F432310

General Info

Members Datasets Scaffolds Average Seq Length
392 254 364 181

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10579956|Ga0157375_105799562
Length 198
Sequence MEVTTTALAGVLIVQPKVFADARGFFLESFNQRQFDAAVGAPVSFVQDNHSRSAQGVLRGLHMQVGAHPQGKLVRVTSGRIFDVAVDVRAGSPTYRQWVGVELDDVAHRQLWIPPGLAHGFLVLSESADVQYKTTDYYSPSDEAGIRWDDPALAISWPDLGIPYALSAKDRAAPTLDAALPNRSRAGADSGYTAAFSH

Samples

Sample ID Description Type Environment
1 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
2 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
3 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
4 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
5 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
6 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
7 2643221596 Acidovorax sp. Root70 Isolate Unclassified
8 2643221652 Acidovorax sp. Root402 Isolate Unclassified
9 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
10 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
11 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
12 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
13 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
14 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
15 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
16 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
17 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
18 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
19 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
20 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
21 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
22 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
23 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
24 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
25 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
26 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
27 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
28 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
179 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
188 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
236 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
246 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
247 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
248 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
249 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
250 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
251 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
252 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
253 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
254 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.86
Metatranscriptomes 0
Isolates 7.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.12
Nodule 3.57
Rhizoplane 2.04
Rhizosphere 82.4
Stem 0
Stem Tuber 0
Unclassified 5.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10055620 3300001989 Bacteria 1265
2 JGI25153J46596_10001011 3300003215 Bacteria 17119
3 rootL2_10020819 3300003322 Bacteria 18630
4 Ga0055526_1050369 3300003771 Bacteria 955
5 Ga0055524_1033396 3300003775 Bacteria 1441
6 Ga0055531_10037224 3300003794 Bacteria 1483
7 Ga0065165_1004747 3300005262 Bacteria 8135
8 Ga0065165_1093868 3300005262 Bacteria 760
9 Ga0065707_10277767 3300005295 Bacteria 1055
10 Ga0070658_10569558 3300005327 Bacteria 981
11 Ga0070676_10008155 3300005328 Bacteria 5635
12 Ga0070676_10026424 3300005328 Bacteria 3286
13 Ga0070676_10189635 3300005328 Bacteria 1341
14 Ga0070690_100119892 3300005330 Bacteria 1765
15 Ga0070690_100340712 3300005330 Bacteria 1086
16 Ga0070670_100026722 3300005331 Bacteria 4965
17 Ga0070670_100522059 3300005331 Bacteria 1057
18 Ga0070670_100537958 3300005331 Bacteria 1041
19 Ga0070670_100593693 3300005331 Bacteria 990
20 Ga0070677_10141727 3300005333 Bacteria 1109
21 Ga0068869_100026238 3300005334 Bacteria 4053
22 Ga0068869_100047305 3300005334 Bacteria 3106
23 Ga0070666_10018798 3300005335 Bacteria 4450
24 Ga0070666_10273457 3300005335 Bacteria 1199
25 Ga0068868_100308497 3300005338 Bacteria 1346
26 Ga0070689_100050107 3300005340 Bacteria 3225
27 Ga0070689_100646300 3300005340 Bacteria 920
28 Ga0070687_100067462 3300005343 Bacteria 1910
29 Ga0070687_100308275 3300005343 Unclassified 1007
30 Ga0070661_100169770 3300005344 Bacteria 1656
31 Ga0070668_100044165 3300005347 Bacteria 3418
32 Ga0070669_100001842 3300005353 Bacteria 15288
33 Ga0070669_100006048 3300005353 Bacteria 8731
34 Ga0070669_100722132 3300005353 Bacteria 842
35 Ga0070675_100003633 3300005354 Bacteria 11728
36 Ga0070675_100018635 3300005354 Bacteria 5525
37 Ga0070675_100302022 3300005354 Bacteria 1410
38 Ga0070675_100515607 3300005354 Bacteria 1078
39 Ga0070675_100785716 3300005354 Bacteria 870
40 Ga0070671_100010512 3300005355 Bacteria 7428
41 Ga0070671_100210887 3300005355 Bacteria 1647
42 Ga0070674_100002357 3300005356 Bacteria 10422
43 Ga0070674_100151878 3300005356 Bacteria 1748
44 Ga0070673_100031026 3300005364 Bacteria 4007
45 Ga0070673_100083830 3300005364 Bacteria 2590
46 Ga0070673_101050584 3300005364 Bacteria 760
47 Ga0070659_100755402 3300005366 Bacteria 844
48 Ga0070659_101034914 3300005366 Bacteria 722
49 Ga0070667_100003070 3300005367 Bacteria 14351
50 Ga0070709_10014575 3300005434 Bacteria 4448
51 Ga0070714_100025107 3300005435 Bacteria 4915
52 Ga0070713_100008469 3300005436 Bacteria 7294
53 Ga0070713_100169734 3300005436 Unclassified 1954
54 Ga0070710_10000578 3300005437 Bacteria 17393
55 Ga0070710_10346186 3300005437 Bacteria 982
56 Ga0070701_10019732 3300005438 Bacteria 3189
57 Ga0070711_100007679 3300005439 Bacteria 6569
58 Ga0070711_100113325 3300005439 Bacteria 1994
59 Ga0070700_100127743 3300005441 Bacteria 1711
60 Ga0070700_100221221 3300005441 Bacteria 1342
61 Ga0070694_100857226 3300005444 Bacteria 748
62 Ga0070708_100255582 3300005445 Unclassified 1646
63 Ga0070663_100216992 3300005455 Bacteria 1500
64 Ga0070663_100344812 3300005455 Bacteria 1205
65 Ga0070663_100533558 3300005455 Bacteria 979
66 Ga0070663_101217960 3300005455 Bacteria 662
67 Ga0070678_100257525 3300005456 Bacteria 1466
68 Ga0070678_100539165 3300005456 Bacteria 1034
69 Ga0070678_100570974 3300005456 Bacteria 1006
70 Ga0070662_100006646 3300005457 Bacteria 7468
71 Ga0070662_100098055 3300005457 Bacteria 2213
72 Ga0070662_100947616 3300005457 Bacteria 736
73 Ga0068867_100009142 3300005459 Bacteria 6992
74 Ga0068867_100018351 3300005459 Bacteria 4971
75 Ga0068867_100679268 3300005459 Bacteria 906
76 Ga0068867_100704233 3300005459 Bacteria 891
77 Ga0068867_101231731 3300005459 Bacteria 688
78 Ga0070706_100122229 3300005467 Bacteria 2427
79 Ga0070707_100936091 3300005468 Unclassified 831
80 Ga0070698_100001690 3300005471 Bacteria 24619
81 Ga0070698_100113300 3300005471 Bacteria 2677
82 Ga0070698_100143053 3300005471 Bacteria 2342
83 Ga0068853_100323320 3300005539 Bacteria 1430
84 Ga0070672_100001113 3300005543 Bacteria 16417
85 Ga0070672_100094831 3300005543 Bacteria 2413
86 Ga0070672_100237129 3300005543 Bacteria 1533
87 Ga0070672_100575527 3300005543 Bacteria 979
88 Ga0070686_100008270 3300005544 Bacteria 5824
89 Ga0070693_100162197 3300005547 Bacteria 1424
90 Ga0070665_100115577 3300005548 Bacteria 2686
91 Ga0070665_100213430 3300005548 Bacteria 1931
92 Ga0070665_100469815 3300005548 Unclassified 1268
93 Ga0070665_100604521 3300005548 Bacteria 1110
94 Ga0070665_100857003 3300005548 Bacteria 922
95 Ga0070664_100446761 3300005564 Bacteria 1187
96 Ga0070664_100533896 3300005564 Bacteria 1084
97 Ga0068857_100693412 3300005577 Bacteria 967
98 Ga0068857_101043155 3300005577 Bacteria 788
99 Ga0068854_100014758 3300005578 Bacteria 5157
100 Ga0068854_101002647 3300005578 Bacteria 739
101 Ga0070702_100131611 3300005615 Bacteria 1581
102 Ga0068852_100047343 3300005616 Bacteria 3668
103 Ga0068852_100228986 3300005616 Bacteria 1771
104 Ga0068852_100530448 3300005616 Bacteria 1175
105 Ga0068852_100644763 3300005616 Bacteria 1066
106 Ga0068864_100074157 3300005618 Bacteria 2968
107 Ga0068866_10006554 3300005718 Bacteria 4855
108 Ga0068866_10041095 3300005718 Bacteria 2293
109 Ga0068861_100005203 3300005719 Bacteria 8768
110 Ga0068861_100277893 3300005719 Bacteria 1441
111 Ga0068861_100336535 3300005719 Bacteria 1320
112 Ga0068851_10194276 3300005834 Bacteria 1130
113 Ga0068870_10441058 3300005840 Bacteria 856
114 Ga0068863_100008845 3300005841 Bacteria 9833
115 Ga0068863_100945852 3300005841 Bacteria 863
116 Ga0068863_101163828 3300005841 Bacteria 777
117 Ga0068858_100002700 3300005842 Bacteria 17882
118 Ga0068860_100008093 3300005843 Bacteria 10470
119 Ga0068862_100055201 3300005844 Bacteria 3403
120 Ga0070717_10014534 3300006028 Bacteria 6058
121 Ga0070717_10165930 3300006028 Bacteria 1918
122 Ga0070715_10017715 3300006163 Bacteria 2701
123 Ga0070712_100036519 3300006175 Bacteria 3344
124 Ga0070712_100100250 3300006175 Bacteria 2139
125 Ga0070712_100598810 3300006175 Bacteria 933
126 Ga0075362_10417840 3300006177 Bacteria 678
127 Ga0075369_10241888 3300006186 Bacteria 837
128 Ga0097621_100231984 3300006237 Bacteria 1611
129 Ga0075430_100056701 3300006846 Bacteria 3295
130 Ga0075429_100000282 3300006880 Bacteria 35849
131 Ga0068865_100743861 3300006881 Bacteria 842
132 Ga0105240_10000246 3300009093 Bacteria 107458
133 Ga0111539_10026084 3300009094 Bacteria 7153
134 Ga0105245_10016144 3300009098 Bacteria 6507
135 Ga0105245_10889643 3300009098 Bacteria 932
136 Ga0105243_10062462 3300009148 Bacteria 2982
137 Ga0105243_10769340 3300009148 Bacteria 946
138 Ga0105242_10207817 3300009176 Bacteria 1743
139 Ga0105242_10713107 3300009176 Bacteria 983
140 Ga0105248_10064977 3300009177 Bacteria 4096
141 Ga0105248_10280225 3300009177 Bacteria 1877
142 Ga0105248_10680598 3300009177 Bacteria 1160
143 Ga0105248_10703355 3300009177 Bacteria 1140
144 Ga0105249_10053154 3300009553 Bacteria 3702
145 Ga0105239_10071577 3300010375 Bacteria 3809
146 Ga0105239_11354284 3300010375 Archaea 821
147 Ga0105246_10758108 3300011119 Bacteria 857
148 Ga0157374_10263179 3300013296 Bacteria 1699
149 Ga0157378_10595372 3300013297 Bacteria 1116
150 Ga0163162_10004605 3300013306 Bacteria 13287
151 Ga0157375_10076375 3300013308 Bacteria 3376
152 Ga0157375_10579956 3300013308 Bacteria 1282
153 Ga0157375_11593812 3300013308 Bacteria 772
154 Ga0157375_11663966 3300013308 Bacteria 755
155 Ga0163163_10054392 3300014325 Bacteria 3955
156 Ga0163163_11688254 3300014325 Bacteria 694
157 Ga0157380_10007519 3300014326 Bacteria 7739
158 Ga0157377_10245980 3300014745 Bacteria 1157
159 Ga0157379_10014103 3300014968 Bacteria 7005
160 Ga0157379_10160195 3300014968 Bacteria 2031
161 Ga0157376_10251624 3300014969 Bacteria 1650
162 Ga0182006_1022498 3300015261 Bacteria 2620
163 Ga0163161_10007620 3300017792 Bacteria 7488
164 Ga0163161_10880125 3300017792 Bacteria 758
165 Ga0213876_10451628 3300021384 Bacteria 684
166 Ga0209563_117343 3300025230 Bacteria 866
167 Ga0209564_1010169 3300025295 Bacteria 4371
168 Ga0209564_1030963 3300025295 Bacteria 1646
169 Ga0209758_1000011 3300025297 Bacteria 1049685
170 Ga0209050_1000934 3300025298 Bacteria 38215
171 Ga0209256_1008470 3300025299 Bacteria 4762
172 Ga0209257_1000811 3300025304 Bacteria 45378
173 Ga0207697_10028106 3300025315 Bacteria 2300
174 Ga0207656_10052021 3300025321 Bacteria 1773
175 Ga0207682_10017477 3300025893 Bacteria 2802
176 Ga0207682_10029937 3300025893 Bacteria 2178
177 Ga0207682_10167487 3300025893 Bacteria 998
178 Ga0207682_10184372 3300025893 Unclassified 954
179 Ga0207682_10192809 3300025893 Bacteria 934
180 Ga0207692_10407731 3300025898 Bacteria 849
181 Ga0207642_10002417 3300025899 Bacteria 5821
182 Ga0207688_10102848 3300025901 Bacteria 1652
183 Ga0207680_10248850 3300025903 Bacteria 1227
184 Ga0207680_10302887 3300025903 Bacteria 1114
185 Ga0207685_10017133 3300025905 Unclassified 2334
186 Ga0207685_10085458 3300025905 Bacteria 1316
187 Ga0207699_10104699 3300025906 Bacteria 1802
188 Ga0207645_10005005 3300025907 Bacteria 9708
189 Ga0207645_10039643 3300025907 Bacteria 3018
190 Ga0207645_10227079 3300025907 Bacteria 1232
191 Ga0207643_10014944 3300025908 Bacteria 4223
192 Ga0207643_10107241 3300025908 Bacteria 1642
193 Ga0207684_10428808 3300025910 Bacteria 1136
194 Ga0207695_10000457 3300025913 Bacteria 88990
195 Ga0207693_10000768 3300025915 Bacteria 28844
196 Ga0207693_10465053 3300025915 Bacteria 988
197 Ga0207663_10195255 3300025916 Bacteria 1456
198 Ga0207662_10055882 3300025918 Bacteria 2356
199 Ga0207657_10601179 3300025919 Bacteria 858
200 Ga0207649_10457958 3300025920 Bacteria 964
201 Ga0207649_10776054 3300025920 Bacteria 747
202 Ga0207681_10000583 3300025923 Bacteria 24864
203 Ga0207681_10056657 3300025923 Bacteria 2674
204 Ga0207681_10349456 3300025923 Bacteria 1183
205 Ga0207681_10483657 3300025923 Bacteria 1011
206 Ga0207650_10737624 3300025925 Bacteria 833
207 Ga0207659_10006701 3300025926 Bacteria 7075
208 Ga0207659_10020759 3300025926 Bacteria 4348
209 Ga0207659_10061966 3300025926 Bacteria 2698
210 Ga0207659_10086882 3300025926 Bacteria 2326
211 Ga0207687_10173407 3300025927 Bacteria 1665
212 Ga0207700_10054218 3300025928 Bacteria 3008
213 Ga0207664_10026171 3300025929 Bacteria 4406
214 Ga0207644_10182965 3300025931 Bacteria 1643
215 Ga0207690_10681769 3300025932 Bacteria 844
216 Ga0207706_10014144 3300025933 Bacteria 7235
217 Ga0207706_10156510 3300025933 Bacteria 2004
218 Ga0207686_10082046 3300025934 Bacteria 2107
219 Ga0207686_10348210 3300025934 Bacteria 1115
220 Ga0207709_10082408 3300025935 Bacteria 2077
221 Ga0207670_10127566 3300025936 Bacteria 1858
222 Ga0207669_10022435 3300025937 Bacteria 3353
223 Ga0207704_10146535 3300025938 Bacteria 1659
224 Ga0207691_10018062 3300025940 Bacteria 6679
225 Ga0207691_10081797 3300025940 Bacteria 2902
226 Ga0207691_10172388 3300025940 Bacteria 1894
227 Ga0207691_10218296 3300025940 Bacteria 1654
228 Ga0207711_10152114 3300025941 Bacteria 2089
229 Ga0207711_10470695 3300025941 Bacteria 1170
230 Ga0207711_10478846 3300025941 Bacteria 1160
231 Ga0207711_11191744 3300025941 Bacteria 703
232 Ga0207689_10003554 3300025942 Bacteria 14254
233 Ga0207689_10029860 3300025942 Bacteria 4546
234 Ga0207661_10319691 3300025944 Bacteria 1395
235 Ga0207651_10036777 3300025960 Bacteria 3200
236 Ga0207651_10079537 3300025960 Bacteria 2355
237 Ga0207651_10194481 3300025960 Bacteria 1620
238 Ga0207712_10069948 3300025961 Bacteria 2520
239 Ga0207640_10017831 3300025981 Bacteria 4160
240 Ga0207658_10001932 3300025986 Bacteria 15466
241 Ga0207677_10376493 3300026023 Bacteria 1197
242 Ga0207677_10885335 3300026023 Bacteria 804
243 Ga0207703_10002118 3300026035 Bacteria 17481
244 Ga0207639_10286525 3300026041 Bacteria 1451
245 Ga0207639_10709233 3300026041 Bacteria 934
246 Ga0207678_10243347 3300026067 Bacteria 1541
247 Ga0207678_10709514 3300026067 Bacteria 885
248 Ga0207708_10011848 3300026075 Bacteria 6493
249 Ga0207708_10019464 3300026075 Bacteria 5117
250 Ga0207641_10038951 3300026088 Bacteria 3974
251 Ga0207641_10683542 3300026088 Bacteria 1010
252 Ga0207648_10001708 3300026089 Bacteria 24031
253 Ga0207648_10023245 3300026089 Bacteria 5559
254 Ga0207648_11110372 3300026089 Bacteria 742
255 Ga0207676_10902679 3300026095 Bacteria 867
256 Ga0207676_11281588 3300026095 Bacteria 727
257 Ga0207674_10665487 3300026116 Bacteria 1005
258 Ga0207675_100059322 3300026118 Bacteria 3570
259 Ga0207675_100581879 3300026118 Bacteria 1121
260 Ga0207683_10088173 3300026121 Bacteria 2760
261 Ga0207683_10300189 3300026121 Bacteria 1469
262 Ga0207683_10430113 3300026121 Bacteria 1216
263 Ga0207683_10613947 3300026121 Bacteria 1007
264 Ga0207683_10843159 3300026121 Bacteria 851
265 Ga0207698_10051554 3300026142 Bacteria 3147
266 Ga0207698_10086080 3300026142 Bacteria 2554
267 Ga0207698_10185814 3300026142 Bacteria 1846
268 Ga0207698_10350235 3300026142 Bacteria 1395
269 Ga0209281_1000064 3300027111 Bacteria 287876
270 Ga0209371_1004962 3300027312 Bacteria 5511
271 Ga0207428_10842647 3300027907 Bacteria 650
272 Ga0268266_10072918 3300028379 Bacteria 2978
273 Ga0268266_10281424 3300028379 Bacteria 1547
274 Ga0268266_10484240 3300028379 Bacteria 1180
275 Ga0268265_10014452 3300028380 Bacteria 5379
276 Ga0268264_10001636 3300028381 Bacteria 20687
277 Ga0268264_10065245 3300028381 Bacteria 3067
278 Ga0265319_1013434 3300028563 Bacteria 3256
279 Ga0307515_10002016 3300028794 Bacteria 44911
280 Ga0265338_10043617 3300028800 Bacteria 4156
281 Ga0268256_1002165 3300030500 Bacteria 10432
282 Ga0265320_10054971 3300031240 Bacteria 1918
283 Ga0265316_10003871 3300031344 Bacteria 15011
284 Ga0265316_10012638 3300031344 Bacteria 7559
285 Ga0265316_10053365 3300031344 Bacteria 3168
286 Ga0307408_100449151 3300031548 Bacteria 1118
287 Ga0265342_10156067 3300031712 Bacteria 1264
288 Ga0307405_10405428 3300031731 Bacteria 1068
289 Ga0307413_10329244 3300031824 Bacteria 1170
290 Ga0307413_10814310 3300031824 Bacteria 786
291 Ga0307410_10032678 3300031852 Bacteria 3352
292 Ga0307406_10156656 3300031901 Bacteria 1632
293 Ga0307407_10915433 3300031903 Bacteria 673
294 Ga0307409_100040544 3300031995 Bacteria 3468
295 Ga0307409_100171739 3300031995 Bacteria 1909
296 Ga0307416_100040016 3300032002 Bacteria 3636
297 Ga0307411_10122696 3300032005 Bacteria 1883
298 Ga0307415_100006619 3300032126 Bacteria 6268
299 Ga0373923_0070761 3300035111 Bacteria 1498
300 Ga0373923_0368731 3300035111 Bacteria 688
301 Ga0373953_0191725 3300035117 Bacteria 883
302 Ga0373957_0229232 3300035120 Bacteria 779
303 Ga0373943_0088531 3300035170 Bacteria 1600
304 Ga0373946_0054102 3300035171 Bacteria 1688
305 Ga0373955_0099526 3300035172 Bacteria 1667
306 Ga0373935_0459171 3300035692 Bacteria 921
307 Ga0373927_0088383 3300035695 Bacteria 2012
308 Ga0373947_0061949 3300035725 Bacteria 2275
309 Ga0373937_0003329 3300036401 Bacteria 13489
310 Ga0373937_0547282 3300036401 Bacteria 1099
311 Ga0395905_0220569 3300037471 Bacteria 1775
312 Ga0436364_1455361 3300037853 Bacteria 1526
313 Ga0400483_026315 3300039062 Bacteria 26780
314 Ga0436365_0736213 3300039437 Bacteria 739
315 Ga0436365_1660430 3300039437 Bacteria 897
316 Ga0436360_0724787 3300039438 Bacteria 5211
317 Ga0436361_0029389 3300039447 Bacteria 902
318 Ga0436361_0403435 3300039447 Bacteria 851
319 Ga0436363_0280160 3300039450 Bacteria 3151
320 Ga0436363_0858173 3300039450 Bacteria 1866
321 Ga0436362_0151836 3300039453 Bacteria 1841
322 Ga0436362_0467897 3300039453 Bacteria 1713
323 Ga0439462_0176288 3300042015 Bacteria 605
324 Ga0453684_0175824 3300044712 Bacteria 2518
325 Ga0451576_0069612 3300045051 Bacteria 3662
326 Ga0451576_0735262 3300045051 Bacteria 1036
327 Ga0495582_0454478 3300046473 Bacteria 740
328 Ga0495598_0099492 3300046537 Unclassified 960
329 Ga0495598_0144862 3300046537 Bacteria 825
330 Ga0495656_0104948 3300046615 Bacteria 1313
331 Ga0495647_0183915 3300046681 Bacteria 910
332 Ga0495658_0042106 3300046683 Bacteria 2548
333 Ga0495658_0240820 3300046683 Bacteria 1136
334 Ga0495658_0283608 3300046683 Bacteria 1045
335 Ga0495602_0517259 3300048088 Bacteria 832
336 Ga0496108_0333904 3300048911 Bacteria 1322
337 Ga0496109_0004788 3300048912 Bacteria 11300
338 Ga0496109_0006344 3300048912 Bacteria 9958
339 Ga0496114_0022380 3300048917 Bacteria 5151
340 Ga0496114_0104879 3300048917 Bacteria 2418
341 Ga0496118_0154623 3300048921 Bacteria 1429
342 Ga0496119_0051720 3300048922 Bacteria 2522
343 Ga0496121_0353152 3300048924 Bacteria 978
344 Ga0496125_0055113 3300048928 Bacteria 3242
345 Ga0501300_000014 3300049523 Bacteria 26548
346 Ga0501252_005494 3300049682 Bacteria 1380
347 nmdc:mga0k408_44461_c1 3300050493 Bacteria 2561
348 nmdc:mga09592_2771_c1 3300050508 Bacteria 14185
349 nmdc:mga0qj67_146857_c1 3300050509 Bacteria 1912
350 nmdc:mga08y16_372607_c1 3300050511 Bacteria 1464
351 Ga0495612_0139015 3300053078 Bacteria 1053
352 Ga0500610_0211012 3300053079 Bacteria 927
353 Ga0495595_0318682 3300053084 Bacteria 783
354 Ga0495619_0072726 3300053085 Bacteria 2303
355 Ga0495619_0132434 3300053085 Bacteria 1714
356 Ga0500566_0000143 3300053094 Bacteria 36825
357 Ga0500640_012043 3300053095 Bacteria 3542
358 Ga0500559_0170516 3300053136 Bacteria 1023
359 Ga0500620_003788 3300053155 Bacteria 3282
360 Ga0500636_0000024 3300053177 Bacteria 86744
361 Ga0500637_0310070 3300053178 Bacteria 857
362 Ga0500601_000624 3300053737 Bacteria 5017
363 Ga0590071_001220 3300059421 Bacteria 6952
364 Ga0590075_001965 3300059424 Bacteria 4978

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025940 Ga0207691_10172388 Ga0207691_101723882 150
2 3300009098 Ga0105245_10889643 Ga0105245_108896432 161
3 3300010375 Ga0105239_11354284 Ga0105239_113542842 161
4 3300005331 Ga0070670_100026722 Ga0070670_1000267223 164
5 3300005334 Ga0068869_100047305 Ga0068869_1000473053 164
6 3300005340 Ga0070689_100050107 Ga0070689_1000501072 164
7 3300005355 Ga0070671_100010512 Ga0070671_1000105127 164
8 3300005364 Ga0070673_100031026 Ga0070673_1000310263 164
9 3300005544 Ga0070686_100008270 Ga0070686_1000082705 164
10 3300025893 Ga0207682_10017477 Ga0207682_100174773 164
11 3300025942 Ga0207689_10003554 Ga0207689_100035545 164
12 3300026089 Ga0207648_10001708 Ga0207648_1000170815 164
13 3300028381 Ga0268264_10065245 Ga0268264_100652452 164
14 3300059421 Ga0590071_001220 Ga0590071_001220_443_943 164
15 3300059424 Ga0590075_001965 Ga0590075_001965_2315_2815 164
16 3300039447 Ga0436361_0029389 Ga0436361_0029389_322_879 168
17 iso_pu_bacteria 2511231028 2511395064 169
18 iso_pu_bacteria 2513237139 2513879611 169
19 iso_pu_bacteria 2513237161 2514017058 169
20 iso_pu_bacteria 2617270735 2617351991 169
21 iso_pu_bacteria 2791355196 2793061232 169
22 iso_pu_bacteria 2802429603 2805918606 169
23 iso_pu_bacteria 2824671348 2824673843 169
24 iso_pu_bacteria 2824687955 2824690451 169
25 iso_pu_bacteria 2824696289 2824700352 169
26 iso_pu_bacteria 2824773399 2824777154 169
27 iso_pu_bacteria 2838122688 2838127151 169
28 iso_pu_bacteria 2841941048 2841947388 169
29 iso_pu_bacteria 2841949485 2841956338 169
30 iso_pu_bacteria 2841966195 2841973175 169
31 iso_pu_bacteria 2841974524 2841980837 169
32 iso_pu_bacteria 2841983080 2841987251 169
33 iso_pu_bacteria 2842038055 2842041039 169
34 iso_pu_bacteria 2842045827 2842046016 169
35 iso_pu_bacteria 2847939898 2847948132 169
36 iso_pu_bacteria 3005506211 3005508009 169
37 3300005468 Ga0070707_100936091 Ga0070707_1009360911 171
38 3300003215 JGI25153J46596_10001011 JGI25153J46596_100010117 173
39 3300003771 Ga0055526_1050369 Ga0055526_10503691 173
40 3300003775 Ga0055524_1033396 Ga0055524_10333962 173
41 3300003794 Ga0055531_10037224 Ga0055531_100372241 173
42 3300005262 Ga0065165_1004747 Ga0065165_10047477 173
43 3300005548 Ga0070665_100213430 Ga0070665_1002134303 173
44 3300005577 Ga0068857_100693412 Ga0068857_1006934122 173
45 3300005616 Ga0068852_100644763 Ga0068852_1006447632 173
46 3300006177 Ga0075362_10417840 Ga0075362_104178401 173
47 3300006186 Ga0075369_10241888 Ga0075369_102418882 173
48 3300010375 Ga0105239_10071577 Ga0105239_100715774 173
49 3300025230 Ga0209563_117343 Ga0209563_1173432 173
50 3300025295 Ga0209564_1030963 Ga0209564_10309632 173
51 3300025297 Ga0209758_1000011 Ga0209758_1000011734 173
52 3300025299 Ga0209256_1008470 Ga0209256_10084704 173
53 3300025304 Ga0209257_1000811 Ga0209257_10008117 173
54 3300025919 Ga0207657_10601179 Ga0207657_106011791 173
55 3300026067 Ga0207678_10243347 Ga0207678_102433472 173
56 3300026142 Ga0207698_10350235 Ga0207698_103502352 173
57 3300048922 Ga0496119_0051720 Ga0496119_0051720_1909_2433 173
58 3300048924 Ga0496121_0353152 Ga0496121_0353152_42_566 173
59 3300053094 Ga0500566_0000143 Ga0500566_0000143_4682_5206 173
60 3300053095 Ga0500640_012043 Ga0500640_012043_2299_2823 173
61 3300053136 Ga0500559_0170516 Ga0500559_0170516_51_575 173
62 3300053155 Ga0500620_003788 Ga0500620_003788_2611_3135 173
63 3300053177 Ga0500636_0000024 Ga0500636_0000024_9917_10441 173
64 3300053178 Ga0500637_0310070 Ga0500637_0310070_316_840 173
65 3300053737 Ga0500601_000624 Ga0500601_000624_3369_3893 173
66 3300005328 Ga0070676_10026424 Ga0070676_100264241 174
67 3300005330 Ga0070690_100119892 Ga0070690_1001198922 174
68 3300005343 Ga0070687_100308275 Ga0070687_1003082752 174
69 3300005344 Ga0070661_100169770 Ga0070661_1001697702 174
70 3300005353 Ga0070669_100006048 Ga0070669_1000060482 174
71 3300005354 Ga0070675_100018635 Ga0070675_1000186355 174
72 3300005354 Ga0070675_100515607 Ga0070675_1005156072 174
73 3300005354 Ga0070675_100785716 Ga0070675_1007857162 174
74 3300005364 Ga0070673_100083830 Ga0070673_1000838303 174
75 3300005438 Ga0070701_10019732 Ga0070701_100197324 174
76 3300005441 Ga0070700_100127743 Ga0070700_1001277432 174
77 3300005444 Ga0070694_100857226 Ga0070694_1008572262 174
78 3300005455 Ga0070663_101217960 Ga0070663_1012179601 174
79 3300005456 Ga0070678_100257525 Ga0070678_1002575252 174
80 3300005459 Ga0068867_100018351 Ga0068867_1000183512 174
81 3300005459 Ga0068867_101231731 Ga0068867_1012317312 174
82 3300005471 Ga0070698_100143053 Ga0070698_1001430533 174
83 3300005543 Ga0070672_100094831 Ga0070672_1000948312 174
84 3300005548 Ga0070665_100469815 Ga0070665_1004698152 174
85 3300005615 Ga0070702_100131611 Ga0070702_1001316112 174
86 3300005718 Ga0068866_10041095 Ga0068866_100410953 174
87 3300005719 Ga0068861_100277893 Ga0068861_1002778932 174
88 3300005840 Ga0068870_10441058 Ga0068870_104410582 174
89 3300005841 Ga0068863_100945852 Ga0068863_1009458522 174
90 3300009148 Ga0105243_10769340 Ga0105243_107693402 174
91 3300009177 Ga0105248_10280225 Ga0105248_102802252 174
92 3300013308 Ga0157375_11663966 Ga0157375_116639662 174
93 3300014325 Ga0163163_10054392 Ga0163163_100543925 174
94 3300014745 Ga0157377_10245980 Ga0157377_102459802 174
95 3300025893 Ga0207682_10184372 Ga0207682_101843722 174
96 3300025903 Ga0207680_10248850 Ga0207680_102488502 174
97 3300025908 Ga0207643_10014944 Ga0207643_100149442 174
98 3300025908 Ga0207643_10107241 Ga0207643_101072412 174
99 3300025920 Ga0207649_10776054 Ga0207649_107760541 174
100 3300025923 Ga0207681_10056657 Ga0207681_100566572 174
101 3300025923 Ga0207681_10483657 Ga0207681_104836572 174
102 3300025926 Ga0207659_10020759 Ga0207659_100207593 174
103 3300025926 Ga0207659_10086882 Ga0207659_100868823 174
104 3300025931 Ga0207644_10182965 Ga0207644_101829652 174
105 3300025936 Ga0207670_10127566 Ga0207670_101275662 174
106 3300025938 Ga0207704_10146535 Ga0207704_101465352 174
107 3300025940 Ga0207691_10081797 Ga0207691_100817973 174
108 3300025941 Ga0207711_10152114 Ga0207711_101521142 174
109 3300025960 Ga0207651_10036777 Ga0207651_100367772 174
110 3300025960 Ga0207651_10079537 Ga0207651_100795373 174
111 3300026023 Ga0207677_10885335 Ga0207677_108853352 174
112 3300026075 Ga0207708_10011848 Ga0207708_100118487 174
113 3300026089 Ga0207648_11110372 Ga0207648_111103721 174
114 3300026116 Ga0207674_10665487 Ga0207674_106654872 174
115 3300026118 Ga0207675_100581879 Ga0207675_1005818792 174
116 3300026121 Ga0207683_10843159 Ga0207683_108431592 174
117 3300028379 Ga0268266_10484240 Ga0268266_104842402 174
118 3300042015 Ga0439462_0176288 Ga0439462_0176288_13_546 174
119 3300046537 Ga0495598_0099492 Ga0495598_0099492_69_599 174
120 3300046537 Ga0495598_0144862 Ga0495598_0144862_285_815 174
121 3300046615 Ga0495656_0104948 Ga0495656_0104948_314_844 174
122 3300046681 Ga0495647_0183915 Ga0495647_0183915_39_569 174
123 3300046683 Ga0495658_0042106 Ga0495658_0042106_173_703 174
124 3300053079 Ga0500610_0211012 Ga0500610_0211012_332_898 174
125 iso_pu_bacteria 2791355275 2793404925 174
126 iso_pu_bacteria 2643221596 2643994168 176
127 iso_pu_bacteria 2643221652 2644292989 176
128 3300031344 Ga0265316_10053365 Ga0265316_100533652 177
129 3300031712 Ga0265342_10156067 Ga0265342_101560672 177
130 3300031824 Ga0307413_10814310 Ga0307413_108143101 177
131 3300031995 Ga0307409_100171739 Ga0307409_1001717391 177
132 3300035117 Ga0373953_0191725 Ga0373953_0191725_256_795 177
133 3300039062 Ga0400483_026315 Ga0400483_026315_13589_14125 177
134 3300048921 Ga0496118_0154623 Ga0496118_0154623_234_770 177
135 3300027312 Ga0209371_1004962 Ga0209371_10049624 178
136 3300030500 Ga0268256_1002165 Ga0268256_10021654 178
137 3300005548 Ga0070665_100604521 Ga0070665_1006045211 179
138 3300028794 Ga0307515_10002016 Ga0307515_100020163 179
139 3300005295 Ga0065707_10277767 Ga0065707_102777672 180
140 3300005548 Ga0070665_100115577 Ga0070665_1001155772 180
141 3300005577 Ga0068857_101043155 Ga0068857_1010431552 180
142 3300009177 Ga0105248_10680598 Ga0105248_106805982 180
143 3300013297 Ga0157378_10595372 Ga0157378_105953722 180
144 3300025941 Ga0207711_10478846 Ga0207711_104788462 180
145 3300027111 Ga0209281_1000064 Ga0209281_1000064239 180
146 3300028379 Ga0268266_10072918 Ga0268266_100729183 180
147 3300031731 Ga0307405_10405428 Ga0307405_104054281 180
148 3300031824 Ga0307413_10329244 Ga0307413_103292442 180
149 3300031852 Ga0307410_10032678 Ga0307410_100326783 180
150 3300031901 Ga0307406_10156656 Ga0307406_101566562 180
151 3300031903 Ga0307407_10915433 Ga0307407_109154331 180
152 3300031995 Ga0307409_100040544 Ga0307409_1000405442 180
153 3300032002 Ga0307416_100040016 Ga0307416_1000400163 180
154 3300032005 Ga0307411_10122696 Ga0307411_101226962 180
155 3300032126 Ga0307415_100006619 Ga0307415_1000066196 180
156 3300045051 Ga0451576_0069612 Ga0451576_0069612_1641_2198 180
157 3300045051 Ga0451576_0735262 Ga0451576_0735262_316_864 180
158 3300049523 Ga0501300_000014 Ga0501300_000014_24076_24621 180
159 3300049682 Ga0501252_005494 Ga0501252_005494_674_1222 180
160 3300005262 Ga0065165_1093868 Ga0065165_10938681 181
161 3300005327 Ga0070658_10569558 Ga0070658_105695582 181
162 3300005328 Ga0070676_10008155 Ga0070676_100081554 181
163 3300005328 Ga0070676_10189635 Ga0070676_101896353 181
164 3300005330 Ga0070690_100340712 Ga0070690_1003407122 181
165 3300005331 Ga0070670_100522059 Ga0070670_1005220592 181
166 3300005331 Ga0070670_100537958 Ga0070670_1005379581 181
167 3300005331 Ga0070670_100593693 Ga0070670_1005936931 181
168 3300005333 Ga0070677_10141727 Ga0070677_101417272 181
169 3300005334 Ga0068869_100026238 Ga0068869_1000262383 181
170 3300005335 Ga0070666_10018798 Ga0070666_100187985 181
171 3300005335 Ga0070666_10273457 Ga0070666_102734571 181
172 3300005338 Ga0068868_100308497 Ga0068868_1003084972 181
173 3300005340 Ga0070689_100646300 Ga0070689_1006463002 181
174 3300005343 Ga0070687_100067462 Ga0070687_1000674623 181
175 3300005347 Ga0070668_100044165 Ga0070668_1000441654 181
176 3300005353 Ga0070669_100001842 Ga0070669_1000018425 181
177 3300005353 Ga0070669_100722132 Ga0070669_1007221322 181
178 3300005354 Ga0070675_100003633 Ga0070675_10000363312 181
179 3300005354 Ga0070675_100302022 Ga0070675_1003020222 181
180 3300005356 Ga0070674_100002357 Ga0070674_1000023575 181
181 3300005356 Ga0070674_100151878 Ga0070674_1001518783 181
182 3300005364 Ga0070673_101050584 Ga0070673_1010505841 181
183 3300005366 Ga0070659_100755402 Ga0070659_1007554022 181
184 3300005366 Ga0070659_101034914 Ga0070659_1010349141 181
185 3300005367 Ga0070667_100003070 Ga0070667_10000307012 181
186 3300005441 Ga0070700_100221221 Ga0070700_1002212213 181
187 3300005445 Ga0070708_100255582 Ga0070708_1002555822 181
188 3300005455 Ga0070663_100216992 Ga0070663_1002169922 181
189 3300005455 Ga0070663_100344812 Ga0070663_1003448122 181
190 3300005455 Ga0070663_100533558 Ga0070663_1005335581 181
191 3300005456 Ga0070678_100539165 Ga0070678_1005391652 181
192 3300005457 Ga0070662_100006646 Ga0070662_1000066462 181
193 3300005457 Ga0070662_100098055 Ga0070662_1000980551 181
194 3300005457 Ga0070662_100947616 Ga0070662_1009476161 181
195 3300005459 Ga0068867_100009142 Ga0068867_1000091425 181
196 3300005459 Ga0068867_100679268 Ga0068867_1006792681 181
197 3300005459 Ga0068867_100704233 Ga0068867_1007042331 181
198 3300005467 Ga0070706_100122229 Ga0070706_1001222292 181
199 3300005471 Ga0070698_100001690 Ga0070698_10000169019 181
200 3300005539 Ga0068853_100323320 Ga0068853_1003233202 181
201 3300005543 Ga0070672_100001113 Ga0070672_1000011136 181
202 3300005543 Ga0070672_100237129 Ga0070672_1002371292 181
203 3300005543 Ga0070672_100575527 Ga0070672_1005755272 181
204 3300005547 Ga0070693_100162197 Ga0070693_1001621972 181
205 3300005548 Ga0070665_100857003 Ga0070665_1008570032 181
206 3300005564 Ga0070664_100446761 Ga0070664_1004467613 181
207 3300005564 Ga0070664_100533896 Ga0070664_1005338962 181
208 3300005578 Ga0068854_100014758 Ga0068854_1000147584 181
209 3300005578 Ga0068854_101002647 Ga0068854_1010026472 181
210 3300005616 Ga0068852_100047343 Ga0068852_1000473432 181
211 3300005616 Ga0068852_100228986 Ga0068852_1002289862 181
212 3300005616 Ga0068852_100530448 Ga0068852_1005304482 181
213 3300005618 Ga0068864_100074157 Ga0068864_1000741574 181
214 3300005718 Ga0068866_10006554 Ga0068866_100065542 181
215 3300005719 Ga0068861_100005203 Ga0068861_1000052037 181
216 3300005719 Ga0068861_100336535 Ga0068861_1003365351 181
217 3300005834 Ga0068851_10194276 Ga0068851_101942762 181
218 3300005841 Ga0068863_100008845 Ga0068863_1000088455 181
219 3300005841 Ga0068863_101163828 Ga0068863_1011638282 181
220 3300005842 Ga0068858_100002700 Ga0068858_10000270014 181
221 3300005843 Ga0068860_100008093 Ga0068860_1000080938 181
222 3300005844 Ga0068862_100055201 Ga0068862_1000552013 181
223 3300006028 Ga0070717_10014534 Ga0070717_100145341 181
224 3300006237 Ga0097621_100231984 Ga0097621_1002319843 181
225 3300006846 Ga0075430_100056701 Ga0075430_1000567014 181
226 3300006880 Ga0075429_100000282 Ga0075429_1000002823 181
227 3300006881 Ga0068865_100743861 Ga0068865_1007438611 181
228 3300009098 Ga0105245_10016144 Ga0105245_100161447 181
229 3300009148 Ga0105243_10062462 Ga0105243_100624623 181
230 3300009176 Ga0105242_10207817 Ga0105242_102078172 181
231 3300009176 Ga0105242_10713107 Ga0105242_107131072 181
232 3300009177 Ga0105248_10064977 Ga0105248_100649772 181
233 3300009177 Ga0105248_10703355 Ga0105248_107033552 181
234 3300009553 Ga0105249_10053154 Ga0105249_100531542 181
235 3300011119 Ga0105246_10758108 Ga0105246_107581082 181
236 3300013296 Ga0157374_10263179 Ga0157374_102631792 181
237 3300013306 Ga0163162_10004605 Ga0163162_100046057 181
238 3300013308 Ga0157375_10076375 Ga0157375_100763754 181
239 3300013308 Ga0157375_11593812 Ga0157375_115938122 181
240 3300014325 Ga0163163_11688254 Ga0163163_116882541 181
241 3300014326 Ga0157380_10007519 Ga0157380_100075193 181
242 3300014968 Ga0157379_10014103 Ga0157379_100141035 181
243 3300014968 Ga0157379_10160195 Ga0157379_101601952 181
244 3300014969 Ga0157376_10251624 Ga0157376_102516242 181
245 3300017792 Ga0163161_10007620 Ga0163161_100076207 181
246 3300017792 Ga0163161_10880125 Ga0163161_108801252 181
247 3300025298 Ga0209050_1000934 Ga0209050_100093431 181
248 3300025315 Ga0207697_10028106 Ga0207697_100281062 181
249 3300025321 Ga0207656_10052021 Ga0207656_100520212 181
250 3300025893 Ga0207682_10029937 Ga0207682_100299372 181
251 3300025893 Ga0207682_10167487 Ga0207682_101674871 181
252 3300025893 Ga0207682_10192809 Ga0207682_101928092 181
253 3300025899 Ga0207642_10002417 Ga0207642_100024176 181
254 3300025901 Ga0207688_10102848 Ga0207688_101028482 181
255 3300025903 Ga0207680_10302887 Ga0207680_103028872 181
256 3300025905 Ga0207685_10085458 Ga0207685_100854582 181
257 3300025907 Ga0207645_10005005 Ga0207645_100050052 181
258 3300025907 Ga0207645_10039643 Ga0207645_100396433 181
259 3300025907 Ga0207645_10227079 Ga0207645_102270792 181
260 3300025910 Ga0207684_10428808 Ga0207684_104288081 181
261 3300025918 Ga0207662_10055882 Ga0207662_100558823 181
262 3300025920 Ga0207649_10457958 Ga0207649_104579582 181
263 3300025923 Ga0207681_10000583 Ga0207681_1000058320 181
264 3300025923 Ga0207681_10349456 Ga0207681_103494561 181
265 3300025925 Ga0207650_10737624 Ga0207650_107376242 181
266 3300025926 Ga0207659_10006701 Ga0207659_100067015 181
267 3300025926 Ga0207659_10061966 Ga0207659_100619663 181
268 3300025927 Ga0207687_10173407 Ga0207687_101734072 181
269 3300025932 Ga0207690_10681769 Ga0207690_106817692 181
270 3300025933 Ga0207706_10014144 Ga0207706_100141445 181
271 3300025933 Ga0207706_10156510 Ga0207706_101565103 181
272 3300025934 Ga0207686_10082046 Ga0207686_100820463 181
273 3300025934 Ga0207686_10348210 Ga0207686_103482102 181
274 3300025935 Ga0207709_10082408 Ga0207709_100824082 181
275 3300025937 Ga0207669_10022435 Ga0207669_100224352 181
276 3300025940 Ga0207691_10018062 Ga0207691_100180625 181
277 3300025940 Ga0207691_10218296 Ga0207691_102182962 181
278 3300025941 Ga0207711_10470695 Ga0207711_104706952 181
279 3300025941 Ga0207711_11191744 Ga0207711_111917441 181
280 3300025942 Ga0207689_10029860 Ga0207689_100298604 181
281 3300025944 Ga0207661_10319691 Ga0207661_103196913 181
282 3300025960 Ga0207651_10194481 Ga0207651_101944811 181
283 3300025961 Ga0207712_10069948 Ga0207712_100699483 181
284 3300025981 Ga0207640_10017831 Ga0207640_100178313 181
285 3300025986 Ga0207658_10001932 Ga0207658_1000193215 181
286 3300026023 Ga0207677_10376493 Ga0207677_103764933 181
287 3300026035 Ga0207703_10002118 Ga0207703_100021188 181
288 3300026041 Ga0207639_10286525 Ga0207639_102865252 181
289 3300026041 Ga0207639_10709233 Ga0207639_107092332 181
290 3300026067 Ga0207678_10709514 Ga0207678_107095142 181
291 3300026075 Ga0207708_10019464 Ga0207708_100194646 181
292 3300026088 Ga0207641_10038951 Ga0207641_100389513 181
293 3300026088 Ga0207641_10683542 Ga0207641_106835421 181
294 3300026089 Ga0207648_10023245 Ga0207648_100232453 181
295 3300026095 Ga0207676_10902679 Ga0207676_109026792 181
296 3300026095 Ga0207676_11281588 Ga0207676_112815881 181
297 3300026118 Ga0207675_100059322 Ga0207675_1000593224 181
298 3300026121 Ga0207683_10088173 Ga0207683_100881734 181
299 3300026121 Ga0207683_10300189 Ga0207683_103001893 181
300 3300026121 Ga0207683_10430113 Ga0207683_104301132 181
301 3300026121 Ga0207683_10613947 Ga0207683_106139472 181
302 3300026142 Ga0207698_10051554 Ga0207698_100515542 181
303 3300026142 Ga0207698_10086080 Ga0207698_100860803 181
304 3300026142 Ga0207698_10185814 Ga0207698_101858143 181
305 3300027907 Ga0207428_10842647 Ga0207428_108426471 181
306 3300028379 Ga0268266_10281424 Ga0268266_102814243 181
307 3300028380 Ga0268265_10014452 Ga0268265_100144524 181
308 3300028381 Ga0268264_10001636 Ga0268264_100016368 181
309 3300035111 Ga0373923_0070761 Ga0373923_0070761_544_1095 181
310 3300035170 Ga0373943_0088531 Ga0373943_0088531_469_1020 181
311 3300035171 Ga0373946_0054102 Ga0373946_0054102_775_1326 181
312 3300035692 Ga0373935_0459171 Ga0373935_0459171_205_756 181
313 3300035725 Ga0373947_0061949 Ga0373947_0061949_240_791 181
314 3300036401 Ga0373937_0547282 Ga0373937_0547282_180_731 181
315 3300037471 Ga0395905_0220569 Ga0395905_0220569_100_645 181
316 3300046473 Ga0495582_0454478 Ga0495582_0454478_147_698 181
317 3300046683 Ga0495658_0240820 Ga0495658_0240820_458_1006 181
318 3300046683 Ga0495658_0283608 Ga0495658_0283608_264_815 181
319 3300048911 Ga0496108_0333904 Ga0496108_0333904_331_876 181
320 3300048917 Ga0496114_0022380 Ga0496114_0022380_2179_2730 181
321 3300048917 Ga0496114_0104879 Ga0496114_0104879_1610_2155 181
322 3300050493 nmdc:mga0k408_44461_c1 nmdc:mga0k408_44461_c1_652_1203 181
323 3300050508 nmdc:mga09592_2771_c1 nmdc:mga09592_2771_c1_11017_11568 181
324 3300050509 nmdc:mga0qj67_146857_c1 nmdc:mga0qj67_146857_c1_1122_1673 181
325 3300050511 nmdc:mga08y16_372607_c1 nmdc:mga08y16_372607_c1_858_1409 181
326 3300053078 Ga0495612_0139015 Ga0495612_0139015_170_721 181
327 3300053085 Ga0495619_0132434 Ga0495619_0132434_203_754 181
328 3300005355 Ga0070671_100210887 Ga0070671_1002108872 182
329 3300005456 Ga0070678_100570974 Ga0070678_1005709741 182
330 3300031344 Ga0265316_10012638 Ga0265316_100126382 182
331 3300044712 Ga0453684_0175824 Ga0453684_0175824_1489_2040 182
332 3300035111 Ga0373923_0368731 Ga0373923_0368731_42_602 184
333 3300035120 Ga0373957_0229232 Ga0373957_0229232_187_747 184
334 3300035172 Ga0373955_0099526 Ga0373955_0099526_502_1062 184
335 3300036401 Ga0373937_0003329 Ga0373937_0003329_7959_8519 184
336 3300039438 Ga0436360_0724787 Ga0436360_0724787_1504_2064 184
337 3300039447 Ga0436361_0403435 Ga0436361_0403435_208_768 184
338 3300048088 Ga0495602_0517259 Ga0495602_0517259_108_668 184
339 3300053085 Ga0495619_0072726 Ga0495619_0072726_691_1251 184
340 3300006175 Ga0070712_100598810 Ga0070712_1005988101 185
341 3300031344 Ga0265316_10003871 Ga0265316_100038718 185
342 3300031548 Ga0307408_100449151 Ga0307408_1004491512 185
343 3300035695 Ga0373927_0088383 Ga0373927_0088383_979_1542 185
344 3300039453 Ga0436362_0151836 Ga0436362_0151836_214_780 185
345 3300048912 Ga0496109_0004788 Ga0496109_0004788_1859_2419 185
346 3300048912 Ga0496109_0006344 Ga0496109_0006344_8731_9294 185
347 3300053084 Ga0495595_0318682 Ga0495595_0318682_125_685 185
348 3300009094 Ga0111539_10026084 Ga0111539_100260844 186
349 3300028563 Ga0265319_1013434 Ga0265319_10134342 186
350 3300028800 Ga0265338_10043617 Ga0265338_100436172 186
351 3300031240 Ga0265320_10054971 Ga0265320_100549712 186
352 3300037853 Ga0436364_1455361 Ga0436364_1455361_612_1178 186
353 3300039437 Ga0436365_0736213 Ga0436365_0736213_58_624 186
354 3300039450 Ga0436363_0280160 Ga0436363_0280160_1782_2348 186
355 3300048928 Ga0496125_0055113 Ga0496125_0055113_767_1330 186
356 iso_pu_bacteria 2599185240 2599745191 186
357 iso_pu_bacteria 2599185355 2600206628 186
358 iso_pu_bacteria 2675903129 2676743080 186
359 iso_pu_bacteria 2870068957 2870076311 186
360 iso_pu_bacteria 8020945358 8020949882 186
361 3300003322 rootL2_10020819 rootL2_100208191 188
362 3300005436 Ga0070713_100169734 Ga0070713_1001697342 188
363 3300005437 Ga0070710_10346186 Ga0070710_103461861 188
364 3300005439 Ga0070711_100113325 Ga0070711_1001133253 188
365 3300005471 Ga0070698_100113300 Ga0070698_1001133002 188
366 3300006028 Ga0070717_10165930 Ga0070717_101659303 188
367 3300006175 Ga0070712_100100250 Ga0070712_1001002503 188
368 3300021384 Ga0213876_10451628 Ga0213876_104516281 188
369 3300025295 Ga0209564_1010169 Ga0209564_10101692 188
370 3300025898 Ga0207692_10407731 Ga0207692_104077311 188
371 3300025915 Ga0207693_10465053 Ga0207693_104650531 188
372 3300039437 Ga0436365_1660430 Ga0436365_1660430_102_677 188
373 3300039450 Ga0436363_0858173 Ga0436363_0858173_1204_1782 188
374 3300005434 Ga0070709_10014575 Ga0070709_100145754 189
375 3300005435 Ga0070714_100025107 Ga0070714_1000251073 189
376 3300005436 Ga0070713_100008469 Ga0070713_1000084697 189
377 3300005437 Ga0070710_10000578 Ga0070710_100005784 189
378 3300005439 Ga0070711_100007679 Ga0070711_1000076798 189
379 3300006163 Ga0070715_10017715 Ga0070715_100177153 189
380 3300006175 Ga0070712_100036519 Ga0070712_1000365192 189
381 3300013308 Ga0157375_10579956 Ga0157375_105799562 189
382 3300025905 Ga0207685_10017133 Ga0207685_100171331 189
383 3300025906 Ga0207699_10104699 Ga0207699_101046992 189
384 3300025915 Ga0207693_10000768 Ga0207693_100007684 189
385 3300025916 Ga0207663_10195255 Ga0207663_101952552 189
386 3300025928 Ga0207700_10054218 Ga0207700_100542181 189
387 3300025929 Ga0207664_10026171 Ga0207664_100261712 189
388 3300039453 Ga0436362_0467897 Ga0436362_0467897_186_809 189
389 3300001989 JGI24739J22299_10055620 JGI24739J22299_100556202 190
390 3300009093 Ga0105240_10000246 Ga0105240_1000024684 190
391 3300015261 Ga0182006_1022498 Ga0182006_10224982 190
392 3300025913 Ga0207695_10000457 Ga0207695_1000045735 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

5

178

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ep0-assembly1.cif.gz_A high resolution crystal structure of dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase from methanobacterium thermoautotrophicum 0.975 1 178
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9741 2 176
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9703 2 177
6ndr-assembly1.cif.gz_B crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose 0.9655 1 176
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9626 2 177
ID Description Score Start End Superfamily
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9749 1 178 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9616 3 177 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9528 3 181 2.60.120.10
1ofnB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9456 3 181 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9437 1 178 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A662ZHF0-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9917 45 177 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-R1F5Q9-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9903 43 174 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A6P1M8H2-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9898 3 177 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A4U9HCF6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9885 41 177 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A2G6G5F5-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9882 3 176 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Feature Viewer

pLDDT pTM Quality
93.07 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map