F432302

General Info

Members Datasets Scaffolds Average Seq Length
392 285 345 283

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10350036|Ga0105237_103500362
Length 328
Sequence MHWNPPDFGSLPPAYGAGGRLQARLRFRRAMRQGRRLSGGTAMLKWRVGDVTVTRVLELEATGGSRFILPQATPEVIRGIGWLCPHFADETGRLKMSVHALAIEAPGGRRIIVDTCIGNDKQREIPTWSNLQTGFLKDLEAAGFARESVDTVLCTHLHVDHVGWNTMLVDGKWVPTFPKARYLIGKAEFEYWKREEDGLEDRSKSPFHDSVAPVFEAGLVELVETNHQVCDEISLEPTLGHTPGHVSVRIRSKGEEALITGDFLHHPCQLARPDWASSADYDPDAGMATRRRVFTALSDTPVLMIGTHFAAPTAGRVVKDGDAWRLAV

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
4 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
5 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
6 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
7 2643221651 Afipia sp. Root123D2 Isolate Unclassified
8 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
9 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
10 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
11 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
12 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
13 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
14 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
15 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
16 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
17 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
18 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
19 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
20 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
21 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
22 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
23 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
24 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
25 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
26 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
27 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
28 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
29 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
30 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
31 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
32 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
33 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
34 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
35 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
36 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
37 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
38 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
39 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
40 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
41 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
42 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
43 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
44 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
45 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
46 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
47 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
50 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
70 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
74 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
75 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
78 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
111 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
112 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
134 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
137 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
186 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
187 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
188 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
197 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
198 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
219 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
262 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
277 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
278 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
279 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
280 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
281 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
282 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
283 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
285 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.01
Metatranscriptomes 0
Isolates 11.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.93
Nodule 9.18
Rhizoplane 5.61
Rhizosphere 68.37
Stem 0
Stem Tuber 0
Unclassified 7.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000123 3300003203 Bacteria 33753
2 JGI25406J46586_10029443 3300003203 Unclassified 2078
3 JGI25153J46596_10009101 3300003215 Bacteria 4660
4 JGI25153J46596_10015217 3300003215 Bacteria 3150
5 rootH2_10073560 3300003320 Bacteria 2407
6 JGI25160J50197_1001075 3300003354 Bacteria 14013
7 JGI25160J50197_1001123 3300003354 Bacteria 13671
8 Ga0065165_1000346 3300005262 Bacteria 76065
9 Ga0065707_10098199 3300005295 Bacteria 3103
10 Ga0070683_100008883 3300005329 Bacteria 8559
11 Ga0070680_100003569 3300005336 Bacteria 11609
12 Ga0070680_100036441 3300005336 Bacteria 3974
13 Ga0070691_10018183 3300005341 Bacteria 3239
14 Ga0070661_100007274 3300005344 Bacteria 7635
15 Ga0070668_100119450 3300005347 Bacteria 2105
16 Ga0070668_100519459 3300005347 Bacteria 1033
17 Ga0070675_100192646 3300005354 Bacteria 1767
18 Ga0070671_100036073 3300005355 Bacteria 4099
19 Ga0070673_100130302 3300005364 Bacteria 2109
20 Ga0070659_100176099 3300005366 Bacteria 1754
21 Ga0070709_10005907 3300005434 Bacteria 6642
22 Ga0070713_100000012 3300005436 Bacteria 137708
23 Ga0070710_10049026 3300005437 Bacteria 2361
24 Ga0070701_10020965 3300005438 Bacteria 3111
25 Ga0070711_100116949 3300005439 Bacteria 1965
26 Ga0070705_100088456 3300005440 Bacteria 1923
27 Ga0070705_100280236 3300005440 Bacteria 1185
28 Ga0070700_100282772 3300005441 Bacteria 1203
29 Ga0070694_100108870 3300005444 Bacteria 1971
30 Ga0070708_100015411 3300005445 Bacteria 6313
31 Ga0070663_100150372 3300005455 Bacteria 1785
32 Ga0070681_10064630 3300005458 Bacteria 3629
33 Ga0070706_100003045 3300005467 Bacteria 16598
34 Ga0070698_100003876 3300005471 Bacteria 16448
35 Ga0070699_100315280 3300005518 Bacteria 1404
36 Ga0070679_100065231 3300005530 Bacteria 3629
37 Ga0070684_100016526 3300005535 Bacteria 6032
38 Ga0070697_100000803 3300005536 Bacteria 23568
39 Ga0070697_100056100 3300005536 Bacteria 3204
40 Ga0070697_100296097 3300005536 Bacteria 1390
41 Ga0070697_100372497 3300005536 Bacteria 1236
42 Ga0068853_100013676 3300005539 Bacteria 6630
43 Ga0068853_100195618 3300005539 Bacteria 1839
44 Ga0070686_100153707 3300005544 Unclassified 1614
45 Ga0070696_100149834 3300005546 Bacteria 1711
46 Ga0070704_100027730 3300005549 Bacteria 3760
47 Ga0068855_100000772 3300005563 Bacteria 39468
48 Ga0068855_100012752 3300005563 Bacteria 10135
49 Ga0068855_100034079 3300005563 Bacteria 6075
50 Ga0068855_100075190 3300005563 Bacteria 3923
51 Ga0068855_100108065 3300005563 Bacteria 3195
52 Ga0068855_100139776 3300005563 Bacteria 2762
53 Ga0068855_100327408 3300005563 Bacteria 1692
54 Ga0068857_100005639 3300005577 Bacteria 10702
55 Ga0068857_100018173 3300005577 Bacteria 6168
56 Ga0068856_100002252 3300005614 Bacteria 19922
57 Ga0068859_100103396 3300005617 Bacteria 2906
58 Ga0068859_100326504 3300005617 Bacteria 1628
59 Ga0068861_100126588 3300005719 Bacteria 2067
60 Ga0068851_10011706 3300005834 Bacteria 4119
61 Ga0068863_100073683 3300005841 Bacteria 3230
62 Ga0068858_100277428 3300005842 Unclassified 1596
63 Ga0068860_100052284 3300005843 Bacteria 3886
64 Ga0068860_100411898 3300005843 Bacteria 1339
65 Ga0068862_100045077 3300005844 Bacteria 3762
66 Ga0068862_100371718 3300005844 Bacteria 1331
67 Ga0081540_1014258 3300005983 Bacteria 5104
68 Ga0081539_10000425 3300005985 Bacteria 89942
69 Ga0081539_10001234 3300005985 Bacteria 45604
70 Ga0081539_10003512 3300005985 Bacteria 19126
71 Ga0075365_10077602 3300006038 Bacteria 2244
72 Ga0070716_100077726 3300006173 Bacteria 1971
73 Ga0070716_100346908 3300006173 Bacteria 1049
74 Ga0070712_100000181 3300006175 Bacteria 34961
75 Ga0070712_100125721 3300006175 Bacteria 1937
76 Ga0075369_10035899 3300006186 Bacteria 2108
77 Ga0075366_10048504 3300006195 Bacteria 2518
78 Ga0075370_10011324 3300006353 Bacteria 4683
79 Ga0075370_10045845 3300006353 Bacteria 2473
80 Ga0075370_10047747 3300006353 Bacteria 2424
81 Ga0075428_100099588 3300006844 Bacteria 3169
82 Ga0075428_100359519 3300006844 Unclassified 1562
83 Ga0075430_100200581 3300006846 Bacteria 1657
84 Ga0075431_100001553 3300006847 Bacteria 21303
85 Ga0075431_100179027 3300006847 Bacteria 2176
86 Ga0075431_100346448 3300006847 Bacteria 1494
87 Ga0075431_100448073 3300006847 Bacteria 1287
88 Ga0075433_10321548 3300006852 Unclassified 1369
89 Ga0075433_10584427 3300006852 Bacteria 981
90 Ga0075434_100022047 3300006871 Bacteria 6201
91 Ga0075429_100021579 3300006880 Bacteria 5582
92 Ga0075429_100023228 3300006880 Bacteria 5379
93 Ga0068865_100010710 3300006881 Bacteria 5715
94 Ga0075436_100000284 3300006914 Bacteria 32139
95 Ga0097620_100103393 3300006931 Bacteria 2906
96 Ga0097620_100326496 3300006931 Bacteria 1628
97 Ga0099824_1007622 3300006942 Bacteria 14251
98 Ga0099822_1013884 3300006943 Bacteria 9357
99 Ga0099794_10159277 3300007265 Bacteria 1148
100 Ga0105240_10003638 3300009093 Bacteria 23879
101 Ga0105240_10008236 3300009093 Bacteria 14936
102 Ga0105240_10031799 3300009093 Bacteria 6838
103 Ga0105240_10047155 3300009093 Bacteria 5454
104 Ga0105240_10052346 3300009093 Bacteria 5134
105 Ga0105240_10122992 3300009093 Bacteria 3122
106 Ga0105240_10194284 3300009093 Bacteria 2384
107 Ga0105240_10489440 3300009093 Bacteria 1370
108 Ga0114129_10018974 3300009147 Bacteria 9796
109 Ga0114129_10296867 3300009147 Bacteria 2155
110 Ga0105243_10064018 3300009148 Bacteria 2949
111 Ga0105241_10107132 3300009174 Bacteria 2232
112 Ga0105242_10389120 3300009176 Bacteria 1298
113 Ga0105248_10002083 3300009177 Bacteria 22124
114 Ga0105248_10883506 3300009177 Bacteria 1009
115 Ga0105237_10014330 3300009545 Bacteria 8299
116 Ga0105237_10350036 3300009545 Bacteria 1482
117 Ga0105238_10007773 3300009551 Bacteria 10722
118 Ga0105238_10444680 3300009551 Bacteria 1293
119 Ga0105238_10513821 3300009551 Bacteria 1200
120 Ga0105249_10417214 3300009553 Unclassified 1375
121 Ga0105249_10429063 3300009553 Bacteria 1357
122 Ga0105249_10464599 3300009553 Bacteria 1306
123 Ga0105239_10013308 3300010375 Bacteria 9143
124 Ga0105239_10108444 3300010375 Bacteria 3077
125 Ga0105239_10320162 3300010375 Bacteria 1749
126 Ga0105246_10087294 3300011119 Bacteria 2239
127 Ga0157370_10063958 3300013104 Bacteria 3484
128 Ga0157369_10019868 3300013105 Bacteria 7515
129 Ga0157369_10234890 3300013105 Bacteria 1916
130 Ga0157374_10284479 3300013296 Bacteria 1633
131 Ga0163162_10071559 3300013306 Bacteria 3521
132 Ga0163162_10351642 3300013306 Bacteria 1606
133 Ga0157375_10666827 3300013308 Unclassified 1195
134 Ga0163163_10423891 3300014325 Bacteria 1390
135 Ga0157380_10436848 3300014326 Bacteria 1253
136 Ga0157377_10079675 3300014745 Bacteria 1911
137 Ga0157379_10101175 3300014968 Bacteria 2587
138 Ga0157379_10110240 3300014968 Bacteria 2472
139 Ga0214542_1037215 3300021321 Bacteria 1398
140 Ga0214543_1038860 3300021327 Bacteria 1342
141 Ga0213876_10001934 3300021384 Bacteria 12423
142 Ga0213875_10005591 3300021388 Bacteria 6722
143 Ga0209563_101817 3300025230 Bacteria 5281
144 Ga0207425_1016314 3300025245 Bacteria 1650
145 Ga0209564_1007134 3300025295 Bacteria 5833
146 Ga0209758_1002999 3300025297 Bacteria 16170
147 Ga0209758_1012418 3300025297 Bacteria 4769
148 Ga0209256_1024829 3300025299 Bacteria 1757
149 Ga0207426_1000217 3300025302 Bacteria 136180
150 Ga0207426_1001146 3300025302 Bacteria 23889
151 Ga0207426_1024525 3300025302 Bacteria 2045
152 Ga0207697_10016795 3300025315 Bacteria 3012
153 Ga0207692_10034560 3300025898 Bacteria 2448
154 Ga0207647_10063359 3300025904 Bacteria 2249
155 Ga0207699_10000104 3300025906 Bacteria 60711
156 Ga0207684_10000406 3300025910 Bacteria 57724
157 Ga0207684_10277749 3300025910 Unclassified 1445
158 Ga0207654_10048868 3300025911 Bacteria 2423
159 Ga0207707_10005294 3300025912 Bacteria 11286
160 Ga0207707_10016824 3300025912 Bacteria 6371
161 Ga0207695_10001681 3300025913 Bacteria 35578
162 Ga0207695_10003122 3300025913 Bacteria 23696
163 Ga0207695_10003286 3300025913 Bacteria 22974
164 Ga0207695_10011683 3300025913 Bacteria 10613
165 Ga0207695_10011831 3300025913 Bacteria 10526
166 Ga0207695_10027026 3300025913 Bacteria 6394
167 Ga0207695_10036216 3300025913 Bacteria 5337
168 Ga0207671_10012964 3300025914 Bacteria 6670
169 Ga0207693_10004146 3300025915 Bacteria 12298
170 Ga0207660_10010037 3300025917 Bacteria 6134
171 Ga0207657_10008647 3300025919 Bacteria 10306
172 Ga0207657_10253985 3300025919 Bacteria 1401
173 Ga0207652_10013564 3300025921 Bacteria 6591
174 Ga0207646_10001055 3300025922 Bacteria 35076
175 Ga0207681_10145764 3300025923 Bacteria 1769
176 Ga0207694_10015011 3300025924 Bacteria 5840
177 Ga0207700_10000335 3300025928 Bacteria 27697
178 Ga0207664_10419218 3300025929 Bacteria 1192
179 Ga0207644_10046372 3300025931 Bacteria 3096
180 Ga0207706_10095038 3300025933 Bacteria 2622
181 Ga0207709_10194576 3300025935 Bacteria 1443
182 Ga0207704_10004543 3300025938 Bacteria 6349
183 Ga0207665_10180763 3300025939 Unclassified 1527
184 Ga0207691_10109599 3300025940 Bacteria 2456
185 Ga0207711_10002892 3300025941 Bacteria 15046
186 Ga0207689_10097342 3300025942 Bacteria 2417
187 Ga0207661_10004540 3300025944 Bacteria 9726
188 Ga0207679_10154307 3300025945 Bacteria 1873
189 Ga0207667_10013617 3300025949 Bacteria 9297
190 Ga0207667_10057854 3300025949 Bacteria 4068
191 Ga0207667_10216504 3300025949 Bacteria 1962
192 Ga0207667_10307790 3300025949 Bacteria 1619
193 Ga0207651_10150882 3300025960 Bacteria 1809
194 Ga0207712_10108355 3300025961 Bacteria 2079
195 Ga0207677_10178793 3300026023 Bacteria 1667
196 Ga0207703_10169193 3300026035 Bacteria 1921
197 Ga0207703_10407745 3300026035 Unclassified 1262
198 Ga0207639_10075548 3300026041 Bacteria 2650
199 Ga0207639_10120581 3300026041 Bacteria 2154
200 Ga0207678_10294085 3300026067 Bacteria 1395
201 Ga0207708_10372165 3300026075 Bacteria 1176
202 Ga0207702_10000045 3300026078 Bacteria 144714
203 Ga0207641_10307290 3300026088 Bacteria 1500
204 Ga0207674_10025319 3300026116 Bacteria 6331
205 Ga0207674_10067238 3300026116 Bacteria 3608
206 Ga0207674_10175796 3300026116 Bacteria 2093
207 Ga0207675_100227619 3300026118 Bacteria 1798
208 Ga0207675_100254965 3300026118 Bacteria 1699
209 Ga0207683_10208552 3300026121 Bacteria 1778
210 Ga0207698_10250425 3300026142 Bacteria 1620
211 Ga0209589_1000005 3300027357 Bacteria 530958
212 Ga0209489_100005 3300027361 Bacteria 530958
213 Ga0209700_100006 3300027363 Bacteria 530958
214 Ga0209179_1004333 3300027512 Bacteria 2134
215 Ga0209588_1041766 3300027671 Bacteria 1480
216 Ga0268265_10044244 3300028380 Bacteria 3314
217 Ga0268264_10095362 3300028381 Bacteria 2574
218 Ga0307517_10000100 3300028786 Bacteria 125762
219 Ga0307515_10021109 3300028794 Bacteria 11563
220 Ga0265330_10019489 3300031235 Bacteria 3109
221 Ga0265332_10023504 3300031238 Bacteria 2718
222 Ga0265328_10012151 3300031239 Bacteria 3429
223 Ga0265340_10012726 3300031247 Bacteria 4441
224 Ga0265339_10017941 3300031249 Bacteria 4182
225 Ga0265316_10116354 3300031344 Bacteria 2021
226 Ga0307416_100353851 3300032002 Bacteria 1488
227 Ga0373928_0052443 3300035084 Bacteria 967
228 Ga0373953_0000754 3300035117 Bacteria 8974
229 Ga0373954_0127251 3300035118 Bacteria 1239
230 Ga0373956_0016854 3300035119 Bacteria 3071
231 Ga0373924_0018228 3300035410 Bacteria 2702
232 Ga0373931_0002294 3300035691 Bacteria 8454
233 Ga0373931_0198218 3300035691 Bacteria 1198
234 Ga0373927_0007348 3300035695 Bacteria 7458
235 Ga0373927_0143773 3300035695 Bacteria 1561
236 Ga0373947_0006075 3300035725 Bacteria 7038
237 Ga0395899_0000539 3300037312 Bacteria 41240
238 Ga0395900_0000009 3300037418 Bacteria 476249
239 Ga0395900_0068859 3300037418 Bacteria 3637
240 Ga0395898_0075332 3300037466 Bacteria 3260
241 Ga0395898_0138987 3300037466 Bacteria 2325
242 Ga0395905_0005016 3300037471 Bacteria 13636
243 Ga0395905_0083209 3300037471 Bacteria 2998
244 Ga0395905_0182473 3300037471 Bacteria 1970
245 Ga0436364_1278600 3300037853 Bacteria 14505
246 Ga0395901_0000007 3300038443 Bacteria 497408
247 Ga0395901_0128757 3300038443 Bacteria 2661
248 Ga0395901_0164863 3300038443 Bacteria 2327
249 Ga0395901_0240191 3300038443 Bacteria 1890
250 Ga0400485_02481 3300038735 Bacteria 3513
251 Ga0436365_0166028 3300039437 Bacteria 30952
252 Ga0451577_0067552 3300042876 Bacteria 3188
253 Ga0466972_0057571 3300044658 Bacteria 1867
254 Ga0453683_0009757 3300044673 Bacteria 6400
255 Ga0466964_0032823 3300044706 Bacteria 2065
256 Ga0453684_0362531 3300044712 Bacteria 1631
257 Ga0495651_0043440 3300046462 Bacteria 3487
258 Ga0495580_0056169 3300046472 Bacteria 2773
259 Ga0495606_0003350 3300046507 Bacteria 17079
260 Ga0495616_0070006 3300046513 Bacteria 1699
261 Ga0495643_0022198 3300046522 Bacteria 3624
262 Ga0495648_0005396 3300046524 Bacteria 10629
263 Ga0495648_0110153 3300046524 Bacteria 1500
264 Ga0495652_0009499 3300046529 Bacteria 8831
265 Ga0495652_0365865 3300046529 Bacteria 1029
266 Ga0495597_0051487 3300046542 Bacteria 1815
267 Ga0495645_0170986 3300046543 Bacteria 1496
268 Ga0495635_0004233 3300046663 Bacteria 9950
269 Ga0495624_0066039 3300046690 Bacteria 2259
270 Ga0495675_0007874 3300047444 Bacteria 6583
271 Ga0496100_0017120 3300048903 Bacteria 4273
272 Ga0496102_0034329 3300048905 Bacteria 4561
273 Ga0496103_0001777 3300048906 Bacteria 14064
274 Ga0496104_0030659 3300048907 Bacteria 4998
275 Ga0496104_0080325 3300048907 Bacteria 3109
276 Ga0496106_0150785 3300048909 Bacteria 1834
277 Ga0496108_0206664 3300048911 Bacteria 1704
278 Ga0496109_0038260 3300048912 Bacteria 4337
279 Ga0496110_0032728 3300048913 Bacteria 4494
280 Ga0496110_0058375 3300048913 Bacteria 3399
281 Ga0496110_0059745 3300048913 Bacteria 3361
282 Ga0496111_0029067 3300048914 Bacteria 3922
283 Ga0496112_0048255 3300048915 Bacteria 4175
284 Ga0496112_0062610 3300048915 Bacteria 3670
285 Ga0496112_0192363 3300048915 Bacteria 2001
286 Ga0496113_0045224 3300048916 Bacteria 3264
287 Ga0496113_0069637 3300048916 Bacteria 2672
288 Ga0496114_0005276 3300048917 Bacteria 10097
289 Ga0496115_0003781 3300048918 Bacteria 10886
290 Ga0496115_0019167 3300048918 Bacteria 5263
291 Ga0496115_0540958 3300048918 Bacteria 932
292 Ga0496116_0058910 3300048919 Bacteria 2501
293 Ga0496117_0098988 3300048920 Bacteria 1852
294 Ga0496121_0000194 3300048924 Bacteria 136324
295 Ga0496124_0080599 3300048927 Bacteria 2678
296 Ga0496125_0054945 3300048928 Bacteria 3250
297 Ga0496125_0145133 3300048928 Bacteria 1642
298 Ga0501033_0033729 3300049570 Bacteria 3843
299 Ga0501036_0320185 3300049572 Bacteria 1296
300 Ga0501047_0064868 3300049581 Bacteria 3522
301 Ga0501072_0543053 3300049588 Bacteria 918
302 Ga0501075_0185908 3300049591 Bacteria 1585
303 Ga0501076_0074194 3300049592 Bacteria 2725
304 Ga0501077_0015875 3300049593 Unclassified 4744
305 Ga0501257_002281 3300049686 Bacteria 4025
306 Ga0501035_0118895 3300049822 Bacteria 2312
307 nmdc:mga00v17_186595_c1 3300050491 Bacteria 1338
308 nmdc:mga00v17_335107_c1 3300050491 Bacteria 983
309 nmdc:mga0yw44_131954_c1 3300050492 Bacteria 1618
310 nmdc:mga0yw44_50965_c1 3300050492 Bacteria 2505
311 nmdc:mga0k408_173347_c1 3300050493 Bacteria 1286
312 nmdc:mga0k408_5183_c1 3300050493 Bacteria 6914
313 nmdc:mga07m45_89044_c1 3300050496 Bacteria 1767
314 nmdc:mga05p37_198749_c1 3300050507 Bacteria 2430
315 nmdc:mga05p37_265071_c1 3300050507 Bacteria 2054
316 nmdc:mga05p37_398524_c1 3300050507 Bacteria 1607
317 nmdc:mga09592_124675_c1 3300050508 Bacteria 2214
318 nmdc:mga09592_151537_c1 3300050508 Bacteria 2000
319 nmdc:mga09592_6828_c1 3300050508 Bacteria 9289
320 nmdc:mga09592_77486_c1 3300050508 Bacteria 2828
321 nmdc:mga0qj67_168830_c1 3300050509 Bacteria 1776
322 nmdc:mga06r32_183546_c1 3300050510 Bacteria 2078
323 nmdc:mga06r32_314077_c1 3300050510 Bacteria 1553
324 nmdc:mga06r32_460539_c1 3300050510 Bacteria 1251
325 nmdc:mga06r32_82982_c1 3300050510 Bacteria 3123
326 nmdc:mga0n895_12345_c1 3300050512 Bacteria 7660
327 nmdc:mga0n895_157579_c1 3300050512 Unclassified 2301
328 nmdc:mga0n895_21186_c1 3300050512 Bacteria 6073
329 nmdc:mga0n895_639547_c1 3300050512 Unclassified 1063
330 nmdc:mga0rr50_391101_c1 3300050513 Bacteria 1173
331 nmdc:mga08x19_100_c1 3300050514 Bacteria 76036
332 nmdc:mga0a205_298845_c1 3300050515 Bacteria 1483
333 nmdc:mga0a205_308930_c1 3300050515 Unclassified 1453
334 Ga0495601_0278707 3300053077 Bacteria 1090
335 Ga0495655_0032464 3300053083 Bacteria 1278
336 Ga0495595_0006871 3300053084 Bacteria 4643
337 Ga0500647_0038000 3300053091 Bacteria 2305
338 Ga0500566_0043807 3300053094 Bacteria 2578
339 Ga0500641_0001249 3300053096 Bacteria 9042
340 Ga0500557_000097 3300053105 Bacteria 28812
341 Ga0500595_055779 3300053119 Bacteria 1209
342 Ga0500642_0000100 3300053130 Bacteria 41454
343 Ga0500637_0005856 3300053178 Bacteria 5994
344 Ga0500625_020484 3300053729 Bacteria 3112
345 Ga0530510_0049067 3300061734 Bacteria 3051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_0543053 Ga0501072_0543053_10_708 228
2 3300013296 Ga0157374_10284479 Ga0157374_102844791 250
3 3300050509 nmdc:mga0qj67_168830_c1 nmdc:mga0qj67_168830_c1_820_1602 250
4 3300035118 Ga0373954_0127251 Ga0373954_0127251_147_923 258
5 3300005445 Ga0070708_100015411 Ga0070708_1000154113 259
6 3300005467 Ga0070706_100003045 Ga0070706_10000304516 259
7 3300005471 Ga0070698_100003876 Ga0070698_10000387616 259
8 3300005536 Ga0070697_100000803 Ga0070697_1000008033 259
9 3300025910 Ga0207684_10000406 Ga0207684_100004064 259
10 3300025922 Ga0207646_10001055 Ga0207646_1000105539 259
11 3300042876 Ga0451577_0067552 Ga0451577_0067552_1275_2165 259
12 3300044673 Ga0453683_0009757 Ga0453683_0009757_3340_4230 259
13 3300044712 Ga0453684_0362531 Ga0453684_0362531_47_937 259
14 3300005843 Ga0068860_100052284 Ga0068860_1000522845 260
15 3300003320 rootH2_10073560 rootH2_100735602 261
16 3300061734 Ga0530510_0049067 Ga0530510_0049067_409_1239 266
17 3300006847 Ga0075431_100448073 Ga0075431_1004480732 267
18 3300009093 Ga0105240_10052346 Ga0105240_100523462 267
19 3300035695 Ga0373927_0143773 Ga0373927_0143773_146_997 267
20 3300050507 nmdc:mga05p37_398524_c1 nmdc:mga05p37_398524_c1_86_958 267
21 3300050515 nmdc:mga0a205_298845_c1 nmdc:mga0a205_298845_c1_116_988 267
22 3300021388 Ga0213875_10005591 Ga0213875_100055914 268
23 3300025910 Ga0207684_10277749 Ga0207684_102777491 268
24 3300037853 Ga0436364_1278600 Ga0436364_1278600_8022_8912 268
25 3300009176 Ga0105242_10389120 Ga0105242_103891202 270
26 3300005295 Ga0065707_10098199 Ga0065707_100981993 271
27 3300005438 Ga0070701_10020965 Ga0070701_100209651 271
28 3300005441 Ga0070700_100282772 Ga0070700_1002827722 271
29 3300005444 Ga0070694_100108870 Ga0070694_1001088701 271
30 3300005518 Ga0070699_100315280 Ga0070699_1003152802 271
31 3300005536 Ga0070697_100296097 Ga0070697_1002960972 271
32 3300005546 Ga0070696_100149834 Ga0070696_1001498342 271
33 3300005577 Ga0068857_100018173 Ga0068857_1000181733 271
34 3300005617 Ga0068859_100103396 Ga0068859_1001033963 271
35 3300005719 Ga0068861_100126588 Ga0068861_1001265881 271
36 3300005844 Ga0068862_100045077 Ga0068862_1000450774 271
37 3300006931 Ga0097620_100103393 Ga0097620_1001033933 271
38 3300009177 Ga0105248_10883506 Ga0105248_108835062 271
39 3300009553 Ga0105249_10464599 Ga0105249_104645992 271
40 3300013306 Ga0163162_10351642 Ga0163162_103516422 271
41 3300014968 Ga0157379_10101175 Ga0157379_101011752 271
42 3300025942 Ga0207689_10097342 Ga0207689_100973422 271
43 3300026075 Ga0207708_10372165 Ga0207708_103721652 271
44 3300026116 Ga0207674_10175796 Ga0207674_101757962 271
45 3300026118 Ga0207675_100227619 Ga0207675_1002276192 271
46 3300028380 Ga0268265_10044244 Ga0268265_100442443 271
47 3300028381 Ga0268264_10095362 Ga0268264_100953623 271
48 3300005440 Ga0070705_100088456 Ga0070705_1000884562 272
49 3300005617 Ga0068859_100326504 Ga0068859_1003265042 272
50 3300006931 Ga0097620_100326496 Ga0097620_1003264962 272
51 3300025923 Ga0207681_10145764 Ga0207681_101457642 272
52 3300025961 Ga0207712_10108355 Ga0207712_101083552 272
53 3300049592 Ga0501076_0074194 Ga0501076_0074194_879_1715 272
54 3300005983 Ga0081540_1014258 Ga0081540_10142584 273
55 3300005539 Ga0068853_100195618 Ga0068853_1001956181 274
56 3300005563 Ga0068855_100000772 Ga0068855_10000077240 274
57 3300006846 Ga0075430_100200581 Ga0075430_1002005813 274
58 3300006847 Ga0075431_100001553 Ga0075431_10000155323 274
59 3300006880 Ga0075429_100023228 Ga0075429_1000232283 274
60 3300006943 Ga0099822_1013884 Ga0099822_10138842 274
61 3300009093 Ga0105240_10008236 Ga0105240_100082365 274
62 3300009147 Ga0114129_10018974 Ga0114129_100189746 274
63 3300025913 Ga0207695_10011683 Ga0207695_100116839 274
64 3300025919 Ga0207657_10253985 Ga0207657_102539852 274
65 3300026041 Ga0207639_10075548 Ga0207639_100755482 274
66 3300049686 Ga0501257_002281 Ga0501257_002281_2286_3167 274
67 3300050508 nmdc:mga09592_6828_c1 nmdc:mga09592_6828_c1_3290_4144 274
68 3300050508 nmdc:mga09592_77486_c1 nmdc:mga09592_77486_c1_1542_2411 274
69 3300050510 nmdc:mga06r32_82982_c1 nmdc:mga06r32_82982_c1_765_1634 274
70 3300005440 Ga0070705_100280236 Ga0070705_1002802361 275
71 3300006847 Ga0075431_100179027 Ga0075431_1001790273 275
72 3300006852 Ga0075433_10321548 Ga0075433_103215482 275
73 3300038443 Ga0395901_0240191 Ga0395901_0240191_81_974 275
74 3300050508 nmdc:mga09592_151537_c1 nmdc:mga09592_151537_c1_346_1206 275
75 3300050510 nmdc:mga06r32_460539_c1 nmdc:mga06r32_460539_c1_158_1018 275
76 3300050512 nmdc:mga0n895_639547_c1 nmdc:mga0n895_639547_c1_89_955 275
77 3300005434 Ga0070709_10005907 Ga0070709_100059078 276
78 3300005436 Ga0070713_100000012 Ga0070713_1000000128 276
79 3300005614 Ga0068856_100002252 Ga0068856_10000225210 276
80 3300005844 Ga0068862_100371718 Ga0068862_1003717182 276
81 3300006175 Ga0070712_100000181 Ga0070712_10000018124 276
82 3300006871 Ga0075434_100022047 Ga0075434_1000220473 276
83 3300006914 Ga0075436_100000284 Ga0075436_1000002848 276
84 3300014968 Ga0157379_10110240 Ga0157379_101102402 276
85 3300025906 Ga0207699_10000104 Ga0207699_1000010446 276
86 3300025915 Ga0207693_10004146 Ga0207693_1000414613 276
87 3300025928 Ga0207700_10000335 Ga0207700_1000033520 276
88 3300026078 Ga0207702_10000045 Ga0207702_1000004574 276
89 3300038735 Ga0400485_02481 Ga0400485_02481_185_1045 276
90 3300048924 Ga0496121_0000194 Ga0496121_0000194_82273_83238 276
91 3300049572 Ga0501036_0320185 Ga0501036_0320185_301_1170 276
92 3300050512 nmdc:mga0n895_21186_c1 nmdc:mga0n895_21186_c1_3094_3951 276
93 3300050514 nmdc:mga08x19_100_c1 nmdc:mga08x19_100_c1_26180_27037 276
94 3300003203 JGI25406J46586_10029443 JGI25406J46586_100294432 277
95 3300005347 Ga0070668_100519459 Ga0070668_1005194591 277
96 3300005544 Ga0070686_100153707 Ga0070686_1001537071 277
97 3300005842 Ga0068858_100277428 Ga0068858_1002774282 277
98 3300005843 Ga0068860_100411898 Ga0068860_1004118981 277
99 3300005985 Ga0081539_10001234 Ga0081539_1000123422 277
100 3300005985 Ga0081539_10003512 Ga0081539_1000351215 277
101 3300006844 Ga0075428_100359519 Ga0075428_1003595192 277
102 3300009147 Ga0114129_10296867 Ga0114129_102968672 277
103 3300009553 Ga0105249_10417214 Ga0105249_104172142 277
104 3300011119 Ga0105246_10087294 Ga0105246_100872943 277
105 3300026023 Ga0207677_10178793 Ga0207677_101787932 277
106 3300026035 Ga0207703_10407745 Ga0207703_104077452 277
107 3300026118 Ga0207675_100254965 Ga0207675_1002549652 277
108 3300050507 nmdc:mga05p37_265071_c1 nmdc:mga05p37_265071_c1_794_1660 277
109 3300050510 nmdc:mga06r32_183546_c1 nmdc:mga06r32_183546_c1_133_999 277
110 3300050512 nmdc:mga0n895_157579_c1 nmdc:mga0n895_157579_c1_844_1716 277
111 iso_pu_bacteria 2507262055 2507505855 277
112 iso_pu_bacteria 2508501009 2508540046 277
113 iso_pu_bacteria 2513237092 2513626457 277
114 iso_pu_bacteria 2513237139 2513875425 277
115 iso_pu_bacteria 2513237161 2514011197 277
116 iso_pu_bacteria 2643221651 2644290252 277
117 iso_pu_bacteria 2667528175 2671120785 277
118 iso_pu_bacteria 2728368998 2728748275 277
119 iso_pu_bacteria 2791355196 2793061613 277
120 iso_pu_bacteria 2802429603 2805921650 277
121 iso_pu_bacteria 2824671348 2824674965 277
122 iso_pu_bacteria 2824687955 2824691395 277
123 iso_pu_bacteria 2824696289 2824701469 277
124 iso_pu_bacteria 2824704595 2824706343 277
125 iso_pu_bacteria 2824753945 2824754984 277
126 iso_pu_bacteria 2824763712 2824765162 277
127 iso_pu_bacteria 2824773399 2824775788 277
128 iso_pu_bacteria 2838122688 2838125159 277
129 iso_pu_bacteria 2841941048 2841945900 277
130 iso_pu_bacteria 2841949485 2841956776 277
131 iso_pu_bacteria 2841966195 2841973293 277
132 iso_pu_bacteria 2841974524 2841979548 277
133 iso_pu_bacteria 2841983080 2841989331 277
134 iso_pu_bacteria 2842038055 2842044322 277
135 iso_pu_bacteria 2842045827 2842051689 277
136 iso_pu_bacteria 2847939898 2847941325 277
137 iso_pu_bacteria 2849076700 2849082252 277
138 iso_pu_bacteria 2874612657 2874620180 277
139 iso_pu_bacteria 2885366525 2885367679 277
140 iso_pu_bacteria 2888388044 2888390011 277
141 iso_pu_bacteria 2904711408 2904714350 277
142 iso_pu_bacteria 2935648319 2935649309 277
143 iso_pu_bacteria 2935656913 2935657919 277
144 iso_pu_bacteria 2935959822 2935963956 277
145 iso_pu_bacteria 2936011229 2936012138 277
146 iso_pu_bacteria 2936019824 2936020781 277
147 iso_pu_bacteria 2936028420 2936029431 277
148 iso_pu_bacteria 2936046547 2936048245 277
149 iso_pu_bacteria 2941531003 2941532120 277
150 iso_pu_bacteria 3005483717 3005485788 277
151 iso_pu_bacteria 3005506211 3005510844 277
152 3300013308 Ga0157375_10666827 Ga0157375_106668271 278
153 3300053096 Ga0500641_0001249 Ga0500641_0001249_3303_4181 278
154 3300005336 Ga0070680_100036441 Ga0070680_1000364415 279
155 3300005536 Ga0070697_100056100 Ga0070697_1000561002 279
156 3300005549 Ga0070704_100027730 Ga0070704_1000277303 279
157 3300005563 Ga0068855_100012752 Ga0068855_10001275217 279
158 3300005563 Ga0068855_100139776 Ga0068855_1001397762 279
159 3300005563 Ga0068855_100327408 Ga0068855_1003274082 279
160 3300006173 Ga0070716_100346908 Ga0070716_1003469081 279
161 3300006175 Ga0070712_100125721 Ga0070712_1001257212 279
162 3300006852 Ga0075433_10584427 Ga0075433_105844271 279
163 3300006881 Ga0068865_100010710 Ga0068865_1000107104 279
164 3300009093 Ga0105240_10003638 Ga0105240_1000363810 279
165 3300009093 Ga0105240_10047155 Ga0105240_100471553 279
166 3300009093 Ga0105240_10122992 Ga0105240_101229926 279
167 3300009093 Ga0105240_10489440 Ga0105240_104894401 279
168 3300009177 Ga0105248_10002083 Ga0105248_1000208311 279
169 3300009545 Ga0105237_10350036 Ga0105237_103500362 279
170 3300009551 Ga0105238_10444680 Ga0105238_104446802 279
171 3300013105 Ga0157369_10234890 Ga0157369_102348902 279
172 3300021384 Ga0213876_10001934 Ga0213876_100019349 279
173 3300025912 Ga0207707_10016824 Ga0207707_100168243 279
174 3300025913 Ga0207695_10001681 Ga0207695_100016814 279
175 3300025913 Ga0207695_10003122 Ga0207695_1000312226 279
176 3300025913 Ga0207695_10003286 Ga0207695_1000328610 279
177 3300025913 Ga0207695_10011831 Ga0207695_1001183116 279
178 3300025913 Ga0207695_10036216 Ga0207695_100362163 279
179 3300025938 Ga0207704_10004543 Ga0207704_100045434 279
180 3300025939 Ga0207665_10180763 Ga0207665_101807632 279
181 3300025941 Ga0207711_10002892 Ga0207711_1000289212 279
182 3300025949 Ga0207667_10057854 Ga0207667_100578543 279
183 3300025949 Ga0207667_10307790 Ga0207667_103077902 279
184 3300026142 Ga0207698_10250425 Ga0207698_102504252 279
185 3300032002 Ga0307416_100353851 Ga0307416_1003538512 279
186 3300037312 Ga0395899_0000539 Ga0395899_0000539_17698_18555 279
187 3300037418 Ga0395900_0000009 Ga0395900_0000009_446952_447809 279
188 3300037466 Ga0395898_0075332 Ga0395898_0075332_1423_2280 279
189 3300037466 Ga0395898_0138987 Ga0395898_0138987_356_1213 279
190 3300037471 Ga0395905_0005016 Ga0395905_0005016_2679_3536 279
191 3300037471 Ga0395905_0083209 Ga0395905_0083209_1569_2426 279
192 3300037471 Ga0395905_0182473 Ga0395905_0182473_979_1836 279
193 3300038443 Ga0395901_0000007 Ga0395901_0000007_22686_23543 279
194 3300039437 Ga0436365_0166028 Ga0436365_0166028_4911_5780 279
195 3300046543 Ga0495645_0170986 Ga0495645_0170986_244_1101 279
196 3300048915 Ga0496112_0062610 Ga0496112_0062610_1896_2753 279
197 3300048918 Ga0496115_0003781 Ga0496115_0003781_1066_1923 279
198 3300049570 Ga0501033_0033729 Ga0501033_0033729_1828_2685 279
199 3300049581 Ga0501047_0064868 Ga0501047_0064868_1857_2714 279
200 3300049822 Ga0501035_0118895 Ga0501035_0118895_1270_2127 279
201 3300050512 nmdc:mga0n895_12345_c1 nmdc:mga0n895_12345_c1_5300_6151 279
202 3300050515 nmdc:mga0a205_308930_c1 nmdc:mga0a205_308930_c1_126_977 279
203 3300053178 Ga0500637_0005856 Ga0500637_0005856_4952_5803 279
204 3300005329 Ga0070683_100008883 Ga0070683_1000088837 280
205 3300005336 Ga0070680_100003569 Ga0070680_10000356912 280
206 3300005341 Ga0070691_10018183 Ga0070691_100181833 280
207 3300005344 Ga0070661_100007274 Ga0070661_1000072747 280
208 3300005366 Ga0070659_100176099 Ga0070659_1001760992 280
209 3300005458 Ga0070681_10064630 Ga0070681_100646303 280
210 3300005530 Ga0070679_100065231 Ga0070679_1000652313 280
211 3300005535 Ga0070684_100016526 Ga0070684_1000165263 280
212 3300005536 Ga0070697_100372497 Ga0070697_1003724971 280
213 3300005539 Ga0068853_100013676 Ga0068853_1000136766 280
214 3300005563 Ga0068855_100034079 Ga0068855_1000340796 280
215 3300005577 Ga0068857_100005639 Ga0068857_1000056395 280
216 3300005834 Ga0068851_10011706 Ga0068851_100117065 280
217 3300006844 Ga0075428_100099588 Ga0075428_1000995882 280
218 3300006847 Ga0075431_100346448 Ga0075431_1003464481 280
219 3300006880 Ga0075429_100021579 Ga0075429_1000215792 280
220 3300007265 Ga0099794_10159277 Ga0099794_101592772 280
221 3300009093 Ga0105240_10031799 Ga0105240_100317996 280
222 3300009093 Ga0105240_10194284 Ga0105240_101942843 280
223 3300009545 Ga0105237_10014330 Ga0105237_100143305 280
224 3300009551 Ga0105238_10007773 Ga0105238_100077736 280
225 3300010375 Ga0105239_10013308 Ga0105239_100133086 280
226 3300013104 Ga0157370_10063958 Ga0157370_100639584 280
227 3300013105 Ga0157369_10019868 Ga0157369_100198687 280
228 3300014326 Ga0157380_10436848 Ga0157380_104368481 280
229 3300025912 Ga0207707_10005294 Ga0207707_1000529410 280
230 3300025913 Ga0207695_10027026 Ga0207695_100270266 280
231 3300025914 Ga0207671_10012964 Ga0207671_100129644 280
232 3300025917 Ga0207660_10010037 Ga0207660_100100376 280
233 3300025919 Ga0207657_10008647 Ga0207657_100086476 280
234 3300025921 Ga0207652_10013564 Ga0207652_100135644 280
235 3300025924 Ga0207694_10015011 Ga0207694_100150112 280
236 3300025940 Ga0207691_10109599 Ga0207691_101095991 280
237 3300025944 Ga0207661_10004540 Ga0207661_100045406 280
238 3300025945 Ga0207679_10154307 Ga0207679_101543073 280
239 3300025949 Ga0207667_10013617 Ga0207667_100136177 280
240 3300026035 Ga0207703_10169193 Ga0207703_101691932 280
241 3300026116 Ga0207674_10025319 Ga0207674_100253195 280
242 3300027512 Ga0209179_1004333 Ga0209179_10043332 280
243 3300027671 Ga0209588_1041766 Ga0209588_10417661 280
244 3300031235 Ga0265330_10019489 Ga0265330_100194892 280
245 3300031238 Ga0265332_10023504 Ga0265332_100235042 280
246 3300031239 Ga0265328_10012151 Ga0265328_100121513 280
247 3300031247 Ga0265340_10012726 Ga0265340_100127263 280
248 3300031344 Ga0265316_10116354 Ga0265316_101163542 280
249 3300035117 Ga0373953_0000754 Ga0373953_0000754_2965_3807 280
250 3300035119 Ga0373956_0016854 Ga0373956_0016854_59_901 280
251 3300035410 Ga0373924_0018228 Ga0373924_0018228_257_1099 280
252 3300035691 Ga0373931_0198218 Ga0373931_0198218_108_950 280
253 3300035695 Ga0373927_0007348 Ga0373927_0007348_33_875 280
254 3300035725 Ga0373947_0006075 Ga0373947_0006075_110_952 280
255 3300046462 Ga0495651_0043440 Ga0495651_0043440_2480_3322 280
256 3300046472 Ga0495580_0056169 Ga0495580_0056169_1896_2738 280
257 3300046524 Ga0495648_0005396 Ga0495648_0005396_5652_6494 280
258 3300046529 Ga0495652_0009499 Ga0495652_0009499_826_1668 280
259 3300046663 Ga0495635_0004233 Ga0495635_0004233_5601_6443 280
260 3300046690 Ga0495624_0066039 Ga0495624_0066039_1091_1933 280
261 3300047444 Ga0495675_0007874 Ga0495675_0007874_4074_4916 280
262 3300048907 Ga0496104_0080325 Ga0496104_0080325_1257_2099 280
263 3300048913 Ga0496110_0059745 Ga0496110_0059745_1930_2772 280
264 3300048914 Ga0496111_0029067 Ga0496111_0029067_1015_1857 280
265 3300048915 Ga0496112_0048255 Ga0496112_0048255_1115_1957 280
266 3300048916 Ga0496113_0069637 Ga0496113_0069637_1153_1995 280
267 3300048918 Ga0496115_0019167 Ga0496115_0019167_423_1265 280
268 3300048918 Ga0496115_0540958 Ga0496115_0540958_68_913 280
269 3300049591 Ga0501075_0185908 Ga0501075_0185908_153_1037 280
270 3300049593 Ga0501077_0015875 Ga0501077_0015875_807_1667 280
271 3300050507 nmdc:mga05p37_198749_c1 nmdc:mga05p37_198749_c1_151_1017 280
272 3300050508 nmdc:mga09592_124675_c1 nmdc:mga09592_124675_c1_1286_2152 280
273 3300050510 nmdc:mga06r32_314077_c1 nmdc:mga06r32_314077_c1_598_1464 280
274 3300050513 nmdc:mga0rr50_391101_c1 nmdc:mga0rr50_391101_c1_91_948 280
275 3300053084 Ga0495595_0006871 Ga0495595_0006871_1667_2509 280
276 iso_pu_bacteria 8016548790 8016556906 280
277 3300003203 JGI25406J46586_10000123 JGI25406J46586_100001232 281
278 3300003215 JGI25153J46596_10009101 JGI25153J46596_100091013 281
279 3300003215 JGI25153J46596_10015217 JGI25153J46596_100152172 281
280 3300003354 JGI25160J50197_1001075 JGI25160J50197_10010758 281
281 3300003354 JGI25160J50197_1001123 JGI25160J50197_10011233 281
282 3300005262 Ga0065165_1000346 Ga0065165_100034648 281
283 3300005347 Ga0070668_100119450 Ga0070668_1001194502 281
284 3300005354 Ga0070675_100192646 Ga0070675_1001926462 281
285 3300005355 Ga0070671_100036073 Ga0070671_1000360732 281
286 3300005364 Ga0070673_100130302 Ga0070673_1001303023 281
287 3300005437 Ga0070710_10049026 Ga0070710_100490262 281
288 3300005439 Ga0070711_100116949 Ga0070711_1001169492 281
289 3300005455 Ga0070663_100150372 Ga0070663_1001503721 281
290 3300005563 Ga0068855_100075190 Ga0068855_1000751905 281
291 3300005563 Ga0068855_100108065 Ga0068855_1001080653 281
292 3300005841 Ga0068863_100073683 Ga0068863_1000736834 281
293 3300005985 Ga0081539_10000425 Ga0081539_100004256 281
294 3300006038 Ga0075365_10077602 Ga0075365_100776022 281
295 3300006173 Ga0070716_100077726 Ga0070716_1000777261 281
296 3300006186 Ga0075369_10035899 Ga0075369_100358991 281
297 3300006195 Ga0075366_10048504 Ga0075366_100485042 281
298 3300006353 Ga0075370_10011324 Ga0075370_100113242 281
299 3300006353 Ga0075370_10045845 Ga0075370_100458452 281
300 3300006353 Ga0075370_10047747 Ga0075370_100477472 281
301 3300006942 Ga0099824_1007622 Ga0099824_100762211 281
302 3300009148 Ga0105243_10064018 Ga0105243_100640183 281
303 3300009174 Ga0105241_10107132 Ga0105241_101071323 281
304 3300009551 Ga0105238_10513821 Ga0105238_105138211 281
305 3300009553 Ga0105249_10429063 Ga0105249_104290631 281
306 3300010375 Ga0105239_10108444 Ga0105239_101084442 281
307 3300010375 Ga0105239_10320162 Ga0105239_103201622 281
308 3300013306 Ga0163162_10071559 Ga0163162_100715592 281
309 3300014325 Ga0163163_10423891 Ga0163163_104238912 281
310 3300014745 Ga0157377_10079675 Ga0157377_100796751 281
311 3300021321 Ga0214542_1037215 Ga0214542_10372152 281
312 3300021327 Ga0214543_1038860 Ga0214543_10388602 281
313 3300025230 Ga0209563_101817 Ga0209563_1018174 281
314 3300025245 Ga0207425_1016314 Ga0207425_10163141 281
315 3300025295 Ga0209564_1007134 Ga0209564_10071345 281
316 3300025297 Ga0209758_1002999 Ga0209758_10029992 281
317 3300025297 Ga0209758_1012418 Ga0209758_10124184 281
318 3300025299 Ga0209256_1024829 Ga0209256_10248292 281
319 3300025302 Ga0207426_1000217 Ga0207426_100021741 281
320 3300025302 Ga0207426_1001146 Ga0207426_100114617 281
321 3300025302 Ga0207426_1024525 Ga0207426_10245252 281
322 3300025315 Ga0207697_10016795 Ga0207697_100167954 281
323 3300025898 Ga0207692_10034560 Ga0207692_100345602 281
324 3300025904 Ga0207647_10063359 Ga0207647_100633592 281
325 3300025911 Ga0207654_10048868 Ga0207654_100488682 281
326 3300025929 Ga0207664_10419218 Ga0207664_104192181 281
327 3300025931 Ga0207644_10046372 Ga0207644_100463723 281
328 3300025933 Ga0207706_10095038 Ga0207706_100950382 281
329 3300025935 Ga0207709_10194576 Ga0207709_101945762 281
330 3300025949 Ga0207667_10216504 Ga0207667_102165041 281
331 3300025960 Ga0207651_10150882 Ga0207651_101508821 281
332 3300026041 Ga0207639_10120581 Ga0207639_101205812 281
333 3300026067 Ga0207678_10294085 Ga0207678_102940851 281
334 3300026088 Ga0207641_10307290 Ga0207641_103072901 281
335 3300026116 Ga0207674_10067238 Ga0207674_100672383 281
336 3300026121 Ga0207683_10208552 Ga0207683_102085522 281
337 3300027357 Ga0209589_1000005 Ga0209589_100000517 281
338 3300027361 Ga0209489_100005 Ga0209489_10000517 281
339 3300027363 Ga0209700_100006 Ga0209700_10000617 281
340 3300028786 Ga0307517_10000100 Ga0307517_100001007 281
341 3300028794 Ga0307515_10021109 Ga0307515_1002110914 281
342 3300031249 Ga0265339_10017941 Ga0265339_100179414 281
343 3300035084 Ga0373928_0052443 Ga0373928_0052443_57_905 281
344 3300035691 Ga0373931_0002294 Ga0373931_0002294_6568_7416 281
345 3300037418 Ga0395900_0068859 Ga0395900_0068859_2263_3108 281
346 3300038443 Ga0395901_0128757 Ga0395901_0128757_999_1844 281
347 3300038443 Ga0395901_0164863 Ga0395901_0164863_694_1596 281
348 3300044658 Ga0466972_0057571 Ga0466972_0057571_552_1400 281
349 3300044706 Ga0466964_0032823 Ga0466964_0032823_156_1004 281
350 3300046507 Ga0495606_0003350 Ga0495606_0003350_6554_7399 281
351 3300046513 Ga0495616_0070006 Ga0495616_0070006_274_1122 281
352 3300046522 Ga0495643_0022198 Ga0495643_0022198_2602_3450 281
353 3300046524 Ga0495648_0110153 Ga0495648_0110153_11_901 281
354 3300046529 Ga0495652_0365865 Ga0495652_0365865_18_866 281
355 3300046542 Ga0495597_0051487 Ga0495597_0051487_208_1056 281
356 3300048903 Ga0496100_0017120 Ga0496100_0017120_1321_2169 281
357 3300048905 Ga0496102_0034329 Ga0496102_0034329_509_1357 281
358 3300048906 Ga0496103_0001777 Ga0496103_0001777_3532_4380 281
359 3300048907 Ga0496104_0030659 Ga0496104_0030659_3661_4509 281
360 3300048909 Ga0496106_0150785 Ga0496106_0150785_568_1416 281
361 3300048911 Ga0496108_0206664 Ga0496108_0206664_722_1570 281
362 3300048912 Ga0496109_0038260 Ga0496109_0038260_2984_3832 281
363 3300048913 Ga0496110_0032728 Ga0496110_0032728_2703_3551 281
364 3300048913 Ga0496110_0058375 Ga0496110_0058375_1054_1902 281
365 3300048915 Ga0496112_0192363 Ga0496112_0192363_272_1120 281
366 3300048916 Ga0496113_0045224 Ga0496113_0045224_610_1458 281
367 3300048917 Ga0496114_0005276 Ga0496114_0005276_8876_9724 281
368 3300048919 Ga0496116_0058910 Ga0496116_0058910_1286_2134 281
369 3300048920 Ga0496117_0098988 Ga0496117_0098988_400_1248 281
370 3300048927 Ga0496124_0080599 Ga0496124_0080599_501_1349 281
371 3300048928 Ga0496125_0054945 Ga0496125_0054945_311_1159 281
372 3300048928 Ga0496125_0145133 Ga0496125_0145133_607_1455 281
373 3300050491 nmdc:mga00v17_186595_c1 nmdc:mga00v17_186595_c1_393_1241 281
374 3300050491 nmdc:mga00v17_335107_c1 nmdc:mga00v17_335107_c1_41_889 281
375 3300050492 nmdc:mga0yw44_131954_c1 nmdc:mga0yw44_131954_c1_233_1081 281
376 3300050492 nmdc:mga0yw44_50965_c1 nmdc:mga0yw44_50965_c1_901_1758 281
377 3300050493 nmdc:mga0k408_173347_c1 nmdc:mga0k408_173347_c1_374_1261 281
378 3300050493 nmdc:mga0k408_5183_c1 nmdc:mga0k408_5183_c1_5307_6155 281
379 3300050496 nmdc:mga07m45_89044_c1 nmdc:mga07m45_89044_c1_686_1534 281
380 3300053077 Ga0495601_0278707 Ga0495601_0278707_106_954 281
381 3300053083 Ga0495655_0032464 Ga0495655_0032464_268_1116 281
382 3300053091 Ga0500647_0038000 Ga0500647_0038000_207_1055 281
383 3300053094 Ga0500566_0043807 Ga0500566_0043807_1687_2544 281
384 3300053105 Ga0500557_000097 Ga0500557_000097_5653_6501 281
385 3300053119 Ga0500595_055779 Ga0500595_055779_216_1118 281
386 3300053130 Ga0500642_0000100 Ga0500642_0000100_35056_35943 281
387 3300053729 Ga0500625_020484 Ga0500625_020484_998_1846 281
388 iso_pu_bacteria 2617270735 2617347738 281
389 iso_pu_bacteria 2841957949 2841965259 281
390 iso_pu_bacteria 2874620515 2874622393 281
391 iso_pu_bacteria 2904666416 2904671600 281
392 iso_pu_bacteria 3005587118 3005588781 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

95

308

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hif-assembly1.cif.gz_B crystal structure of a reconstructed lactonase ancestor, anc1-mph, of the bacterial methyl parathion hydrolase, mph. 0.8471 2 281
7y7u-assembly1.cif.gz_B dimeric structure of a quorum-quenching metallo-hydrolase, lrsl 0.8337 1 281
4zo2-assembly1.cif.gz_B aidc, a dizinc quorum-quenching lactonase 0.8327 1 281
4le6-assembly1.cif.gz_A-2 crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes 0.8322 1 281
4zo2-assembly1.cif.gz_B aidc, a dizinc quorum-quenching lactonase 0.8299 1 281
ID Description Score Start End Superfamily
5vngA05 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.8472 56 69 3.40.20.10
6c2cA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8457 2 281 3.60.15.10
6c2cA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.823 2 281 3.60.15.10
af_Q1RLT7_510_602_3.40.20.10 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.8166 56 69 3.40.20.10
4le6E00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.813 1 281 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A1I4KWK1-F1-model_v4 deleted 0.998 1 281
AF-A0A1M5XB41-F1-model_v4 Glyoxylase, beta-lactamase superfamily II 0.9966 1 280
AF-A0A4V1KYQ1-F1-model_v4 deleted 0.9965 1 281
AF-A0A1Y2K0Y8-F1-model_v4 MBL fold metallo-hydrolase 0.9951 165 281 GO:0016787
AF-A0A1I4KWK1-F1-model_v4 deleted 0.9945 1 281

Feature Viewer

pLDDT pTM Quality
96.91 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map