_0963510_150_626 157
362 3300039145 Ga0237816_02984 Ga0237816_02984_79_558 157
363 3300046524 Ga0495648_0326145 Ga0495648_0326145_199_675 157
364 3300046525 Ga0495663_0031151 Ga0495663_0031151_201_686 157
365 3300046660 Ga0495625_0000054 Ga0495625_0000054_95130_95615 157
366 3300046660 Ga0495625_0046341 Ga0495625_0046341_1372_1857 157
367 3300046660 Ga0495625_0112698 Ga0495625_0112698_959_1441 157
368 3300046692 Ga0495671_0040489 Ga0495671_0040489_124_606 157
369 3300047472 Ga0495686_0024527 Ga0495686_0024527_343_828 157
370 3300048921 Ga0496118_0027094 Ga0496118_0027094_1965_2441 157
371 3300048924 Ga0496121_0000584 Ga0496121_0000584_32928_33404 157
372 3300048924 Ga0496121_0586575 Ga0496121_0586575_93_572 157
373 3300048926 Ga0496123_0349069 Ga0496123_0349069_79_627 157
374 3300048929 Ga0496126_0006167 Ga0496126_0006167_9263_9739 157
375 3300049515 Ga0501292_000004 Ga0501292_000004_43315_43866 157
376 3300049517 Ga0501294_000180 Ga0501294_000180_4671_5222 157
377 3300049523 Ga0501300_000345 Ga0501300_000345_3472_4023 157
378 3300049653 Ga0501206_000465 Ga0501206_000465_1623_2174 157
379 3300049662 Ga0501222_009966 Ga0501222_009966_495_1028 157
380 3300049664 Ga0501224_003240 Ga0501224_003240_518_1069 157
381 3300049665 Ga0501227_002542 Ga0501227_002542_2560_3111 157
382 3300049670 Ga0501236_016472 Ga0501236_016472_482_1033 157
383 3300049686 Ga0501257_002768 Ga0501257_002768_2929_3480 157
384 3300049688 Ga0501259_000472 Ga0501259_000472_702_1253 157
385 3300049690 Ga0501261_000053 Ga0501261_000053_9141_9692 157
386 3300049704 Ga0501221_007416 Ga0501221_007416_1230_1781 157
387 3300049705 Ga0501225_0022321 Ga0501225_0022321_102_653 157
388 3300049705 Ga0501225_0171108 Ga0501225_0171108_102_653 157
389 3300049708 Ga0501245_000332 Ga0501245_000332_570_1121 157
390 3300049775 Ga0501279_000005 Ga0501279_000005_134750_135301 157
391 3300049777 Ga0501281_00005 Ga0501281_00005_18560_19111 157
392 3300049778 Ga0501282_000034 Ga0501282_000034_12267_12818 157
393 3300053153 Ga0500616_0000161 Ga0500616_0000161_103559_104056 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01272

GreA_GreB

Transcription elongation factor, GreA/GreB, C-term

80

154

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z03-assembly1.cif.gz_B dna topoisomerase 0.9578 32 73
8h9m-assembly1.cif.gz_H human atp synthase state 3a subregion 3 0.9528 34 73
4wzx-assembly1.cif.gz_A ulk3 regulates cytokinetic abscission by phosphorylating escrt-iii proteins 0.9451 34 72
4yxw-assembly1.cif.gz_H bovine heart mitochondrial f1-atpase inhibited by amp-pnp and adp in the presence of thiophosphate. 0.9405 34 72
1mft-assembly1.cif.gz_B crystal structure of four-helix bundle model 0.9388 31 72
ID Description Score Start End Superfamily
af_Q8IKB5_261_518_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9829 34 72 1.20.1070.10
af_B9FNG6_1_117_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9721 33 72 1.20.1250.20
af_Q54TN6_1_527_3.90.1570.30 Alpha Beta;Alpha-Beta Complex;tt1808, chain A; 0.9519 34 72 3.90.1570.30
af_B5DEF8_24_120_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.9514 34 72 1.10.287.1060
af_Q9H160_25_121_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.9483 34 72 1.10.287.1060
ID Description Score Start End GO Terms
AF-A0A4Q5QEW8-F1-model_v4 Nucleoside-diphosphate kinase 0.9596 20 157 GO:0003677
GO:0016301
GO:0032784
AF-A0A4Q5QEW8-F1-model_v4 Nucleoside-diphosphate kinase 0.9528 20 157 GO:0003677
GO:0016301
GO:0032784
AF-A0A2E1Z1V5-F1-model_v4 deleted 0.9419 46 150
AF-A0A2Z6AGG0-F1-model_v4 Transcription elongation factor GreA/GreB C-terminal domain-containing protein 0.9326 15 155 GO:0003677
GO:0006354
GO:0032784
GO:0070063
AF-N9VX39-F1-model_v4 GreA/GreB family elongation factor 0.9314 15 155 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063

Feature Viewer

pLDDT pTM Quality
87.59 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map