F432230

General Info

Members Datasets Scaffolds Average Seq Length
392 199 784 113

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_101036487|Ga0070683_1010364872
Length 126
Sequence MEQWSDMSTPFEDIEARLRAALSPIEPPTHLQLRLEATLGELVELAADELEAWELKAMRDPRNWPRAVVPATAAVVGSGAAVGLVVLRTQRKRHKRRAQSRGARDLAVRTLKDAGREARKVLDEFR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
132 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
133 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
134 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 3.06
Rhizosphere 95.41
Stem 0
Stem Tuber 0
Unclassified 6.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_101036487 3300005329 Bacteria 788
2 JGI25406J46586_10026896 3300003203 Bacteria 2212
3 Ga0070658_10662471 3300005327 Bacteria 906
4 Ga0070683_100540953 3300005329 Bacteria 1113
5 Ga0070683_100822550 3300005329 Bacteria 891
6 Ga0070690_100867782 3300005330 Bacteria 704
7 Ga0070690_101567502 3300005330 Unclassified 533
8 Ga0070677_10276676 3300005333 Bacteria 844
9 Ga0068868_100145618 3300005338 Bacteria 1948
10 Ga0068868_100739494 3300005338 Unclassified 883
11 Ga0070691_10873221 3300005341 Unclassified 553
12 Ga0070687_100258349 3300005343 Bacteria 1086
13 Ga0070661_101618764 3300005344 Bacteria 548
14 Ga0070692_10478321 3300005345 Bacteria 803
15 Ga0070668_100235871 3300005347 Bacteria 1514
16 Ga0070668_100341612 3300005347 Bacteria 1265
17 Ga0070668_100589149 3300005347 Bacteria 972
18 Ga0070668_101103782 3300005347 Bacteria 716
19 Ga0070669_100118457 3300005353 Bacteria 2017
20 Ga0070675_100108131 3300005354 Bacteria 2349
21 Ga0070671_100383234 3300005355 Bacteria 1202
22 Ga0070671_101108565 3300005355 Bacteria 695
23 Ga0070674_100107306 3300005356 Bacteria 2044
24 Ga0070674_100123126 3300005356 Bacteria 1922
25 Ga0070659_100082475 3300005366 Bacteria 2568
26 Ga0070659_100326903 3300005366 Bacteria 1283
27 Ga0070659_100976709 3300005366 Bacteria 743
28 Ga0070709_11138679 3300005434 Bacteria 625
29 Ga0070714_100978655 3300005435 Bacteria 823
30 Ga0070714_102083477 3300005435 Bacteria 553
31 Ga0070713_100240646 3300005436 Bacteria 1648
32 Ga0070713_101646510 3300005436 Bacteria 623
33 Ga0070701_10373467 3300005438 Bacteria 897
34 Ga0070700_100086513 3300005441 Bacteria 2035
35 Ga0070700_100206074 3300005441 Bacteria 1385
36 Ga0070700_100452074 3300005441 Bacteria 978
37 Ga0070700_100798890 3300005441 Bacteria 760
38 Ga0070663_100563100 3300005455 Bacteria 954
39 Ga0070663_100654039 3300005455 Unclassified 889
40 Ga0070663_101548407 3300005455 Bacteria 590
41 Ga0070662_100375934 3300005457 Bacteria 1169
42 Ga0070662_101162374 3300005457 Bacteria 663
43 Ga0070662_101763819 3300005457 Bacteria 535
44 Ga0068867_100217862 3300005459 Bacteria 1537
45 Ga0068867_100491068 3300005459 Bacteria 1054
46 Ga0068867_101887715 3300005459 Bacteria 563
47 Ga0070679_101168306 3300005530 Bacteria 715
48 Ga0070679_101783514 3300005530 Bacteria 564
49 Ga0070684_100334068 3300005535 Bacteria 1393
50 Ga0070684_101507188 3300005535 Unclassified 634
51 Ga0068853_102274091 3300005539 Bacteria 525
52 Ga0070672_100161089 3300005543 Bacteria 1862
53 Ga0070672_100232881 3300005543 Bacteria 1548
54 Ga0070672_100760399 3300005543 Bacteria 851
55 Ga0070693_100287881 3300005547 Bacteria 1103
56 Ga0070665_100475139 3300005548 Bacteria 1261
57 Ga0070665_100753543 3300005548 Bacteria 987
58 Ga0070704_100899613 3300005549 Bacteria 796
59 Ga0070664_100254075 3300005564 Bacteria 1580
60 Ga0070664_100480917 3300005564 Bacteria 1143
61 Ga0070664_100715568 3300005564 Bacteria 933
62 Ga0068857_101749991 3300005577 Bacteria 608
63 Ga0068857_102041604 3300005577 Bacteria 562
64 Ga0068854_100890310 3300005578 Bacteria 782
65 Ga0068856_101452656 3300005614 Bacteria 700
66 Ga0070702_101308949 3300005615 Bacteria 589
67 Ga0068852_100196438 3300005616 Bacteria 1907
68 Ga0068852_100490768 3300005616 Bacteria 1222
69 Ga0068859_101660638 3300005617 Bacteria 706
70 Ga0068859_101954843 3300005617 Bacteria 648
71 Ga0068864_100297617 3300005618 Bacteria 1510
72 Ga0068866_10395782 3300005718 Bacteria 890
73 Ga0068866_11055269 3300005718 Bacteria 580
74 Ga0068861_100616765 3300005719 Bacteria 998
75 Ga0068870_10341585 3300005840 Bacteria 958
76 Ga0068870_10796586 3300005840 Bacteria 660
77 Ga0068863_102409376 3300005841 Bacteria 536
78 Ga0068863_102648120 3300005841 Unclassified 510
79 Ga0068858_100123780 3300005842 Bacteria 2420
80 Ga0068858_101960901 3300005842 Bacteria 579
81 Ga0068862_100780443 3300005844 Bacteria 932
82 Ga0068862_102123631 3300005844 Bacteria 573
83 Ga0081455_10042817 3300005937 Bacteria 3967
84 Ga0081455_10139664 3300005937 Bacteria 1883
85 Ga0081455_10187027 3300005937 Bacteria 1563
86 Ga0081538_10016068 3300005981 Bacteria 5757
87 Ga0081538_10018913 3300005981 Bacteria 5148
88 Ga0081538_10089397 3300005981 Bacteria 1599
89 Ga0081538_10144042 3300005981 Bacteria 1093
90 Ga0081539_10001430 3300005985 Bacteria 40918
91 Ga0081539_10012315 3300005985 Bacteria 6614
92 Ga0070717_10069587 3300006028 Bacteria 2931
93 Ga0075432_10100651 3300006058 Bacteria 1067
94 Ga0070712_100032587 3300006175 Bacteria 3520
95 Ga0070712_100488386 3300006175 Bacteria 1031
96 Ga0075428_100047874 3300006844 Bacteria 4695
97 Ga0075428_100405103 3300006844 Bacteria 1462
98 Ga0075428_100954176 3300006844 Bacteria 909
99 Ga0075428_101174200 3300006844 Bacteria 809
100 Ga0075428_101904866 3300006844 Bacteria 617
101 Ga0075430_100549294 3300006846 Bacteria 953
102 Ga0075430_101174220 3300006846 Bacteria 632
103 Ga0075430_101634988 3300006846 Bacteria 529
104 Ga0068865_100250872 3300006881 Bacteria 1397
105 Ga0068865_100285042 3300006881 Bacteria 1316
106 Ga0068865_100340634 3300006881 Bacteria 1212
107 Ga0097620_101660553 3300006931 Bacteria 706
108 Ga0097620_101954914 3300006931 Bacteria 648
109 Ga0075435_100634765 3300007076 Bacteria 927
110 Ga0111539_10045161 3300009094 Bacteria 5275
111 Ga0111539_10565074 3300009094 Bacteria 1325
112 Ga0111539_11033417 3300009094 Bacteria 955
113 Ga0111539_11236297 3300009094 Bacteria 867
114 Ga0111539_11872113 3300009094 Bacteria 696
115 Ga0105245_10062644 3300009098 Bacteria 3356
116 Ga0105245_11414838 3300009098 Bacteria 746
117 Ga0105245_11436491 3300009098 Bacteria 740
118 Ga0114129_10257817 3300009147 Bacteria 2339
119 Ga0105243_10137786 3300009148 Bacteria 2078
120 Ga0105243_10189510 3300009148 Bacteria 1795
121 Ga0105243_10228617 3300009148 Bacteria 1649
122 Ga0105241_11141248 3300009174 Unclassified 736
123 Ga0105242_10246100 3300009176 Bacteria 1609
124 Ga0105242_11722116 3300009176 Unclassified 663
125 Ga0105248_12681384 3300009177 Unclassified 568
126 Ga0105246_10651565 3300011119 Bacteria 917
127 Ga0105246_10963312 3300011119 Bacteria 770
128 Ga0157371_10295450 3300013102 Bacteria 1172
129 Ga0157369_11074010 3300013105 Bacteria 823
130 Ga0157369_11957401 3300013105 Bacteria 595
131 Ga0157372_10091018 3300013307 Bacteria 3469
132 Ga0157372_10182611 3300013307 Bacteria 2429
133 Ga0157372_12629642 3300013307 Unclassified 578
134 Ga0157375_10802405 3300013308 Bacteria 1090
135 Ga0163163_10260772 3300014325 Bacteria 1784
136 Ga0163163_12926196 3300014325 Unclassified 533
137 Ga0157380_10276742 3300014326 Bacteria 1533
138 Ga0157380_11856426 3300014326 Bacteria 662
139 Ga0157377_10068523 3300014745 Bacteria 2045
140 Ga0157379_10771686 3300014968 Bacteria 906
141 Ga0207642_10367135 3300025899 Bacteria 853
142 Ga0207688_10194357 3300025901 Bacteria 1215
143 Ga0207688_10415065 3300025901 Bacteria 836
144 Ga0207645_10238337 3300025907 Bacteria 1202
145 Ga0207645_10425998 3300025907 Bacteria 894
146 Ga0207643_10135084 3300025908 Bacteria 1470
147 Ga0207643_10135594 3300025908 Bacteria 1467
148 Ga0207705_10210739 3300025909 Bacteria 1474
149 Ga0207705_10684931 3300025909 Unclassified 797
150 Ga0207693_10253087 3300025915 Bacteria 1382
151 Ga0207660_10262189 3300025917 Bacteria 1367
152 Ga0207662_10216024 3300025918 Bacteria 1247
153 Ga0207657_11238860 3300025919 Bacteria 566
154 Ga0207652_10749722 3300025921 Bacteria 869
155 Ga0207652_10993979 3300025921 Bacteria 738
156 Ga0207681_10308680 3300025923 Bacteria 1254
157 Ga0207659_10111415 3300025926 Bacteria 2081
158 Ga0207659_10381958 3300025926 Bacteria 1175
159 Ga0207687_10701251 3300025927 Bacteria 859
160 Ga0207664_10202148 3300025929 Bacteria 1716
161 Ga0207644_10339157 3300025931 Bacteria 1219
162 Ga0207644_11746641 3300025931 Bacteria 521
163 Ga0207690_10455973 3300025932 Bacteria 1028
164 Ga0207690_10654657 3300025932 Bacteria 861
165 Ga0207706_10103048 3300025933 Bacteria 2510
166 Ga0207706_10722318 3300025933 Bacteria 850
167 Ga0207706_10766837 3300025933 Bacteria 821
168 Ga0207686_10445947 3300025934 Bacteria 995
169 Ga0207669_10205959 3300025937 Bacteria 1432
170 Ga0207669_10576776 3300025937 Unclassified 911
171 Ga0207669_11216732 3300025937 Bacteria 638
172 Ga0207704_10150608 3300025938 Bacteria 1641
173 Ga0207691_10487399 3300025940 Bacteria 1047
174 Ga0207691_10619968 3300025940 Bacteria 915
175 Ga0207689_10145406 3300025942 Bacteria 1953
176 Ga0207661_10069649 3300025944 Bacteria 2869
177 Ga0207661_10759825 3300025944 Bacteria 892
178 Ga0207679_10214631 3300025945 Bacteria 1616
179 Ga0207679_10238587 3300025945 Bacteria 1539
180 Ga0207651_11773708 3300025960 Bacteria 556
181 Ga0207712_10366995 3300025961 Bacteria 1201
182 Ga0207712_10814062 3300025961 Bacteria 822
183 Ga0207668_10258685 3300025972 Bacteria 1417
184 Ga0207668_10317789 3300025972 Bacteria 1291
185 Ga0207668_10757528 3300025972 Bacteria 857
186 Ga0207640_10831164 3300025981 Bacteria 802
187 Ga0207640_11348144 3300025981 Unclassified 638
188 Ga0207640_11597644 3300025981 Bacteria 587
189 Ga0207677_10524049 3300026023 Bacteria 1028
190 Ga0207677_11563907 3300026023 Bacteria 610
191 Ga0207703_10061931 3300026035 Bacteria 3065
192 Ga0207703_11505439 3300026035 Bacteria 647
193 Ga0207678_10506257 3300026067 Bacteria 1053
194 Ga0207678_10552941 3300026067 Bacteria 1007
195 Ga0207708_10025551 3300026075 Bacteria 4470
196 Ga0207708_10187843 3300026075 Bacteria 1643
197 Ga0207708_10467397 3300026075 Bacteria 1053
198 Ga0207708_10559768 3300026075 Bacteria 965
199 Ga0207702_10780510 3300026078 Bacteria 944
200 Ga0207648_10160149 3300026089 Bacteria 1988
201 Ga0207648_10232139 3300026089 Bacteria 1641
202 Ga0207648_10802752 3300026089 Bacteria 876
203 Ga0207676_10385831 3300026095 Bacteria 1305
204 Ga0207674_11039707 3300026116 Bacteria 788
205 Ga0207675_100064486 3300026118 Bacteria 3424
206 Ga0207675_101222730 3300026118 Bacteria 772
207 Ga0207683_10266197 3300026121 Bacteria 1565
208 Ga0207683_10499223 3300026121 Bacteria 1124
209 Ga0207683_12094380 3300026121 Bacteria 514
210 Ga0207698_10139037 3300026142 Bacteria 2089
211 Ga0207428_10134813 3300027907 Bacteria 1888
212 Ga0207428_10763547 3300027907 Bacteria 688
213 Ga0268266_10646221 3300028379 Bacteria 1018
214 Ga0268265_10550405 3300028380 Bacteria 1095
215 Ga0268265_10572508 3300028380 Bacteria 1075
216 Ga0307408_100936886 3300031548 Bacteria 795
217 Ga0307408_100966339 3300031548 Bacteria 783
218 Ga0307413_10106577 3300031824 Bacteria 1866
219 Ga0307413_10240376 3300031824 Bacteria 1337
220 Ga0307413_11577300 3300031824 Bacteria 582
221 Ga0307410_10101503 3300031852 Bacteria 2063
222 Ga0307406_10071555 3300031901 Bacteria 2273
223 Ga0307406_10463757 3300031901 Bacteria 1019
224 Ga0307406_10508196 3300031901 Bacteria 978
225 Ga0307406_11028408 3300031901 Unclassified 708
226 Ga0307407_10080260 3300031903 Bacteria 1971
227 Ga0307407_10115088 3300031903 Bacteria 1695
228 Ga0307407_10453711 3300031903 Bacteria 931
229 Ga0307407_10530282 3300031903 Bacteria 867
230 Ga0307407_10606538 3300031903 Bacteria 816
231 Ga0307407_10685767 3300031903 Unclassified 770
232 Ga0307412_11017856 3300031911 Bacteria 733
233 Ga0307409_100373784 3300031995 Bacteria 1352
234 Ga0307409_100567159 3300031995 Bacteria 1117
235 Ga0307409_100749854 3300031995 Bacteria 980
236 Ga0307409_101580702 3300031995 Unclassified 684
237 Ga0307416_100064420 3300032002 Bacteria 3007
238 Ga0307416_101174884 3300032002 Bacteria 873
239 Ga0307416_101484794 3300032002 Bacteria 784
240 Ga0307416_103372795 3300032002 Unclassified 535
241 Ga0307414_10743486 3300032004 Bacteria 891
242 Ga0307414_10778792 3300032004 Bacteria 871
243 Ga0307411_10087242 3300032005 Bacteria 2167
244 Ga0307411_12121193 3300032005 Unclassified 526
245 Ga0307415_100068040 3300032126 Bacteria 2491
246 Ga0307415_100368729 3300032126 Bacteria 1215
247 Ga0307415_100553281 3300032126 Bacteria 1016
248 Ga0307415_100959369 3300032126 Bacteria 792
249 Ga0307415_101055241 3300032126 Unclassified 758
250 Ga0307415_101060125 3300032126 Bacteria 757
251 Ga0307415_101065886 3300032126 Unclassified 755
252 Ga0307415_101981875 3300032126 Bacteria 567
253 Ga0373937_1066512 3300036401 Unclassified 757
254 Ga0395901_0787371 3300038443 Bacteria 941
255 Ga0436365_1073675 3300039437 Bacteria 1090
256 Ga0436360_1171193 3300039438 Bacteria 704
257 Ga0436363_0938328 3300039450 Bacteria 708
258 Ga0450912_022800 3300042116 Bacteria 614
259 Ga0439464_0025410 3300042439 Bacteria 1640
260 Ga0450916_036924 3300042530 Bacteria 731
261 Ga0439440_0260714 3300042993 Bacteria 530
262 Ga0466964_0184263 3300044706 Bacteria 992
263 Ga0466971_0093775 3300044719 Bacteria 1376
264 Ga0466968_0305538 3300044735 Bacteria 766
265 Ga0466960_0686907 3300044901 Bacteria 613
266 Ga0466967_0678065 3300045976 Bacteria 1020
267 Ga0466967_0724996 3300045976 Bacteria 985
268 Ga0466967_0792062 3300045976 Bacteria 941
269 Ga0466967_0919823 3300045976 Bacteria 870
270 Ga0466967_1004783 3300045976 Bacteria 830
271 Ga0495664_0268324 3300046477 Bacteria 1031
272 Ga0495596_0077064 3300046500 Bacteria 1295
273 Ga0495630_0344207 3300046517 Bacteria 1141
274 Ga0495643_0197446 3300046522 Bacteria 968
275 Ga0495644_0373769 3300046523 Bacteria 563
276 Ga0495652_0413247 3300046529 Unclassified 952
277 Ga0495586_0270113 3300046535 Bacteria 972
278 Ga0495586_0825856 3300046535 Bacteria 534
279 Ga0495658_0466398 3300046683 Bacteria 807
280 Ga0495602_0543547 3300048088 Bacteria 806
281 Ga0496100_0004433 3300048903 Bacteria 7440
282 Ga0496100_1444675 3300048903 Bacteria 543
283 Ga0496101_0274931 3300048904 Bacteria 1315
284 Ga0496102_0032856 3300048905 Bacteria 4663
285 Ga0496102_0719615 3300048905 Bacteria 921
286 Ga0496106_0070239 3300048909 Bacteria 2674
287 Ga0496106_0613430 3300048909 Bacteria 871
288 Ga0496107_0002231 3300048910 Bacteria 12475
289 Ga0496109_0791910 3300048912 Bacteria 886
290 Ga0496110_0695928 3300048913 Bacteria 918
291 Ga0496110_0745443 3300048913 Bacteria 882
292 Ga0496115_0121206 3300048918 Bacteria 2152
293 Ga0496126_0245802 3300048929 Bacteria 1493
294 Ga0501031_0075013 3300049568 Bacteria 2202
295 Ga0501031_0119901 3300049568 Bacteria 1718
296 Ga0501031_0154722 3300049568 Bacteria 1498
297 Ga0501031_0326810 3300049568 Bacteria 993
298 Ga0501032_0151163 3300049569 Bacteria 1527
299 Ga0501032_0246828 3300049569 Bacteria 1159
300 Ga0501032_0305216 3300049569 Bacteria 1029
301 Ga0501032_0750944 3300049569 Bacteria 617
302 Ga0501034_0826679 3300049571 Bacteria 818
303 Ga0501036_0085862 3300049572 Bacteria 2660
304 Ga0501036_0122172 3300049572 Bacteria 2199
305 Ga0501036_0205134 3300049572 Bacteria 1657
306 Ga0501037_0857056 3300049573 Bacteria 597
307 Ga0501038_0150625 3300049574 Bacteria 1897
308 Ga0501038_0312279 3300049574 Bacteria 1231
309 Ga0501038_0611667 3300049574 Bacteria 823
310 Ga0501039_0002539 3300049575 Bacteria 13625
311 Ga0501039_0126524 3300049575 Bacteria 2004
312 Ga0501039_0137065 3300049575 Bacteria 1922
313 Ga0501039_0474396 3300049575 Bacteria 982
314 Ga0501039_0776240 3300049575 Bacteria 748
315 Ga0501040_0084780 3300049576 Bacteria 2198
316 Ga0501040_0184534 3300049576 Bacteria 1479
317 Ga0501040_0215826 3300049576 Bacteria 1364
318 Ga0501041_0012134 3300049577 Bacteria 5102
319 Ga0501041_0038545 3300049577 Bacteria 2898
320 Ga0501041_0066540 3300049577 Bacteria 2208
321 Ga0501042_0047670 3300049578 Bacteria 3055
322 Ga0501042_0564333 3300049578 Bacteria 827
323 Ga0501042_0587961 3300049578 Bacteria 809
324 Ga0501046_0101343 3300049580 Bacteria 2209
325 Ga0501046_0324675 3300049580 Bacteria 1121
326 Ga0501048_0156762 3300049582 Bacteria 1611
327 Ga0501048_0467116 3300049582 Bacteria 904
328 Ga0501048_0476999 3300049582 Bacteria 894
329 Ga0501048_0512385 3300049582 Bacteria 860
330 Ga0501048_0714538 3300049582 Bacteria 720
331 Ga0501069_0333197 3300049585 Bacteria 893
332 Ga0501070_1335636 3300049586 Bacteria 546
333 Ga0501071_0028690 3300049587 Bacteria 3923
334 Ga0501071_0065557 3300049587 Bacteria 2637
335 Ga0501071_0231376 3300049587 Bacteria 1392
336 Ga0501072_0019433 3300049588 Bacteria 5251
337 Ga0501072_0035856 3300049588 Bacteria 3887
338 Ga0501072_0082215 3300049588 Bacteria 2553
339 Ga0501072_0456157 3300049588 Bacteria 1012
340 Ga0501073_0490062 3300049589 Bacteria 850
341 Ga0501074_0203072 3300049590 Bacteria 1412
342 Ga0501074_0246123 3300049590 Bacteria 1271
343 Ga0501074_0439492 3300049590 Bacteria 925
344 Ga0501075_0189324 3300049591 Bacteria 1569
345 Ga0501075_0254961 3300049591 Bacteria 1337
346 Ga0501075_0292264 3300049591 Bacteria 1241
347 Ga0501076_0057631 3300049592 Bacteria 3085
348 Ga0501076_0254911 3300049592 Bacteria 1436
349 Ga0501076_0386436 3300049592 Bacteria 1150
350 Ga0501077_0017813 3300049593 Bacteria 4488
351 Ga0501077_0708131 3300049593 Bacteria 647
352 Ga0501079_0066688 3300049741 Bacteria 2777
353 Ga0501079_0100941 3300049741 Bacteria 2237
354 Ga0501079_0215895 3300049741 Bacteria 1498
355 Ga0501080_0307266 3300049742 Bacteria 1438
356 Ga0501080_0455600 3300049742 Bacteria 1146
357 Ga0501081_0025315 3300049743 Bacteria 3991
358 Ga0501081_0050304 3300049743 Bacteria 2871
359 Ga0501081_0548752 3300049743 Bacteria 863
360 Ga0501083_0578623 3300049744 Unclassified 731
361 Ga0501035_0086050 3300049822 Bacteria 2770
362 Ga0501035_0878273 3300049822 Bacteria 711
363 Ga0501035_1170511 3300049822 Bacteria 598
364 Ga0501044_0422590 3300049823 Bacteria 1243
365 Ga0501044_0479400 3300049823 Bacteria 1147
366 Ga0501045_0021108 3300049824 Bacteria 4657
367 Ga0501045_0088879 3300049824 Bacteria 2282
368 Ga0501045_0676407 3300049824 Bacteria 762
369 nmdc:mga0yw44_907523_c1 3300050492 Bacteria 597
370 nmdc:mga09592_540232_c1 3300050508 Bacteria 1001
371 nmdc:mga0qj67_513706_c1 3300050509 Bacteria 962
372 nmdc:mga08y16_287429_c1 3300050511 Bacteria 1695
373 nmdc:mga08y16_308442_c1 3300050511 Bacteria 1630
374 nmdc:mga08y16_73368_c1 3300050511 Bacteria 3566
375 nmdc:mga08y16_778824_c1 3300050511 Bacteria 951
376 nmdc:mga0rr50_824934_c1 3300050513 Bacteria 791
377 nmdc:mga0a205_1487849_c1 3300050515 Unclassified 525
378 Ga0495601_0762982 3300053077 Bacteria 615
379 Ga0500588_0231980 3300053146 Bacteria 690
380 Ga0500616_0044024 3300053153 Bacteria 2384
381 Ga0501084_0101969 3300054114 Bacteria 2410
382 Ga0501084_0121892 3300054114 Bacteria 2192
383 Ga0501084_0310999 3300054114 Bacteria 1330
384 Ga0590075_204381 3300059424 Unclassified 523
385 Ga0501082_0187344 3300060353 Bacteria 1800
386 Ga0501082_0213705 3300060353 Bacteria 1678
387 Ga0501082_0333329 3300060353 Bacteria 1322
388 Ga0466962_0524340 3300061719 Bacteria 601
389 Ga0530510_0009340 3300061734 Bacteria 6877
390 Ga0530510_0138969 3300061734 Bacteria 1789
391 Ga0530510_0270050 3300061734 Bacteria 1269
392 Ga0530510_0280547 3300061734 Bacteria 1244
393 Ga0070683_101036487
394 JGI25406J46586_10026896
395 Ga0070658_10662471
396 Ga0070683_100540953
397 Ga0070683_100822550
398 Ga0070690_100867782
399 Ga0070690_101567502
400 Ga0070677_10276676
401 Ga0068868_100145618
402 Ga0068868_100739494
403 Ga0070691_10873221
404 Ga0070687_100258349
405 Ga0070661_101618764
406 Ga0070692_10478321
407 Ga0070668_100235871
408 Ga0070668_100341612
409 Ga0070668_100589149
410 Ga0070668_101103782
411 Ga0070669_100118457
412 Ga0070675_100108131
413 Ga0070671_100383234
414 Ga0070671_101108565
415 Ga0070674_100107306
416 Ga0070674_100123126
417 Ga0070659_100082475
418 Ga0070659_100326903
419 Ga0070659_100976709
420 Ga0070709_11138679
421 Ga0070714_100978655
422 Ga0070714_102083477
423 Ga0070713_100240646
424 Ga0070713_101646510
425 Ga0070701_10373467
426 Ga0070700_100086513
427 Ga0070700_100206074
428 Ga0070700_100452074
429 Ga0070700_100798890
430 Ga0070663_100563100
431 Ga0070663_100654039
432 Ga0070663_101548407
433 Ga0070662_100375934
434 Ga0070662_101162374
435 Ga0070662_101763819
436 Ga0068867_100217862
437 Ga0068867_100491068
438 Ga0068867_101887715
439 Ga0070679_101168306
440 Ga0070679_101783514
441 Ga0070684_100334068
442 Ga0070684_101507188
443 Ga0068853_102274091
444 Ga0070672_100161089
445 Ga0070672_100232881
446 Ga0070672_100760399
447 Ga0070693_100287881
448 Ga0070665_100475139
449 Ga0070665_100753543
450 Ga0070704_100899613
451 Ga0070664_100254075
452 Ga0070664_100480917
453 Ga0070664_100715568
454 Ga0068857_101749991
455 Ga0068857_102041604
456 Ga0068854_100890310
457 Ga0068856_101452656
458 Ga0070702_101308949
459 Ga0068852_100196438
460 Ga0068852_100490768
461 Ga0068859_101660638
462 Ga0068859_101954843
463 Ga0068864_100297617
464 Ga0068866_10395782
465 Ga0068866_11055269
466 Ga0068861_100616765
467 Ga0068870_10341585
468 Ga0068870_10796586
469 Ga0068863_102409376
470 Ga0068863_102648120
471 Ga0068858_100123780
472 Ga0068858_101960901
473 Ga0068862_100780443
474 Ga0068862_102123631
475 Ga0081455_10042817
476 Ga0081455_10139664
477 Ga0081455_10187027
478 Ga0081538_10016068
479 Ga0081538_10018913
480 Ga0081538_10089397
481 Ga0081538_10144042
482 Ga0081539_10001430
483 Ga0081539_10012315
484 Ga0070717_10069587
485 Ga0075432_10100651
486 Ga0070712_100032587
487 Ga0070712_100488386
488 Ga0075428_100047874
489 Ga0075428_100405103
490 Ga0075428_100954176
491 Ga0075428_101174200
492 Ga0075428_101904866
493 Ga0075430_100549294
494 Ga0075430_101174220
495 Ga0075430_101634988
496 Ga0068865_100250872
497 Ga0068865_100285042
498 Ga0068865_100340634
499 Ga0097620_101660553
500 Ga0097620_101954914
501 Ga0075435_100634765
502 Ga0111539_10045161
503 Ga0111539_10565074
504 Ga0111539_11033417
505 Ga0111539_11236297
506 Ga0111539_11872113
507 Ga0105245_10062644
508 Ga0105245_11414838
509 Ga0105245_11436491
510 Ga0114129_10257817
511 Ga0105243_10137786
512 Ga0105243_10189510
513 Ga0105243_10228617
514 Ga0105241_11141248
515 Ga0105242_10246100
516 Ga0105242_11722116
517 Ga0105248_12681384
518 Ga0105246_10651565
519 Ga0105246_10963312
520 Ga0157371_10295450
521 Ga0157369_11074010
522 Ga0157369_11957401
523 Ga0157372_10091018
524 Ga0157372_10182611
525 Ga0157372_12629642
526 Ga0157375_10802405
527 Ga0163163_10260772
528 Ga0163163_12926196
529 Ga0157380_10276742
530 Ga0157380_11856426
531 Ga0157377_10068523
532 Ga0157379_10771686
533 Ga0207642_10367135
534 Ga0207688_10194357
535 Ga0207688_10415065
536 Ga0207645_10238337
537 Ga0207645_10425998
538 Ga0207643_10135084
539 Ga0207643_10135594
540 Ga0207705_10210739
541 Ga0207705_10684931
542 Ga0207693_10253087
543 Ga0207660_10262189
544 Ga0207662_10216024
545 Ga0207657_11238860
546 Ga0207652_10749722
547 Ga0207652_10993979
548 Ga0207681_10308680
549 Ga0207659_10111415
550 Ga0207659_10381958
551 Ga0207687_10701251
552 Ga0207664_10202148
553 Ga0207644_10339157
554 Ga0207644_11746641
555 Ga0207690_10455973
556 Ga0207690_10654657
557 Ga0207706_10103048
558 Ga0207706_10722318
559 Ga0207706_10766837
560 Ga0207686_10445947
561 Ga0207669_10205959
562 Ga0207669_10576776
563 Ga0207669_11216732
564 Ga0207704_10150608
565 Ga0207691_10487399
566 Ga0207691_10619968
567 Ga0207689_10145406
568 Ga0207661_10069649
569 Ga0207661_10759825
570 Ga0207679_10214631
571 Ga0207679_10238587
572 Ga0207651_11773708
573 Ga0207712_10366995
574 Ga0207712_10814062
575 Ga0207668_10258685
576 Ga0207668_10317789
577 Ga0207668_10757528
578 Ga0207640_10831164
579 Ga0207640_11348144
580 Ga0207640_11597644
581 Ga0207677_10524049
582 Ga0207677_11563907
583 Ga0207703_10061931
584 Ga0207703_11505439
585 Ga0207678_10506257
586 Ga0207678_10552941
587 Ga0207708_10025551
588 Ga0207708_10187843
589 Ga0207708_10467397
590 Ga0207708_10559768
591 Ga0207702_10780510
592 Ga0207648_10160149
593 Ga0207648_10232139
594 Ga0207648_10802752
595 Ga0207676_10385831
596 Ga0207674_11039707
597 Ga0207675_100064486
598 Ga0207675_101222730
599 Ga0207683_10266197
600 Ga0207683_10499223
601 Ga0207683_12094380
602 Ga0207698_10139037
603 Ga0207428_10134813
604 Ga0207428_10763547
605 Ga0268266_10646221
606 Ga0268265_10550405
607 Ga0268265_10572508
608 Ga0307408_100936886
609 Ga0307408_100966339
610 Ga0307413_10106577
611 Ga0307413_10240376
612 Ga0307413_11577300
613 Ga0307410_10101503
614 Ga0307406_10071555
615 Ga0307406_10463757
616 Ga0307406_10508196
617 Ga0307406_11028408
618 Ga0307407_10080260
619 Ga0307407_10115088
620 Ga0307407_10453711
621 Ga0307407_10530282
622 Ga0307407_10606538
623 Ga0307407_10685767
624 Ga0307412_11017856
625 Ga0307409_100373784
626 Ga0307409_100567159
627 Ga0307409_100749854
628 Ga0307409_101580702
629 Ga0307416_100064420
630 Ga0307416_101174884
631 Ga0307416_101484794
632 Ga0307416_103372795
633 Ga0307414_10743486
634 Ga0307414_10778792
635 Ga0307411_10087242
636 Ga0307411_12121193
637 Ga0307415_100068040
638 Ga0307415_100368729
639 Ga0307415_100553281
640 Ga0307415_100959369
641 Ga0307415_101055241
642 Ga0307415_101060125
643 Ga0307415_101065886
644 Ga0307415_101981875
645 Ga0373937_1066512
646 Ga0395901_0787371
647 Ga0436365_1073675
648 Ga0436360_1171193
649 Ga0436363_0938328
650 Ga0450912_022800
651 Ga0439464_0025410
652 Ga0450916_036924
653 Ga0439440_0260714
654 Ga0466964_0184263
655 Ga0466971_0093775
656 Ga0466968_0305538
657 Ga0466960_0686907
658 Ga0466967_0678065
659 Ga0466967_0724996
660 Ga0466967_0792062
661 Ga0466967_0919823
662 Ga0466967_1004783
663 Ga0495664_0268324
664 Ga0495596_0077064
665 Ga0495630_0344207
666 Ga0495643_0197446
667 Ga0495644_0373769
668 Ga0495652_0413247
669 Ga0495586_0270113
670 Ga0495586_0825856
671 Ga0495658_0466398
672 Ga0495602_0543547
673 Ga0496100_0004433
674 Ga0496100_1444675
675 Ga0496101_0274931
676 Ga0496102_0032856
677 Ga0496102_0719615
678 Ga0496106_0070239
679 Ga0496106_0613430
680 Ga0496107_0002231
681 Ga0496109_0791910
682 Ga0496110_0695928
683 Ga0496110_0745443
684 Ga0496115_0121206
685 Ga0496126_0245802
686 Ga0501031_0075013
687 Ga0501031_0119901
688 Ga0501031_0154722
689 Ga0501031_0326810
690 Ga0501032_0151163
691 Ga0501032_0246828
692 Ga0501032_0305216
693 Ga0501032_0750944
694 Ga0501034_0826679
695 Ga0501036_0085862
696 Ga0501036_0122172
697 Ga0501036_0205134
698 Ga0501037_0857056
699 Ga0501038_0150625
700 Ga0501038_0312279
701 Ga0501038_0611667
702 Ga0501039_0002539
703 Ga0501039_0126524
704 Ga0501039_0137065
705 Ga0501039_0474396
706 Ga0501039_0776240
707 Ga0501040_0084780
708 Ga0501040_0184534
709 Ga0501040_0215826
710 Ga0501041_0012134
711 Ga0501041_0038545
712 Ga0501041_0066540
713 Ga0501042_0047670
714 Ga0501042_0564333
715 Ga0501042_0587961
716 Ga0501046_0101343
717 Ga0501046_0324675
718 Ga0501048_0156762
719 Ga0501048_0467116
720 Ga0501048_0476999
721 Ga0501048_0512385
722 Ga0501048_0714538
723 Ga0501069_0333197
724 Ga0501070_1335636
725 Ga0501071_0028690
726 Ga0501071_0065557
727 Ga0501071_0231376
728 Ga0501072_0019433
729 Ga0501072_0035856
730 Ga0501072_0082215
731 Ga0501072_0456157
732 Ga0501073_0490062
733 Ga0501074_0203072
734 Ga0501074_0246123
735 Ga0501074_0439492
736 Ga0501075_0189324
737 Ga0501075_0254961
738 Ga0501075_0292264
739 Ga0501076_0057631
740 Ga0501076_0254911
741 Ga0501076_0386436
742 Ga0501077_0017813
743 Ga0501077_0708131
744 Ga0501079_0066688
745 Ga0501079_0100941
746 Ga0501079_0215895
747 Ga0501080_0307266
748 Ga0501080_0455600
749 Ga0501081_0025315
750 Ga0501081_0050304
751 Ga0501081_0548752
752 Ga0501083_0578623
753 Ga0501035_0086050
754 Ga0501035_0878273
755 Ga0501035_1170511
756 Ga0501044_0422590
757 Ga0501044_0479400
758 Ga0501045_0021108
759 Ga0501045_0088879
760 Ga0501045_0676407
761 nmdc:mga0yw44_907523_c1
762 nmdc:mga09592_540232_c1
763 nmdc:mga0qj67_513706_c1
764 nmdc:mga08y16_287429_c1
765 nmdc:mga08y16_308442_c1
766 nmdc:mga08y16_73368_c1
767 nmdc:mga08y16_778824_c1
768 nmdc:mga0rr50_824934_c1
769 nmdc:mga0a205_1487849_c1
770 Ga0495601_0762982
771 Ga0500588_0231980
772 Ga0500616_0044024
773 Ga0501084_0101969
774 Ga0501084_0121892
775 Ga0501084_0310999
776 Ga0590075_204381
777 Ga0501082_0187344
778 Ga0501082_0213705
779 Ga0501082_0333329
780 Ga0466962_0524340
781 Ga0530510_0009340
782 Ga0530510_0138969
783 Ga0530510_0270050
784 Ga0530510_0280547

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map