F432481

General Info

Members Datasets Scaffolds Average Seq Length
393 165 393 355

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10003908|JGI24737J22298_100039082
Length 378
Sequence VRTTQSDYMHWAKFKPPARFALTASEVPHFRLDSLPIDIAGLDLDGASHPRYPPLRDAIARRYGVGPEQVVAADGTSMANFLAMAALIEPGDEVLVEQPTYEPLLGAASFLGGEIRRFDRRSEDGFRIDIGRVAAAVTGRTRLIVITNLHNPSSALAGEGELRALAELARNAGARILIDEVYLDSAVPPGRSAVHLGSEFVCTNSLTKVYGLSGLRCGWILAEPEVAERMWRLNDLFGVNQAHQAERLACLAFERLDQILGDTPAMLERNRAVFNAFVAGRTDVEAMPAEHGIVAFPRWTRGNTDPLAERLREHYDTAVVPGRWFEMPDHFRVGLGVPTDLLEEGLSRLGAALDDLRXGQSDRSERTGVLPEFXGPHI

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.56
Rhizosphere 96.18
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5610527 2162886012 Unclassified 1578
2 JGI24740J21852_10012062 3300001979 Bacteria 3266
3 JGI24739J22299_10001795 3300001989 Bacteria 8170
4 JGI24737J22298_10000691 3300001990 Bacteria 11843
5 JGI24737J22298_10003908 3300001990 Bacteria 5226
6 JGI24738J21930_10000237 3300002075 Bacteria 15008
7 Ga0065712_10074837 3300005290 Bacteria 3996
8 Ga0065715_10171461 3300005293 Unclassified 1543
9 Ga0065707_10023858 3300005295 Bacteria 1616
10 Ga0070658_10000205 3300005327 Bacteria 52211
11 Ga0070658_10091211 3300005327 Bacteria 2511
12 Ga0070658_10103027 3300005327 Bacteria 2360
13 Ga0070676_10020752 3300005328 Bacteria 3672
14 Ga0070676_10035613 3300005328 Bacteria 2863
15 Ga0070676_10052878 3300005328 Bacteria 2390
16 Ga0070683_100004542 3300005329 Bacteria 11456
17 Ga0070683_100112308 3300005329 Bacteria 2571
18 Ga0070683_100375230 3300005329 Bacteria 1355
19 Ga0070690_100002718 3300005330 Bacteria 9548
20 Ga0070670_100024466 3300005331 Bacteria 5193
21 Ga0070670_100031301 3300005331 Bacteria 4581
22 Ga0070670_100109232 3300005331 Bacteria 2383
23 Ga0070670_100151454 3300005331 Bacteria 2007
24 Ga0070677_10000275 3300005333 Bacteria 18016
25 Ga0070677_10034230 3300005333 Bacteria 1961
26 Ga0070677_10046145 3300005333 Bacteria 1741
27 Ga0070666_10000168 3300005335 Bacteria 45111
28 Ga0070666_10000342 3300005335 Bacteria 29324
29 Ga0070680_100006388 3300005336 Bacteria 8955
30 Ga0070680_100177055 3300005336 Bacteria 1795
31 Ga0070682_100086985 3300005337 Bacteria 2036
32 Ga0068868_100002310 3300005338 Bacteria 13190
33 Ga0068868_100002494 3300005338 Bacteria 12783
34 Ga0068868_100140375 3300005338 Bacteria 1983
35 Ga0068868_100278887 3300005338 Bacteria 1414
36 Ga0068868_100368868 3300005338 Bacteria 1233
37 Ga0070660_100000009 3300005339 Bacteria 145691
38 Ga0070660_100025786 3300005339 Bacteria 4372
39 Ga0070660_100031651 3300005339 Bacteria 3974
40 Ga0070691_10000966 3300005341 Bacteria 11743
41 Ga0070661_100000100 3300005344 Bacteria 70585
42 Ga0070661_100050543 3300005344 Bacteria 3042
43 Ga0070661_100240965 3300005344 Bacteria 1392
44 Ga0070692_10006317 3300005345 Bacteria 5139
45 Ga0070668_100018349 3300005347 Bacteria 5252
46 Ga0070669_100031918 3300005353 Bacteria 3805
47 Ga0070669_100142308 3300005353 Bacteria 1850
48 Ga0070669_100206768 3300005353 Bacteria 1547
49 Ga0070675_100016371 3300005354 Bacteria 5885
50 Ga0070671_100002442 3300005355 Bacteria 14371
51 Ga0070671_100004212 3300005355 Bacteria 11379
52 Ga0070671_100007800 3300005355 Bacteria 8551
53 Ga0070671_100028136 3300005355 Bacteria 4628
54 Ga0070671_100079826 3300005355 Bacteria 2735
55 Ga0070671_100107612 3300005355 Bacteria 2341
56 Ga0070674_100005255 3300005356 Bacteria 7455
57 Ga0070674_100005341 3300005356 Bacteria 7408
58 Ga0070674_100030212 3300005356 Bacteria 3578
59 Ga0070674_100060006 3300005356 Bacteria 2650
60 Ga0070674_100078403 3300005356 Bacteria 2354
61 Ga0070674_100155499 3300005356 Bacteria 1730
62 Ga0070674_100208944 3300005356 Bacteria 1512
63 Ga0070673_100007550 3300005364 Bacteria 7186
64 Ga0070673_100023337 3300005364 Bacteria 4520
65 Ga0070673_100065928 3300005364 Bacteria 2891
66 Ga0070673_100093897 3300005364 Bacteria 2458
67 Ga0070659_100001907 3300005366 Bacteria 14906
68 Ga0070659_100003359 3300005366 Bacteria 11387
69 Ga0070659_100004210 3300005366 Bacteria 10269
70 Ga0070659_100005537 3300005366 Bacteria 9074
71 Ga0070659_100202520 3300005366 Unclassified 1634
72 Ga0070659_100224861 3300005366 Bacteria 1550
73 Ga0070667_100000656 3300005367 Bacteria 33607
74 Ga0070667_100001032 3300005367 Bacteria 25440
75 Ga0070667_100021642 3300005367 Bacteria 5337
76 Ga0070667_100060400 3300005367 Bacteria 3207
77 Ga0070667_100127491 3300005367 Bacteria 2219
78 Ga0070667_100142938 3300005367 Bacteria 2097
79 Ga0070714_100214679 3300005435 Bacteria 1765
80 Ga0070694_100001501 3300005444 Bacteria 13691
81 Ga0070662_100000035 3300005457 Bacteria 77342
82 Ga0070662_100003041 3300005457 Bacteria 10419
83 Ga0070662_100036066 3300005457 Bacteria 3496
84 Ga0070662_100058841 3300005457 Bacteria 2798
85 Ga0070662_100183115 3300005457 Bacteria 1652
86 Ga0068867_100014324 3300005459 Bacteria 5617
87 Ga0070679_100081785 3300005530 Bacteria 3219
88 Ga0070679_100157626 3300005530 Bacteria 2244
89 Ga0070684_100019167 3300005535 Bacteria 5657
90 Ga0070684_100100201 3300005535 Bacteria 2586
91 Ga0068853_100000409 3300005539 Bacteria 29517
92 Ga0068853_100023480 3300005539 Bacteria 5163
93 Ga0070672_100002538 3300005543 Bacteria 11635
94 Ga0070672_100037474 3300005543 Bacteria 3700
95 Ga0070672_100055308 3300005543 Bacteria 3109
96 Ga0070672_100108509 3300005543 Bacteria 2260
97 Ga0070693_100000322 3300005547 Bacteria 22033
98 Ga0070693_100055289 3300005547 Bacteria 2286
99 Ga0070665_100011012 3300005548 Bacteria 9141
100 Ga0070665_100086659 3300005548 Bacteria 3137
101 Ga0070665_100105260 3300005548 Bacteria 2823
102 Ga0068855_100001487 3300005563 Bacteria 29322
103 Ga0068855_100194557 3300005563 Bacteria 2285
104 Ga0070664_100000025 3300005564 Bacteria 93173
105 Ga0070664_100006560 3300005564 Bacteria 9386
106 Ga0070664_100146084 3300005564 Bacteria 2086
107 Ga0068857_100002400 3300005577 Bacteria 15273
108 Ga0068857_100026484 3300005577 Bacteria 5112
109 Ga0068857_100043097 3300005577 Bacteria 4003
110 Ga0068854_100002567 3300005578 Bacteria 11244
111 Ga0068854_100029092 3300005578 Bacteria 3822
112 Ga0068856_100000219 3300005614 Bacteria 61699
113 Ga0068856_100238067 3300005614 Bacteria 1836
114 Ga0068852_100003830 3300005616 Bacteria 10562
115 Ga0068852_100017294 3300005616 Bacteria 5653
116 Ga0068852_100017902 3300005616 Bacteria 5570
117 Ga0068852_100457529 3300005616 Unclassified 1264
118 Ga0068859_100489565 3300005617 Bacteria 1325
119 Ga0068864_100002309 3300005618 Bacteria 15778
120 Ga0068864_100012083 3300005618 Bacteria 7132
121 Ga0068864_100014582 3300005618 Bacteria 6529
122 Ga0068864_100033685 3300005618 Bacteria 4356
123 Ga0068851_10053322 3300005834 Bacteria 2059
124 Ga0068851_10076561 3300005834 Bacteria 1740
125 Ga0068870_10156878 3300005840 Bacteria 1346
126 Ga0068863_100034494 3300005841 Unclassified 4820
127 Ga0068863_100094015 3300005841 Bacteria 2845
128 Ga0068858_100005341 3300005842 Bacteria 12606
129 Ga0068858_100010680 3300005842 Bacteria 8686
130 Ga0068858_100018219 3300005842 Bacteria 6575
131 Ga0068860_100000894 3300005843 Bacteria 33104
132 Ga0068860_100002325 3300005843 Bacteria 19958
133 Ga0068860_100172304 3300005843 Unclassified 2091
134 Ga0068862_100018881 3300005844 Bacteria 5745
135 Ga0097621_100002777 3300006237 Bacteria 11982
136 Ga0097621_100021718 3300006237 Bacteria 4971
137 Ga0097621_100132156 3300006237 Unclassified 2126
138 Ga0068871_100002519 3300006358 Bacteria 12491
139 Ga0068871_100045287 3300006358 Bacteria 3540
140 Ga0068871_100072577 3300006358 Bacteria 2835
141 Ga0068865_100113483 3300006881 Bacteria 2003
142 Ga0097620_100489588 3300006931 Bacteria 1325
143 Ga0105240_10079641 3300009093 Bacteria 4031
144 Ga0105245_10068290 3300009098 Bacteria 3221
145 Ga0105241_10079257 3300009174 Bacteria 2568
146 Ga0105248_10000163 3300009177 Bacteria 77658
147 Ga0105248_10001099 3300009177 Bacteria 29952
148 Ga0105248_10015396 3300009177 Bacteria 8435
149 Ga0105248_10138957 3300009177 Bacteria 2740
150 Ga0105248_10452280 3300009177 Bacteria 1447
151 Ga0105237_10061054 3300009545 Bacteria 3770
152 Ga0105238_10056727 3300009551 Bacteria 3928
153 Ga0105238_10100462 3300009551 Bacteria 2876
154 Ga0105238_10196678 3300009551 Bacteria 1992
155 Ga0105249_10018403 3300009553 Bacteria 6214
156 Ga0157373_10007399 3300013100 Bacteria 8167
157 Ga0157371_10161790 3300013102 Bacteria 1599
158 Ga0157371_10180218 3300013102 Bacteria 1511
159 Ga0157371_10197313 3300013102 Bacteria 1442
160 Ga0157370_10111257 3300013104 Bacteria 2560
161 Ga0157374_10008320 3300013296 Bacteria 8854
162 Ga0157378_10055710 3300013297 Bacteria 3522
163 Ga0163162_10198528 3300013306 Bacteria 2135
164 Ga0157372_10227099 3300013307 Bacteria 2164
165 Ga0157375_10021468 3300013308 Bacteria 5922
166 Ga0163163_10072407 3300014325 Bacteria 3435
167 Ga0157377_10048150 3300014745 Bacteria 2390
168 Ga0163161_10117479 3300017792 Bacteria 1995
169 Ga0207666_1010178 3300025271 Unclassified 1283
170 Ga0207697_10001976 3300025315 Bacteria 10865
171 Ga0207682_10000595 3300025893 Bacteria 16781
172 Ga0207682_10046375 3300025893 Bacteria 1786
173 Ga0207688_10005020 3300025901 Bacteria 7194
174 Ga0207680_10000613 3300025903 Bacteria 16839
175 Ga0207680_10003132 3300025903 Bacteria 7764
176 Ga0207680_10003266 3300025903 Bacteria 7637
177 Ga0207680_10076341 3300025903 Bacteria 2092
178 Ga0207647_10000437 3300025904 Bacteria 34055
179 Ga0207647_10018073 3300025904 Bacteria 4779
180 Ga0207647_10036378 3300025904 Bacteria 3128
181 Ga0207647_10038544 3300025904 Bacteria 3020
182 Ga0207645_10011199 3300025907 Bacteria 6135
183 Ga0207645_10055428 3300025907 Bacteria 2531
184 Ga0207705_10000114 3300025909 Bacteria 90132
185 Ga0207705_10008203 3300025909 Bacteria 7641
186 Ga0207705_10014651 3300025909 Bacteria 5641
187 Ga0207705_10017165 3300025909 Bacteria 5184
188 Ga0207705_10045110 3300025909 Bacteria 3168
189 Ga0207705_10049832 3300025909 Bacteria 3014
190 Ga0207705_10097454 3300025909 Bacteria 2160
191 Ga0207707_10335875 3300025912 Unclassified 1303
192 Ga0207693_10027883 3300025915 Bacteria 4464
193 Ga0207657_10000071 3300025919 Bacteria 93725
194 Ga0207657_10005161 3300025919 Bacteria 13700
195 Ga0207657_10036880 3300025919 Bacteria 4373
196 Ga0207657_10058047 3300025919 Bacteria 3332
197 Ga0207649_10000436 3300025920 Bacteria 30088
198 Ga0207649_10030719 3300025920 Bacteria 3185
199 Ga0207652_10009779 3300025921 Bacteria 7719
200 Ga0207681_10027495 3300025923 Bacteria 3678
201 Ga0207681_10030919 3300025923 Bacteria 3494
202 Ga0207681_10110208 3300025923 Bacteria 2001
203 Ga0207681_10165134 3300025923 Bacteria 1673
204 Ga0207681_10301740 3300025923 Unclassified 1267
205 Ga0207694_10020241 3300025924 Bacteria 5031
206 Ga0207694_10063275 3300025924 Bacteria 2882
207 Ga0207650_10007351 3300025925 Bacteria 7500
208 Ga0207650_10009277 3300025925 Bacteria 6722
209 Ga0207650_10049407 3300025925 Bacteria 3106
210 Ga0207659_10001918 3300025926 Bacteria 12330
211 Ga0207687_10024633 3300025927 Bacteria 4023
212 Ga0207644_10000522 3300025931 Bacteria 24894
213 Ga0207644_10000979 3300025931 Bacteria 18243
214 Ga0207644_10001463 3300025931 Bacteria 15217
215 Ga0207644_10011310 3300025931 Bacteria 5902
216 Ga0207644_10060229 3300025931 Bacteria 2747
217 Ga0207690_10000045 3300025932 Bacteria 116965
218 Ga0207690_10002056 3300025932 Bacteria 12329
219 Ga0207690_10003663 3300025932 Bacteria 9146
220 Ga0207690_10012275 3300025932 Bacteria 5127
221 Ga0207690_10025056 3300025932 Bacteria 3742
222 Ga0207690_10180870 3300025932 Bacteria 1588
223 Ga0207706_10000086 3300025933 Bacteria 95284
224 Ga0207706_10004924 3300025933 Bacteria 12484
225 Ga0207706_10005104 3300025933 Bacteria 12257
226 Ga0207706_10013195 3300025933 Bacteria 7517
227 Ga0207706_10018313 3300025933 Bacteria 6302
228 Ga0207706_10057351 3300025933 Bacteria 3431
229 Ga0207669_10002484 3300025937 Bacteria 7865
230 Ga0207669_10007008 3300025937 Bacteria 5185
231 Ga0207669_10040258 3300025937 Bacteria 2709
232 Ga0207704_10037254 3300025938 Bacteria 2808
233 Ga0207691_10000693 3300025940 Bacteria 33328
234 Ga0207691_10001381 3300025940 Bacteria 24252
235 Ga0207691_10005551 3300025940 Bacteria 12183
236 Ga0207691_10012926 3300025940 Bacteria 7994
237 Ga0207691_10015217 3300025940 Bacteria 7319
238 Ga0207711_10001105 3300025941 Bacteria 25760
239 Ga0207711_10002330 3300025941 Bacteria 17013
240 Ga0207711_10007875 3300025941 Bacteria 8913
241 Ga0207711_10035036 3300025941 Bacteria 4253
242 Ga0207711_10122427 3300025941 Bacteria 2324
243 Ga0207689_10074486 3300025942 Unclassified 2789
244 Ga0207679_10000315 3300025945 Bacteria 36328
245 Ga0207679_10028278 3300025945 Bacteria 3887
246 Ga0207679_10067007 3300025945 Bacteria 2692
247 Ga0207679_10138954 3300025945 Bacteria 1961
248 Ga0207679_10185753 3300025945 Bacteria 1723
249 Ga0207667_10001152 3300025949 Bacteria 33245
250 Ga0207667_10002705 3300025949 Bacteria 21934
251 Ga0207667_10057696 3300025949 Bacteria 4074
252 Ga0207667_10271097 3300025949 Bacteria 1735
253 Ga0207651_10003015 3300025960 Bacteria 8158
254 Ga0207651_10010591 3300025960 Bacteria 5118
255 Ga0207651_10026534 3300025960 Bacteria 3621
256 Ga0207651_10185069 3300025960 Unclassified 1656
257 Ga0207712_10004214 3300025961 Bacteria 9075
258 Ga0207712_10055727 3300025961 Bacteria 2782
259 Ga0207668_10000021 3300025972 Bacteria 137592
260 Ga0207668_10072908 3300025972 Bacteria 2459
261 Ga0207668_10106443 3300025972 Unclassified 2095
262 Ga0207640_10007769 3300025981 Bacteria 5922
263 Ga0207640_10277149 3300025981 Unclassified 1315
264 Ga0207658_10005047 3300025986 Bacteria 9087
265 Ga0207658_10005841 3300025986 Bacteria 8417
266 Ga0207658_10009792 3300025986 Bacteria 6507
267 Ga0207658_10019436 3300025986 Bacteria 4698
268 Ga0207658_10057133 3300025986 Bacteria 2898
269 Ga0207658_10115255 3300025986 Bacteria 2132
270 Ga0207677_10001769 3300026023 Bacteria 11421
271 Ga0207703_10002359 3300026035 Bacteria 16434
272 Ga0207639_10000330 3300026041 Bacteria 32864
273 Ga0207639_10042460 3300026041 Bacteria 3408
274 Ga0207678_10000311 3300026067 Bacteria 43860
275 Ga0207678_10002415 3300026067 Bacteria 16979
276 Ga0207678_10041259 3300026067 Bacteria 4001
277 Ga0207678_10112012 3300026067 Bacteria 2328
278 Ga0207708_10050922 3300026075 Bacteria 3152
279 Ga0207702_10005053 3300026078 Bacteria 11584
280 Ga0207702_10009212 3300026078 Bacteria 8301
281 Ga0207641_10089198 3300026088 Unclassified 2694
282 Ga0207641_10136672 3300026088 Unclassified 2207
283 Ga0207641_10140075 3300026088 Bacteria 2181
284 Ga0207648_10013730 3300026089 Bacteria 7520
285 Ga0207676_10002624 3300026095 Bacteria 12817
286 Ga0207676_10045484 3300026095 Bacteria 3392
287 Ga0207676_10058406 3300026095 Bacteria 3043
288 Ga0207676_10195307 3300026095 Bacteria 1784
289 Ga0207674_10005725 3300026116 Bacteria 14735
290 Ga0207674_10028203 3300026116 Bacteria 5929
291 Ga0207674_10061992 3300026116 Bacteria 3777
292 Ga0207674_10119959 3300026116 Bacteria 2598
293 Ga0207674_10151260 3300026116 Bacteria 2278
294 Ga0207674_10174230 3300026116 Bacteria 2104
295 Ga0207674_10216197 3300026116 Bacteria 1865
296 Ga0207683_10014939 3300026121 Bacteria 6609
297 Ga0207698_10017200 3300026142 Bacteria 4899
298 Ga0207698_10019392 3300026142 Bacteria 4655
299 Ga0207698_10036427 3300026142 Bacteria 3611
300 Ga0268266_10027052 3300028379 Bacteria 4880
301 Ga0268266_10084105 3300028379 Bacteria 2778
302 Ga0268266_10130461 3300028379 Bacteria 2247
303 Ga0268265_10000789 3300028380 Bacteria 30232
304 Ga0268265_10014777 3300028380 Bacteria 5327
305 Ga0268264_10002322 3300028381 Bacteria 16822
306 Ga0268264_10002882 3300028381 Bacteria 14960
307 Ga0307406_10098153 3300031901 Bacteria 1988
308 Ga0307412_10033074 3300031911 Bacteria 3283
309 Ga0307409_100010609 3300031995 Bacteria 5742
310 Ga0307414_10030304 3300032004 Bacteria 3532
311 Ga0307414_10162595 3300032004 Bacteria 1775
312 Ga0307411_10036647 3300032005 Bacteria 3075
313 Ga0307411_10046172 3300032005 Bacteria 2806
314 Ga0307415_100125022 3300032126 Bacteria 1936
315 Ga0373931_0006874 3300035691 Bacteria 5348
316 Ga0395899_0003424 3300037312 Bacteria 12584
317 Ga0395899_0004210 3300037312 Bacteria 11284
318 Ga0395899_0023950 3300037312 Bacteria 4619
319 Ga0395899_0092498 3300037312 Bacteria 2190
320 Ga0395899_0115012 3300037312 Bacteria 1931
321 Ga0395899_0119800 3300037312 Bacteria 1886
322 Ga0395899_0169005 3300037312 Bacteria 1541
323 Ga0395900_0001148 3300037418 Bacteria 33301
324 Ga0395900_0002008 3300037418 Bacteria 22966
325 Ga0395900_0030322 3300037418 Bacteria 5552
326 Ga0395900_0084611 3300037418 Unclassified 3259
327 Ga0395900_0231733 3300037418 Bacteria 1857
328 Ga0395898_0005750 3300037466 Bacteria 13345
329 Ga0395898_0049293 3300037466 Bacteria 4126
330 Ga0395898_0080073 3300037466 Bacteria 3150
331 Ga0395898_0164807 3300037466 Bacteria 2120
332 Ga0395898_0216584 3300037466 Bacteria 1826
333 Ga0395905_0000218 3300037471 Bacteria 87745
334 Ga0395905_0000649 3300037471 Bacteria 46291
335 Ga0395905_0005809 3300037471 Bacteria 12536
336 Ga0395905_0010977 3300037471 Bacteria 8766
337 Ga0395905_0017839 3300037471 Bacteria 6743
338 Ga0395905_0075792 3300037471 Bacteria 3152
339 Ga0395905_0080161 3300037471 Bacteria 3059
340 Ga0395905_0089074 3300037471 Bacteria 2892
341 Ga0395905_0193456 3300037471 Bacteria 1907
342 Ga0395905_0306473 3300037471 Bacteria 1476
343 Ga0395905_0465744 3300037471 Bacteria 1162
344 Ga0395905_0565355 3300037471 Bacteria 1038
345 Ga0395901_0000386 3300038443 Bacteria 52804
346 Ga0395901_0002884 3300038443 Bacteria 17345
347 Ga0395901_0010511 3300038443 Bacteria 9374
348 Ga0395901_0021759 3300038443 Bacteria 6570
349 Ga0395901_0081615 3300038443 Bacteria 3377
350 Ga0395901_0118341 3300038443 Bacteria 2783
351 Ga0395901_0162040 3300038443 Bacteria 2349
352 Ga0436365_1352252 3300039437 Bacteria 6516
353 Ga0439458_0000231 3300042157 Bacteria 13292
354 Ga0466966_0134915 3300044684 Unclassified 1510
355 Ga0466961_0023370 3300044693 Bacteria 3977
356 Ga0466963_0006532 3300044694 Bacteria 6906
357 Ga0466963_0083877 3300044694 Bacteria 2161
358 Ga0466964_0028326 3300044706 Bacteria 2206
359 Ga0466971_0001516 3300044719 Bacteria 9787
360 Ga0466957_0018293 3300044842 Bacteria 4114
361 Ga0466959_0037352 3300045049 Bacteria 3588
362 Ga0466958_0002509 3300045836 Bacteria 9251
363 Ga0466958_0030393 3300045836 Bacteria 3208
364 Ga0466967_0009635 3300045976 Bacteria 7180
365 Ga0466967_0037420 3300045976 Bacteria 4153
366 Ga0466967_0135211 3300045976 Bacteria 2292
367 Ga0466967_0165305 3300045976 Bacteria 2079
368 Ga0495598_0001112 3300046537 Bacteria 5165
369 Ga0495621_0000848 3300046539 Bacteria 7788
370 Ga0495669_0011759 3300046684 Bacteria 3721
371 Ga0495669_0011762 3300046684 Bacteria 3720
372 Ga0495669_0146621 3300046684 Bacteria 1116
373 Ga0495670_0010641 3300046691 Bacteria 4521
374 Ga0496102_0092565 3300048905 Bacteria 2800
375 Ga0496108_0010568 3300048911 Bacteria 7494
376 Ga0496109_0007994 3300048912 Bacteria 8967
377 Ga0496109_0012282 3300048912 Bacteria 7393
378 Ga0496109_0134631 3300048912 Bacteria 2308
379 Ga0496110_0003540 3300048913 Bacteria 11995
380 Ga0496110_0028970 3300048913 Bacteria 4760
381 Ga0496111_0006338 3300048914 Bacteria 7671
382 Ga0496111_0028031 3300048914 Bacteria 3990
383 Ga0496112_0018680 3300048915 Bacteria 6534
384 Ga0496112_0037353 3300048915 Bacteria 4741
385 Ga0496113_0078047 3300048916 Bacteria 2533
386 Ga0496114_0316190 3300048917 Bacteria 1379
387 Ga0496115_0001289 3300048918 Bacteria 17904
388 Ga0501069_0030283 3300049585 Bacteria 2972
389 Ga0501069_0119304 3300049585 Bacteria 1506
390 Ga0501080_0070040 3300049742 Bacteria 3262
391 nmdc:mga08y16_118510_c1 3300050511 Bacteria 2755
392 nmdc:mga0a205_7080_c1 3300050515 Bacteria 10131
393 Ga0466962_0002209 3300061719 Bacteria 9197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046539 Ga0495621_0000848 Ga0495621_0000848_4377_5429 318
2 3300037466 Ga0395898_0216584 Ga0395898_0216584_32_1012 326
3 3300037471 Ga0395905_0465744 Ga0395905_0465744_27_1007 326
4 3300037471 Ga0395905_0565355 Ga0395905_0565355_30_1010 326
5 3300049742 Ga0501080_0070040 Ga0501080_0070040_70_1050 326
6 3300045836 Ga0466958_0030393 Ga0466958_0030393_2080_3144 328
7 3300045976 Ga0466967_0009635 Ga0466967_0009635_4330_5394 328
8 3300005841 Ga0068863_100034494 Ga0068863_1000344942 330
9 3300026088 Ga0207641_10089198 Ga0207641_100891982 330
10 3300046537 Ga0495598_0001112 Ga0495598_0001112_1605_2657 332
11 3300046684 Ga0495669_0011759 Ga0495669_0011759_547_1599 332
12 3300046691 Ga0495670_0010641 Ga0495670_0010641_1543_2595 332
13 3300006237 Ga0097621_100132156 Ga0097621_1001321562 339
14 3300006358 Ga0068871_100072577 Ga0068871_1000725772 339
15 3300037312 Ga0395899_0169005 Ga0395899_0169005_429_1472 342
16 3300005328 Ga0070676_10020752 Ga0070676_100207523 343
17 3300005328 Ga0070676_10035613 Ga0070676_100356133 343
18 3300005328 Ga0070676_10052878 Ga0070676_100528781 343
19 3300005330 Ga0070690_100002718 Ga0070690_1000027187 343
20 3300005335 Ga0070666_10000342 Ga0070666_100003423 343
21 3300005338 Ga0068868_100002310 Ga0068868_10000231014 343
22 3300005338 Ga0068868_100002494 Ga0068868_1000024948 343
23 3300005338 Ga0068868_100140375 Ga0068868_1001403752 343
24 3300005347 Ga0070668_100018349 Ga0070668_1000183497 343
25 3300005353 Ga0070669_100031918 Ga0070669_1000319183 343
26 3300005353 Ga0070669_100206768 Ga0070669_1002067682 343
27 3300005355 Ga0070671_100107612 Ga0070671_1001076122 343
28 3300005356 Ga0070674_100005255 Ga0070674_1000052552 343
29 3300005356 Ga0070674_100030212 Ga0070674_1000302123 343
30 3300005364 Ga0070673_100007550 Ga0070673_1000075507 343
31 3300005364 Ga0070673_100065928 Ga0070673_1000659282 343
32 3300005367 Ga0070667_100000656 Ga0070667_1000006568 343
33 3300005367 Ga0070667_100060400 Ga0070667_1000604002 343
34 3300005367 Ga0070667_100127491 Ga0070667_1001274912 343
35 3300005459 Ga0068867_100014324 Ga0068867_1000143242 343
36 3300005543 Ga0070672_100108509 Ga0070672_1001085092 343
37 3300005547 Ga0070693_100055289 Ga0070693_1000552893 343
38 3300005548 Ga0070665_100105260 Ga0070665_1001052602 343
39 3300005616 Ga0068852_100017902 Ga0068852_1000179027 343
40 3300005842 Ga0068858_100018219 Ga0068858_1000182197 343
41 3300005843 Ga0068860_100002325 Ga0068860_10000232510 343
42 3300005844 Ga0068862_100018881 Ga0068862_1000188812 343
43 3300006358 Ga0068871_100045287 Ga0068871_1000452872 343
44 3300006881 Ga0068865_100113483 Ga0068865_1001134832 343
45 3300009098 Ga0105245_10068290 Ga0105245_100682903 343
46 3300009177 Ga0105248_10001099 Ga0105248_100010998 343
47 3300013100 Ga0157373_10007399 Ga0157373_100073997 343
48 3300013297 Ga0157378_10055710 Ga0157378_100557102 343
49 3300013308 Ga0157375_10021468 Ga0157375_100214684 343
50 3300025901 Ga0207688_10005020 Ga0207688_100050207 343
51 3300025903 Ga0207680_10003132 Ga0207680_100031324 343
52 3300025907 Ga0207645_10011199 Ga0207645_100111993 343
53 3300025907 Ga0207645_10055428 Ga0207645_100554282 343
54 3300025923 Ga0207681_10030919 Ga0207681_100309192 343
55 3300025927 Ga0207687_10024633 Ga0207687_100246334 343
56 3300025931 Ga0207644_10011310 Ga0207644_100113103 343
57 3300025937 Ga0207669_10007008 Ga0207669_100070083 343
58 3300025937 Ga0207669_10040258 Ga0207669_100402582 343
59 3300025938 Ga0207704_10037254 Ga0207704_100372542 343
60 3300025940 Ga0207691_10015217 Ga0207691_100152179 343
61 3300025941 Ga0207711_10001105 Ga0207711_1000110526 343
62 3300025960 Ga0207651_10026534 Ga0207651_100265342 343
63 3300025960 Ga0207651_10185069 Ga0207651_101850692 343
64 3300025972 Ga0207668_10000021 Ga0207668_1000002179 343
65 3300025986 Ga0207658_10005047 Ga0207658_100050473 343
66 3300025986 Ga0207658_10009792 Ga0207658_100097924 343
67 3300025986 Ga0207658_10057133 Ga0207658_100571333 343
68 3300026023 Ga0207677_10001769 Ga0207677_100017698 343
69 3300026088 Ga0207641_10136672 Ga0207641_101366722 343
70 3300026089 Ga0207648_10013730 Ga0207648_100137309 343
71 3300028380 Ga0268265_10000789 Ga0268265_1000078926 343
72 3300028381 Ga0268264_10002322 Ga0268264_1000232210 343
73 3300031995 Ga0307409_100010609 Ga0307409_1000106096 343
74 3300032004 Ga0307414_10162595 Ga0307414_101625952 343
75 3300037312 Ga0395899_0023950 Ga0395899_0023950_1542_2588 343
76 3300037471 Ga0395905_0010977 Ga0395905_0010977_4368_5414 343
77 3300038443 Ga0395901_0162040 Ga0395901_0162040_601_1647 343
78 3300005366 Ga0070659_100003359 Ga0070659_10000335911 344
79 3300025932 Ga0207690_10025056 Ga0207690_100250563 344
80 3300005577 Ga0068857_100026484 Ga0068857_1000264843 348
81 3300026116 Ga0207674_10119959 Ga0207674_101199592 348
82 3300032005 Ga0307411_10046172 Ga0307411_100461722 348
83 3300046684 Ga0495669_0146621 Ga0495669_0146621_36_1097 348
84 2162886012 MBSR1b_contig_5610527 MBSR1b_0309.00000540 349
85 3300001979 JGI24740J21852_10012062 JGI24740J21852_100120622 349
86 3300001989 JGI24739J22299_10001795 JGI24739J22299_100017955 349
87 3300001990 JGI24737J22298_10000691 JGI24737J22298_100006913 349
88 3300001990 JGI24737J22298_10003908 JGI24737J22298_100039082 349
89 3300002075 JGI24738J21930_10000237 JGI24738J21930_1000023710 349
90 3300005290 Ga0065712_10074837 Ga0065712_100748372 349
91 3300005293 Ga0065715_10171461 Ga0065715_101714612 349
92 3300005295 Ga0065707_10023858 Ga0065707_100238582 349
93 3300005327 Ga0070658_10000205 Ga0070658_1000020510 349
94 3300005327 Ga0070658_10091211 Ga0070658_100912112 349
95 3300005327 Ga0070658_10103027 Ga0070658_101030272 349
96 3300005329 Ga0070683_100004542 Ga0070683_1000045428 349
97 3300005329 Ga0070683_100112308 Ga0070683_1001123082 349
98 3300005329 Ga0070683_100375230 Ga0070683_1003752301 349
99 3300005331 Ga0070670_100024466 Ga0070670_1000244663 349
100 3300005331 Ga0070670_100031301 Ga0070670_1000313012 349
101 3300005331 Ga0070670_100109232 Ga0070670_1001092323 349
102 3300005331 Ga0070670_100151454 Ga0070670_1001514542 349
103 3300005333 Ga0070677_10000275 Ga0070677_100002754 349
104 3300005333 Ga0070677_10034230 Ga0070677_100342301 349
105 3300005333 Ga0070677_10046145 Ga0070677_100461451 349
106 3300005335 Ga0070666_10000168 Ga0070666_1000016821 349
107 3300005336 Ga0070680_100006388 Ga0070680_1000063889 349
108 3300005336 Ga0070680_100177055 Ga0070680_1001770552 349
109 3300005337 Ga0070682_100086985 Ga0070682_1000869852 349
110 3300005338 Ga0068868_100278887 Ga0068868_1002788872 349
111 3300005338 Ga0068868_100368868 Ga0068868_1003688681 349
112 3300005339 Ga0070660_100000009 Ga0070660_10000000927 349
113 3300005339 Ga0070660_100025786 Ga0070660_1000257863 349
114 3300005339 Ga0070660_100031651 Ga0070660_1000316513 349
115 3300005341 Ga0070691_10000966 Ga0070691_100009664 349
116 3300005344 Ga0070661_100000100 Ga0070661_10000010027 349
117 3300005344 Ga0070661_100050543 Ga0070661_1000505432 349
118 3300005344 Ga0070661_100240965 Ga0070661_1002409651 349
119 3300005345 Ga0070692_10006317 Ga0070692_100063172 349
120 3300005353 Ga0070669_100142308 Ga0070669_1001423082 349
121 3300005354 Ga0070675_100016371 Ga0070675_1000163715 349
122 3300005355 Ga0070671_100002442 Ga0070671_10000244213 349
123 3300005355 Ga0070671_100004212 Ga0070671_10000421212 349
124 3300005355 Ga0070671_100007800 Ga0070671_1000078007 349
125 3300005355 Ga0070671_100028136 Ga0070671_1000281365 349
126 3300005355 Ga0070671_100079826 Ga0070671_1000798262 349
127 3300005356 Ga0070674_100005341 Ga0070674_1000053418 349
128 3300005356 Ga0070674_100060006 Ga0070674_1000600062 349
129 3300005356 Ga0070674_100078403 Ga0070674_1000784032 349
130 3300005356 Ga0070674_100155499 Ga0070674_1001554992 349
131 3300005356 Ga0070674_100208944 Ga0070674_1002089442 349
132 3300005364 Ga0070673_100023337 Ga0070673_1000233376 349
133 3300005364 Ga0070673_100093897 Ga0070673_1000938972 349
134 3300005366 Ga0070659_100001907 Ga0070659_10000190710 349
135 3300005366 Ga0070659_100004210 Ga0070659_1000042107 349
136 3300005366 Ga0070659_100005537 Ga0070659_1000055374 349
137 3300005366 Ga0070659_100202520 Ga0070659_1002025202 349
138 3300005366 Ga0070659_100224861 Ga0070659_1002248612 349
139 3300005367 Ga0070667_100001032 Ga0070667_10000103218 349
140 3300005367 Ga0070667_100021642 Ga0070667_1000216425 349
141 3300005367 Ga0070667_100142938 Ga0070667_1001429382 349
142 3300005435 Ga0070714_100214679 Ga0070714_1002146792 349
143 3300005444 Ga0070694_100001501 Ga0070694_1000015012 349
144 3300005457 Ga0070662_100000035 Ga0070662_10000003518 349
145 3300005457 Ga0070662_100003041 Ga0070662_1000030416 349
146 3300005457 Ga0070662_100036066 Ga0070662_1000360662 349
147 3300005457 Ga0070662_100058841 Ga0070662_1000588412 349
148 3300005457 Ga0070662_100183115 Ga0070662_1001831152 349
149 3300005530 Ga0070679_100081785 Ga0070679_1000817853 349
150 3300005530 Ga0070679_100157626 Ga0070679_1001576263 349
151 3300005535 Ga0070684_100019167 Ga0070684_1000191672 349
152 3300005535 Ga0070684_100100201 Ga0070684_1001002013 349
153 3300005539 Ga0068853_100000409 Ga0068853_1000004094 349
154 3300005539 Ga0068853_100023480 Ga0068853_1000234804 349
155 3300005543 Ga0070672_100002538 Ga0070672_1000025384 349
156 3300005543 Ga0070672_100037474 Ga0070672_1000374742 349
157 3300005543 Ga0070672_100055308 Ga0070672_1000553083 349
158 3300005547 Ga0070693_100000322 Ga0070693_1000003222 349
159 3300005548 Ga0070665_100011012 Ga0070665_1000110126 349
160 3300005548 Ga0070665_100086659 Ga0070665_1000866593 349
161 3300005563 Ga0068855_100001487 Ga0068855_10000148727 349
162 3300005563 Ga0068855_100194557 Ga0068855_1001945572 349
163 3300005564 Ga0070664_100000025 Ga0070664_10000002576 349
164 3300005564 Ga0070664_100006560 Ga0070664_1000065609 349
165 3300005564 Ga0070664_100146084 Ga0070664_1001460842 349
166 3300005577 Ga0068857_100002400 Ga0068857_1000024004 349
167 3300005577 Ga0068857_100043097 Ga0068857_1000430972 349
168 3300005578 Ga0068854_100002567 Ga0068854_1000025679 349
169 3300005578 Ga0068854_100029092 Ga0068854_1000290922 349
170 3300005614 Ga0068856_100000219 Ga0068856_1000002194 349
171 3300005614 Ga0068856_100238067 Ga0068856_1002380672 349
172 3300005616 Ga0068852_100003830 Ga0068852_1000038305 349
173 3300005616 Ga0068852_100017294 Ga0068852_1000172943 349
174 3300005616 Ga0068852_100457529 Ga0068852_1004575291 349
175 3300005617 Ga0068859_100489565 Ga0068859_1004895652 349
176 3300005618 Ga0068864_100002309 Ga0068864_10000230914 349
177 3300005618 Ga0068864_100012083 Ga0068864_1000120838 349
178 3300005618 Ga0068864_100014582 Ga0068864_1000145822 349
179 3300005618 Ga0068864_100033685 Ga0068864_1000336854 349
180 3300005834 Ga0068851_10053322 Ga0068851_100533222 349
181 3300005834 Ga0068851_10076561 Ga0068851_100765612 349
182 3300005840 Ga0068870_10156878 Ga0068870_101568782 349
183 3300005841 Ga0068863_100094015 Ga0068863_1000940152 349
184 3300005842 Ga0068858_100005341 Ga0068858_1000053413 349
185 3300005842 Ga0068858_100010680 Ga0068858_1000106804 349
186 3300005843 Ga0068860_100000894 Ga0068860_1000008944 349
187 3300005843 Ga0068860_100172304 Ga0068860_1001723042 349
188 3300006237 Ga0097621_100002777 Ga0097621_1000027772 349
189 3300006237 Ga0097621_100021718 Ga0097621_1000217186 349
190 3300006358 Ga0068871_100002519 Ga0068871_1000025198 349
191 3300006931 Ga0097620_100489588 Ga0097620_1004895882 349
192 3300009093 Ga0105240_10079641 Ga0105240_100796414 349
193 3300009174 Ga0105241_10079257 Ga0105241_100792572 349
194 3300009177 Ga0105248_10000163 Ga0105248_1000016327 349
195 3300009177 Ga0105248_10015396 Ga0105248_1001539610 349
196 3300009177 Ga0105248_10138957 Ga0105248_101389572 349
197 3300009177 Ga0105248_10452280 Ga0105248_104522802 349
198 3300009545 Ga0105237_10061054 Ga0105237_100610543 349
199 3300009551 Ga0105238_10056727 Ga0105238_100567274 349
200 3300009551 Ga0105238_10100462 Ga0105238_101004622 349
201 3300009551 Ga0105238_10196678 Ga0105238_101966782 349
202 3300009553 Ga0105249_10018403 Ga0105249_100184034 349
203 3300013102 Ga0157371_10161790 Ga0157371_101617902 349
204 3300013102 Ga0157371_10180218 Ga0157371_101802182 349
205 3300013102 Ga0157371_10197313 Ga0157371_101973132 349
206 3300013104 Ga0157370_10111257 Ga0157370_101112572 349
207 3300013296 Ga0157374_10008320 Ga0157374_100083202 349
208 3300013306 Ga0163162_10198528 Ga0163162_101985282 349
209 3300013307 Ga0157372_10227099 Ga0157372_102270991 349
210 3300014325 Ga0163163_10072407 Ga0163163_100724072 349
211 3300014745 Ga0157377_10048150 Ga0157377_100481502 349
212 3300017792 Ga0163161_10117479 Ga0163161_101174792 349
213 3300025271 Ga0207666_1010178 Ga0207666_10101781 349
214 3300025315 Ga0207697_10001976 Ga0207697_100019769 349
215 3300025893 Ga0207682_10000595 Ga0207682_1000059512 349
216 3300025893 Ga0207682_10046375 Ga0207682_100463752 349
217 3300025903 Ga0207680_10000613 Ga0207680_100006137 349
218 3300025903 Ga0207680_10003266 Ga0207680_100032667 349
219 3300025903 Ga0207680_10076341 Ga0207680_100763412 349
220 3300025904 Ga0207647_10000437 Ga0207647_1000043729 349
221 3300025904 Ga0207647_10018073 Ga0207647_100180733 349
222 3300025904 Ga0207647_10036378 Ga0207647_100363782 349
223 3300025904 Ga0207647_10038544 Ga0207647_100385444 349
224 3300025909 Ga0207705_10000114 Ga0207705_1000011415 349
225 3300025909 Ga0207705_10008203 Ga0207705_100082036 349
226 3300025909 Ga0207705_10014651 Ga0207705_100146516 349
227 3300025909 Ga0207705_10017165 Ga0207705_100171655 349
228 3300025909 Ga0207705_10045110 Ga0207705_100451103 349
229 3300025909 Ga0207705_10049832 Ga0207705_100498322 349
230 3300025909 Ga0207705_10097454 Ga0207705_100974542 349
231 3300025912 Ga0207707_10335875 Ga0207707_103358752 349
232 3300025915 Ga0207693_10027883 Ga0207693_100278832 349
233 3300025919 Ga0207657_10000071 Ga0207657_1000007175 349
234 3300025919 Ga0207657_10005161 Ga0207657_100051613 349
235 3300025919 Ga0207657_10036880 Ga0207657_100368804 349
236 3300025919 Ga0207657_10058047 Ga0207657_100580472 349
237 3300025920 Ga0207649_10000436 Ga0207649_100004364 349
238 3300025920 Ga0207649_10030719 Ga0207649_100307192 349
239 3300025921 Ga0207652_10009779 Ga0207652_100097792 349
240 3300025923 Ga0207681_10027495 Ga0207681_100274954 349
241 3300025923 Ga0207681_10110208 Ga0207681_101102082 349
242 3300025923 Ga0207681_10165134 Ga0207681_101651342 349
243 3300025923 Ga0207681_10301740 Ga0207681_103017401 349
244 3300025924 Ga0207694_10020241 Ga0207694_100202414 349
245 3300025924 Ga0207694_10063275 Ga0207694_100632753 349
246 3300025925 Ga0207650_10007351 Ga0207650_100073513 349
247 3300025925 Ga0207650_10009277 Ga0207650_100092778 349
248 3300025925 Ga0207650_10049407 Ga0207650_100494072 349
249 3300025926 Ga0207659_10001918 Ga0207659_1000191813 349
250 3300025931 Ga0207644_10000522 Ga0207644_1000052214 349
251 3300025931 Ga0207644_10000979 Ga0207644_1000097913 349
252 3300025931 Ga0207644_10001463 Ga0207644_100014636 349
253 3300025931 Ga0207644_10060229 Ga0207644_100602293 349
254 3300025932 Ga0207690_10000045 Ga0207690_1000004526 349
255 3300025932 Ga0207690_10002056 Ga0207690_100020568 349
256 3300025932 Ga0207690_10003663 Ga0207690_100036635 349
257 3300025932 Ga0207690_10012275 Ga0207690_100122756 349
258 3300025932 Ga0207690_10180870 Ga0207690_101808702 349
259 3300025933 Ga0207706_10000086 Ga0207706_1000008627 349
260 3300025933 Ga0207706_10004924 Ga0207706_100049244 349
261 3300025933 Ga0207706_10005104 Ga0207706_100051044 349
262 3300025933 Ga0207706_10013195 Ga0207706_100131952 349
263 3300025933 Ga0207706_10018313 Ga0207706_100183132 349
264 3300025933 Ga0207706_10057351 Ga0207706_100573515 349
265 3300025937 Ga0207669_10002484 Ga0207669_100024849 349
266 3300025940 Ga0207691_10000693 Ga0207691_1000069316 349
267 3300025940 Ga0207691_10001381 Ga0207691_1000138117 349
268 3300025940 Ga0207691_10005551 Ga0207691_100055519 349
269 3300025940 Ga0207691_10012926 Ga0207691_100129262 349
270 3300025941 Ga0207711_10002330 Ga0207711_100023304 349
271 3300025941 Ga0207711_10007875 Ga0207711_100078752 349
272 3300025941 Ga0207711_10035036 Ga0207711_100350362 349
273 3300025941 Ga0207711_10122427 Ga0207711_101224272 349
274 3300025942 Ga0207689_10074486 Ga0207689_100744862 349
275 3300025945 Ga0207679_10000315 Ga0207679_1000031527 349
276 3300025945 Ga0207679_10028278 Ga0207679_100282785 349
277 3300025945 Ga0207679_10067007 Ga0207679_100670072 349
278 3300025945 Ga0207679_10138954 Ga0207679_101389542 349
279 3300025945 Ga0207679_10185753 Ga0207679_101857532 349
280 3300025949 Ga0207667_10001152 Ga0207667_1000115227 349
281 3300025949 Ga0207667_10002705 Ga0207667_1000270514 349
282 3300025949 Ga0207667_10057696 Ga0207667_100576962 349
283 3300025949 Ga0207667_10271097 Ga0207667_102710972 349
284 3300025960 Ga0207651_10003015 Ga0207651_100030158 349
285 3300025960 Ga0207651_10010591 Ga0207651_100105916 349
286 3300025961 Ga0207712_10004214 Ga0207712_1000421410 349
287 3300025961 Ga0207712_10055727 Ga0207712_100557272 349
288 3300025972 Ga0207668_10072908 Ga0207668_100729082 349
289 3300025972 Ga0207668_10106443 Ga0207668_101064432 349
290 3300025981 Ga0207640_10007769 Ga0207640_100077696 349
291 3300025981 Ga0207640_10277149 Ga0207640_102771492 349
292 3300025986 Ga0207658_10005841 Ga0207658_100058413 349
293 3300025986 Ga0207658_10019436 Ga0207658_100194364 349
294 3300025986 Ga0207658_10115255 Ga0207658_101152552 349
295 3300026035 Ga0207703_10002359 Ga0207703_1000235917 349
296 3300026041 Ga0207639_10000330 Ga0207639_1000033029 349
297 3300026041 Ga0207639_10042460 Ga0207639_100424602 349
298 3300026067 Ga0207678_10000311 Ga0207678_100003117 349
299 3300026067 Ga0207678_10002415 Ga0207678_100024152 349
300 3300026067 Ga0207678_10041259 Ga0207678_100412592 349
301 3300026067 Ga0207678_10112012 Ga0207678_101120122 349
302 3300026075 Ga0207708_10050922 Ga0207708_100509222 349
303 3300026078 Ga0207702_10005053 Ga0207702_1000505311 349
304 3300026078 Ga0207702_10009212 Ga0207702_100092129 349
305 3300026088 Ga0207641_10140075 Ga0207641_101400752 349
306 3300026095 Ga0207676_10002624 Ga0207676_100026248 349
307 3300026095 Ga0207676_10045484 Ga0207676_100454844 349
308 3300026095 Ga0207676_10058406 Ga0207676_100584062 349
309 3300026095 Ga0207676_10195307 Ga0207676_101953071 349
310 3300026116 Ga0207674_10005725 Ga0207674_100057259 349
311 3300026116 Ga0207674_10028203 Ga0207674_100282036 349
312 3300026116 Ga0207674_10061992 Ga0207674_100619925 349
313 3300026116 Ga0207674_10151260 Ga0207674_101512602 349
314 3300026116 Ga0207674_10174230 Ga0207674_101742302 349
315 3300026116 Ga0207674_10216197 Ga0207674_102161972 349
316 3300026121 Ga0207683_10014939 Ga0207683_100149393 349
317 3300026142 Ga0207698_10017200 Ga0207698_100172005 349
318 3300026142 Ga0207698_10019392 Ga0207698_100193925 349
319 3300026142 Ga0207698_10036427 Ga0207698_100364272 349
320 3300028379 Ga0268266_10027052 Ga0268266_100270525 349
321 3300028379 Ga0268266_10084105 Ga0268266_100841052 349
322 3300028379 Ga0268266_10130461 Ga0268266_101304612 349
323 3300028380 Ga0268265_10014777 Ga0268265_100147773 349
324 3300028381 Ga0268264_10002882 Ga0268264_100028829 349
325 3300031901 Ga0307406_10098153 Ga0307406_100981532 349
326 3300031911 Ga0307412_10033074 Ga0307412_100330744 349
327 3300032004 Ga0307414_10030304 Ga0307414_100303044 349
328 3300032005 Ga0307411_10036647 Ga0307411_100366472 349
329 3300032126 Ga0307415_100125022 Ga0307415_1001250222 349
330 3300035691 Ga0373931_0006874 Ga0373931_0006874_633_1697 349
331 3300037312 Ga0395899_0003424 Ga0395899_0003424_8320_9402 349
332 3300037312 Ga0395899_0004210 Ga0395899_0004210_8476_9540 349
333 3300037312 Ga0395899_0092498 Ga0395899_0092498_786_1871 349
334 3300037312 Ga0395899_0115012 Ga0395899_0115012_573_1637 349
335 3300037312 Ga0395899_0119800 Ga0395899_0119800_472_1536 349
336 3300037418 Ga0395900_0001148 Ga0395900_0001148_20269_21333 349
337 3300037418 Ga0395900_0002008 Ga0395900_0002008_2489_3574 349
338 3300037418 Ga0395900_0030322 Ga0395900_0030322_2330_3394 349
339 3300037418 Ga0395900_0084611 Ga0395900_0084611_38_1102 349
340 3300037418 Ga0395900_0231733 Ga0395900_0231733_326_1390 349
341 3300037466 Ga0395898_0005750 Ga0395898_0005750_9726_10805 349
342 3300037466 Ga0395898_0049293 Ga0395898_0049293_2738_3802 349
343 3300037466 Ga0395898_0080073 Ga0395898_0080073_1845_2909 349
344 3300037466 Ga0395898_0164807 Ga0395898_0164807_666_1730 349
345 3300037471 Ga0395905_0000218 Ga0395905_0000218_10580_11665 349
346 3300037471 Ga0395905_0000649 Ga0395905_0000649_23034_24098 349
347 3300037471 Ga0395905_0005809 Ga0395905_0005809_8137_9219 349
348 3300037471 Ga0395905_0017839 Ga0395905_0017839_3966_5030 349
349 3300037471 Ga0395905_0075792 Ga0395905_0075792_1846_2910 349
350 3300037471 Ga0395905_0080161 Ga0395905_0080161_717_1781 349
351 3300037471 Ga0395905_0089074 Ga0395905_0089074_1072_2136 349
352 3300037471 Ga0395905_0193456 Ga0395905_0193456_166_1230 349
353 3300037471 Ga0395905_0306473 Ga0395905_0306473_329_1378 349
354 3300038443 Ga0395901_0000386 Ga0395901_0000386_1627_2706 349
355 3300038443 Ga0395901_0002884 Ga0395901_0002884_9213_10298 349
356 3300038443 Ga0395901_0010511 Ga0395901_0010511_718_1782 349
357 3300038443 Ga0395901_0021759 Ga0395901_0021759_2953_4017 349
358 3300038443 Ga0395901_0081615 Ga0395901_0081615_206_1270 349
359 3300038443 Ga0395901_0118341 Ga0395901_0118341_970_2034 349
360 3300039437 Ga0436365_1352252 Ga0436365_1352252_1502_2566 349
361 3300042157 Ga0439458_0000231 Ga0439458_0000231_10893_11957 349
362 3300044684 Ga0466966_0134915 Ga0466966_0134915_78_1142 349
363 3300044693 Ga0466961_0023370 Ga0466961_0023370_406_1470 349
364 3300044694 Ga0466963_0006532 Ga0466963_0006532_2608_3672 349
365 3300044694 Ga0466963_0083877 Ga0466963_0083877_426_1490 349
366 3300044706 Ga0466964_0028326 Ga0466964_0028326_277_1341 349
367 3300044719 Ga0466971_0001516 Ga0466971_0001516_2698_3762 349
368 3300044842 Ga0466957_0018293 Ga0466957_0018293_2838_3902 349
369 3300045049 Ga0466959_0037352 Ga0466959_0037352_1283_2347 349
370 3300045836 Ga0466958_0002509 Ga0466958_0002509_1769_2833 349
371 3300045976 Ga0466967_0037420 Ga0466967_0037420_2131_3195 349
372 3300045976 Ga0466967_0135211 Ga0466967_0135211_899_1981 349
373 3300045976 Ga0466967_0165305 Ga0466967_0165305_406_1470 349
374 3300046684 Ga0495669_0011762 Ga0495669_0011762_561_1610 349
375 3300048905 Ga0496102_0092565 Ga0496102_0092565_577_1626 349
376 3300048911 Ga0496108_0010568 Ga0496108_0010568_188_1237 349
377 3300048912 Ga0496109_0007994 Ga0496109_0007994_6253_7302 349
378 3300048912 Ga0496109_0012282 Ga0496109_0012282_3332_4417 349
379 3300048912 Ga0496109_0134631 Ga0496109_0134631_1196_2245 349
380 3300048913 Ga0496110_0003540 Ga0496110_0003540_7020_8069 349
381 3300048913 Ga0496110_0028970 Ga0496110_0028970_2091_3176 349
382 3300048914 Ga0496111_0006338 Ga0496111_0006338_4186_5235 349
383 3300048914 Ga0496111_0028031 Ga0496111_0028031_193_1242 349
384 3300048915 Ga0496112_0018680 Ga0496112_0018680_4548_5597 349
385 3300048915 Ga0496112_0037353 Ga0496112_0037353_3156_4220 349
386 3300048916 Ga0496113_0078047 Ga0496113_0078047_317_1366 349
387 3300048917 Ga0496114_0316190 Ga0496114_0316190_224_1288 349
388 3300048918 Ga0496115_0001289 Ga0496115_0001289_6291_7355 349
389 3300049585 Ga0501069_0030283 Ga0501069_0030283_779_1858 349
390 3300049585 Ga0501069_0119304 Ga0501069_0119304_169_1251 349
391 3300050511 nmdc:mga08y16_118510_c1 nmdc:mga08y16_118510_c1_364_1428 349
392 3300050515 nmdc:mga0a205_7080_c1 nmdc:mga0a205_7080_c1_4860_5924 349
393 3300061719 Ga0466962_0002209 Ga0466962_0002209_2163_3227 349

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

43

349

0.91

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

58

180

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fft-assembly1.cif.gz_B structure of gntc, a plp-dependent enzyme catalyzing l-enduracididine biosynthesis from (s)-4-hydroxy-l-arginine 0.9388 10 346
8fft-assembly2.cif.gz_D structure of gntc, a plp-dependent enzyme catalyzing l-enduracididine biosynthesis from (s)-4-hydroxy-l-arginine 0.9388 10 346
8fft-assembly2.cif.gz_C structure of gntc, a plp-dependent enzyme catalyzing l-enduracididine biosynthesis from (s)-4-hydroxy-l-arginine 0.9153 12 346
3op7-assembly1.cif.gz_A crystal structure of a plp-dependent aminotransferase (zp_03625122.1) from streptococcus suis 89-1591 at 1.70 a resolution 0.915 10 349
8fft-assembly1.cif.gz_B structure of gntc, a plp-dependent enzyme catalyzing l-enduracididine biosynthesis from (s)-4-hydroxy-l-arginine 0.9054 10 346
ID Description Score Start End Superfamily
1o4sB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9353 38 246 3.40.640.10
af_A0A1D8PRL8_287_384_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.931 251 343 3.90.1150.10
af_I1LT64_314_417_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9262 255 347 3.90.1150.10
af_A0A0R0HS10_77_301_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9211 38 246 3.40.640.10
1j32B02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9186 38 246 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A2V5WV81-F1-model_v4 N-acetyltransferase domain-containing protein 0.9603 1 329 GO:0009058
GO:0016747
GO:0030170
AF-A0A7Y5JHG7-F1-model_v4 Pyridoxal phosphate-dependent aminotransferase 0.9543 4 347 GO:0008483
GO:0009058
GO:0030170
AF-A0A3D2MUN7-F1-model_v4 deleted 0.9471 39 347
AF-A0A523YH61-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9464 10 347 GO:0008483
GO:0009058
GO:0030170
AF-A0A7X7XGJ8-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9433 3 346 GO:0008483
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
92.25 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map