F432216

General Info

Members Datasets Scaffolds Average Seq Length
392 219 784 323

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10000691|JGI25407J50210_100006913
Length 333
Sequence VRAVQITELSGPRSALAIADLPEPEPSHMLTPGSGVLVDVHAAGVSFPELLQTRGQYQVKPPLPFVPGSEVGGTVRSAPDGAGVSEGDRVAAFCMLGGFAEVAVAPEFLTFPLSSELDFAQGAGLILNYHTAYFALVLRGRLAEGESVLVHGAAGGVGTAALQVAKGLGARAIAVVSSDEKQRVARAAGADEVVRSDGPWKDEAKEWSGGGVDVVIDPVGGDRFTDSLRSLAEGGRCVVVGFTAGSIPEVRVNRLLLNNIEVVGAGWGAYVMGKPNVNREIGAAVNRLVDEGAVRPIVGARLPLDKAADALELLEGRGATGKVVLEVQSGQTP

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
56 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
118 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
119 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
120 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
121 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
218 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
219 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.26
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.34
Nodule 0
Rhizoplane 9.95
Rhizosphere 81.12
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000691 3300003373 Bacteria 6999
2 JGI25407J50210_10000016 3300003373 Bacteria 17847
3 Ga0070658_10002580 3300005327 Bacteria 15093
4 Ga0070676_10091651 3300005328 Bacteria 1863
5 Ga0070683_100012837 3300005329 Bacteria 7290
6 Ga0070683_100405205 3300005329 Bacteria 1301
7 Ga0070682_100111938 3300005337 Bacteria 1821
8 Ga0070660_100000603 3300005339 Bacteria 24010
9 Ga0070661_100016974 3300005344 Bacteria 5157
10 Ga0070692_10001624 3300005345 Bacteria 8276
11 Ga0070668_100008209 3300005347 Bacteria 7753
12 Ga0070668_100045445 3300005347 Bacteria 3369
13 Ga0070669_100150521 3300005353 Bacteria 1801
14 Ga0070675_100008653 3300005354 Bacteria 7905
15 Ga0070674_100004552 3300005356 Bacteria 7912
16 Ga0070659_100028497 3300005366 Bacteria 4313
17 Ga0070713_100007499 3300005436 Bacteria 7662
18 Ga0070713_100024016 3300005436 Bacteria 4741
19 Ga0070713_100091141 3300005436 Bacteria 2622
20 Ga0070711_100015506 3300005439 Bacteria 4826
21 Ga0070700_100035865 3300005441 Bacteria 3004
22 Ga0070700_100037970 3300005441 Bacteria 2932
23 Ga0070663_100069615 3300005455 Bacteria 2557
24 Ga0070662_100001697 3300005457 Bacteria 13542
25 Ga0070685_10014862 3300005466 Bacteria 4129
26 Ga0068853_100312272 3300005539 Bacteria 1455
27 Ga0070686_100083879 3300005544 Bacteria 2116
28 Ga0070693_100031336 3300005547 Bacteria 2913
29 Ga0070664_100003953 3300005564 Bacteria 11933
30 Ga0070664_100023301 3300005564 Bacteria 5113
31 Ga0068852_100007992 3300005616 Bacteria 7758
32 Ga0068852_100158406 3300005616 Bacteria 2111
33 Ga0068861_100014690 3300005719 Bacteria 5498
34 Ga0068861_100110785 3300005719 Bacteria 2199
35 Ga0068861_100242373 3300005719 Bacteria 1534
36 Ga0068851_10029756 3300005834 Bacteria 2705
37 Ga0068851_10196488 3300005834 Bacteria 1124
38 Ga0081455_10007657 3300005937 Bacteria 11344
39 Ga0081455_10013414 3300005937 Bacteria 8101
40 Ga0081455_10018546 3300005937 Bacteria 6623
41 Ga0081538_10000077 3300005981 Bacteria 93624
42 Ga0081538_10000107 3300005981 Bacteria 82480
43 Ga0081538_10000223 3300005981 Bacteria 63727
44 Ga0081538_10001086 3300005981 Bacteria 28963
45 Ga0081538_10001793 3300005981 Bacteria 21677
46 Ga0081538_10002024 3300005981 Bacteria 20280
47 Ga0081538_10002112 3300005981 Bacteria 19798
48 Ga0081538_10004182 3300005981 Bacteria 13394
49 Ga0081538_10011231 3300005981 Bacteria 7269
50 Ga0081538_10022873 3300005981 Bacteria 4511
51 Ga0081538_10028268 3300005981 Bacteria 3862
52 Ga0081538_10054213 3300005981 Bacteria 2374
53 Ga0081538_10086811 3300005981 Bacteria 1636
54 Ga0081540_1093055 3300005983 Bacteria 1321
55 Ga0070717_10010791 3300006028 Bacteria 6912
56 Ga0070717_10204839 3300006028 Bacteria 1729
57 Ga0075365_10008348 3300006038 Bacteria 5871
58 Ga0075365_10068767 3300006038 Bacteria 2379
59 Ga0075365_10193928 3300006038 Bacteria 1422
60 Ga0075363_100068520 3300006048 Bacteria 1924
61 Ga0075363_100117599 3300006048 Bacteria 1482
62 Ga0075364_10090137 3300006051 Bacteria 2034
63 Ga0075364_10105990 3300006051 Bacteria 1873
64 Ga0075364_10239288 3300006051 Bacteria 1233
65 Ga0070712_100003760 3300006175 Bacteria 9350
66 Ga0075367_10023867 3300006178 Bacteria 3446
67 Ga0075428_100013444 3300006844 Bacteria 9108
68 Ga0075428_100026049 3300006844 Bacteria 6476
69 Ga0075428_100095325 3300006844 Bacteria 3244
70 Ga0075428_100243527 3300006844 Bacteria 1940
71 Ga0075430_100009178 3300006846 Bacteria 8358
72 Ga0075430_100029532 3300006846 Bacteria 4654
73 Ga0075431_100545405 3300006847 Bacteria 1147
74 Ga0075429_100017950 3300006880 Bacteria 6118
75 Ga0068865_100016278 3300006881 Bacteria 4755
76 Ga0111539_10327161 3300009094 Bacteria 1784
77 Ga0111539_10431116 3300009094 Bacteria 1535
78 Ga0105245_10006881 3300009098 Bacteria 9973
79 Ga0114129_10002947 3300009147 Bacteria 23806
80 Ga0114129_10028945 3300009147 Bacteria 7848
81 Ga0114129_10144993 3300009147 Bacteria 3253
82 Ga0105243_10002373 3300009148 Bacteria 15760
83 Ga0105248_10289724 3300009177 Bacteria 1844
84 Ga0105248_10765985 3300009177 Bacteria 1089
85 Ga0105237_10025126 3300009545 Bacteria 6094
86 Ga0105249_10016864 3300009553 Bacteria 6481
87 Ga0105239_10040897 3300010375 Bacteria 5080
88 Ga0105239_10593568 3300010375 Bacteria 1263
89 Ga0163162_10030535 3300013306 Bacteria 5339
90 Ga0163162_10142973 3300013306 Bacteria 2507
91 Ga0157372_10141852 3300013307 Bacteria 2769
92 Ga0157375_10016157 3300013308 Bacteria 6695
93 Ga0157380_10054124 3300014326 Bacteria 3183
94 Ga0157377_10049277 3300014745 Bacteria 2367
95 Ga0206353_11849605 3300020082 Bacteria 2048
96 Ga0213873_10003579 3300021358 Bacteria 2812
97 Ga0213874_10023414 3300021377 Bacteria 1722
98 Ga0213876_10013328 3300021384 Bacteria 4370
99 Ga0213876_10040694 3300021384 Bacteria 2456
100 Ga0213875_10060118 3300021388 Bacteria 1778
101 Ga0207656_10073962 3300025321 Bacteria 1520
102 Ga0207688_10009452 3300025901 Bacteria 5306
103 Ga0207688_10017895 3300025901 Bacteria 3856
104 Ga0207699_10049609 3300025906 Bacteria 2471
105 Ga0207699_10114578 3300025906 Bacteria 1734
106 Ga0207705_10044157 3300025909 Bacteria 3203
107 Ga0207705_10341268 3300025909 Bacteria 1153
108 Ga0207671_10010682 3300025914 Bacteria 7552
109 Ga0207693_10023390 3300025915 Bacteria 4907
110 Ga0207693_10031656 3300025915 Bacteria 4179
111 Ga0207693_10385809 3300025915 Bacteria 1095
112 Ga0207657_10000668 3300025919 Bacteria 36536
113 Ga0207681_10179240 3300025923 Bacteria 1613
114 Ga0207659_10064255 3300025926 Bacteria 2655
115 Ga0207687_10022452 3300025927 Bacteria 4200
116 Ga0207700_10063757 3300025928 Bacteria 2804
117 Ga0207664_10000577 3300025929 Bacteria 25654
118 Ga0207664_10050350 3300025929 Bacteria 3284
119 Ga0207690_10055259 3300025932 Bacteria 2673
120 Ga0207706_10001477 3300025933 Bacteria 23446
121 Ga0207706_10004017 3300025933 Bacteria 13928
122 Ga0207709_10109338 3300025935 Bacteria 1845
123 Ga0207709_10153940 3300025935 Bacteria 1596
124 Ga0207670_10063757 3300025936 Bacteria 2523
125 Ga0207669_10260225 3300025937 Bacteria 1297
126 Ga0207704_10179822 3300025938 Bacteria 1527
127 Ga0207665_10013749 3300025939 Bacteria 5323
128 Ga0207691_10018329 3300025940 Bacteria 6631
129 Ga0207689_10062551 3300025942 Bacteria 3061
130 Ga0207661_10002102 3300025944 Bacteria 13699
131 Ga0207661_10170957 3300025944 Bacteria 1892
132 Ga0207679_10016097 3300025945 Bacteria 4959
133 Ga0207679_10074193 3300025945 Bacteria 2577
134 Ga0207679_10168340 3300025945 Bacteria 1801
135 Ga0207712_10071164 3300025961 Bacteria 2501
136 Ga0207712_10101888 3300025961 Bacteria 2136
137 Ga0207640_10246361 3300025981 Bacteria 1384
138 Ga0207639_10140476 3300026041 Bacteria 2011
139 Ga0207678_10002805 3300026067 Bacteria 15804
140 Ga0207708_10003448 3300026075 Bacteria 11654
141 Ga0207708_10021665 3300026075 Bacteria 4848
142 Ga0207674_10018498 3300026116 Bacteria 7573
143 Ga0207675_100001320 3300026118 Bacteria 24844
144 Ga0207675_100167539 3300026118 Bacteria 2098
145 Ga0207675_100342170 3300026118 Bacteria 1464
146 Ga0207683_10118684 3300026121 Bacteria 2373
147 Ga0207683_10305273 3300026121 Bacteria 1456
148 Ga0207698_10036400 3300026142 Bacteria 3613
149 Ga0268266_10014056 3300028379 Bacteria 6891
150 Ga0268264_10037405 3300028381 Bacteria 4002
151 Ga0316182_1363690 3300030745 Bacteria 8488
152 Ga0307408_100126562 3300031548 Bacteria 1988
153 Ga0307405_10036921 3300031731 Bacteria 2932
154 Ga0307405_10047273 3300031731 Bacteria 2649
155 Ga0307406_10026650 3300031901 Bacteria 3474
156 Ga0307406_10072486 3300031901 Bacteria 2261
157 Ga0307406_10074255 3300031901 Bacteria 2238
158 Ga0307409_100016947 3300031995 Bacteria 4840
159 Ga0307409_100042204 3300031995 Bacteria 3414
160 Ga0307409_100287163 3300031995 Bacteria 1524
161 Ga0307416_100013813 3300032002 Bacteria 5504
162 Ga0307416_100046732 3300032002 Bacteria 3419
163 Ga0307414_10234642 3300032004 Bacteria 1515
164 Ga0373953_0048063 3300035117 Bacteria 1718
165 Ga0373955_0083562 3300035172 Bacteria 1809
166 Ga0316574_0218327 3300035398 Bacteria 1222
167 Ga0373924_0007944 3300035410 Bacteria 3841
168 Ga0373931_0054657 3300035691 Bacteria 2134
169 Ga0373933_0081988 3300035724 Bacteria 1979
170 Ga0373937_0006516 3300036401 Bacteria 10078
171 Ga0395899_0241494 3300037312 Bacteria 1243
172 Ga0395900_0058372 3300037418 Bacteria 3972
173 Ga0395900_0154381 3300037418 Bacteria 2345
174 Ga0395898_0004779 3300037466 Bacteria 14739
175 Ga0395898_0087577 3300037466 Bacteria 3000
176 Ga0395898_0121159 3300037466 Bacteria 2506
177 Ga0395898_0194628 3300037466 Bacteria 1937
178 Ga0395898_0458314 3300037466 Bacteria 1214
179 Ga0395905_0035786 3300037471 Bacteria 4663
180 Ga0436364_0112083 3300037853 Bacteria 2884
181 Ga0436364_0830799 3300037853 Bacteria 3525
182 Ga0436364_1421865 3300037853 Bacteria 3131
183 Ga0395901_0002671 3300038443 Bacteria 17999
184 Ga0395901_0009111 3300038443 Bacteria 10050
185 Ga0395901_0061148 3300038443 Bacteria 3919
186 Ga0395901_0085958 3300038443 Bacteria 3288
187 Ga0395901_0629524 3300038443 Bacteria 1079
188 Ga0436365_0262453 3300039437 Bacteria 28030
189 Ga0436365_0498829 3300039437 Bacteria 5754
190 Ga0436365_0627820 3300039437 Bacteria 7220
191 Ga0436365_0721292 3300039437 Bacteria 3977
192 Ga0436365_0928468 3300039437 Bacteria 2572
193 Ga0436365_0934035 3300039437 Bacteria 1562
194 Ga0436365_1248132 3300039437 Bacteria 2545
195 Ga0436360_0331962 3300039438 Bacteria 2820
196 Ga0436363_0365955 3300039450 Bacteria 1250
197 Ga0436363_0453008 3300039450 Bacteria 4617
198 Ga0436362_0338080 3300039453 Bacteria 2784
199 Ga0436362_0877036 3300039453 Bacteria 4540
200 Ga0439450_018658 3300042008 Bacteria 1460
201 Ga0439463_026388 3300042016 Bacteria 1459
202 Ga0439464_0001838 3300042439 Bacteria 5126
203 Ga0439460_0032199 3300042461 Bacteria 1500
204 Ga0439440_0006673 3300042993 Bacteria 2329
205 Ga0466966_0027318 3300044684 Bacteria 3722
206 Ga0466966_0158386 3300044684 Bacteria 1379
207 Ga0466966_0308524 3300044684 Bacteria 951
208 Ga0466961_0015002 3300044693 Bacteria 4975
209 Ga0466963_0015375 3300044694 Bacteria 4737
210 Ga0466963_0027463 3300044694 Bacteria 3645
211 Ga0466963_0090057 3300044694 Bacteria 2088
212 Ga0466963_0284948 3300044694 Bacteria 1161
213 Ga0466964_0043547 3300044706 Unclassified 1821
214 Ga0466964_0066885 3300044706 Bacteria 1509
215 Ga0466964_0206321 3300044706 Bacteria 946
216 Ga0466971_0054496 3300044719 Bacteria 1802
217 Ga0466970_0021489 3300044765 Bacteria 3361
218 Ga0466957_0088993 3300044842 Bacteria 1932
219 Ga0466957_0130100 3300044842 Bacteria 1612
220 Ga0466960_0004281 3300044901 Bacteria 5562
221 Ga0466959_0012049 3300045049 Bacteria 6237
222 Ga0466959_0089161 3300045049 Bacteria 2216
223 Ga0466959_0217438 3300045049 Bacteria 1326
224 Ga0466959_0297602 3300045049 Bacteria 1105
225 Ga0466958_0073441 3300045836 Bacteria 2095
226 Ga0466958_0218023 3300045836 Bacteria 1217
227 Ga0466967_0012387 3300045976 Bacteria 6518
228 Ga0466967_0045211 3300045976 Bacteria 3825
229 Ga0466967_0076931 3300045976 Bacteria 3003
230 Ga0466967_0077312 3300045976 Bacteria 2996
231 Ga0466967_0196715 3300045976 Bacteria 1907
232 Ga0495592_0098139 3300046454 Bacteria 2091
233 Ga0495651_0006035 3300046462 Bacteria 9249
234 Ga0495651_0368514 3300046462 Bacteria 945
235 Ga0495653_0039669 3300046463 Bacteria 3687
236 Ga0495664_0000066 3300046477 Bacteria 49794
237 Ga0495664_0044629 3300046477 Bacteria 2627
238 Ga0495608_0005776 3300046511 Bacteria 8813
239 Ga0495618_0013039 3300046514 Bacteria 5052
240 Ga0495628_0032982 3300046516 Bacteria 4177
241 Ga0495630_0311711 3300046517 Bacteria 1203
242 Ga0495652_0062415 3300046529 Bacteria 3142
243 Ga0495652_0082082 3300046529 Bacteria 2658
244 Ga0495652_0087285 3300046529 Bacteria 2559
245 Ga0495640_0021674 3300046533 Bacteria 4710
246 Ga0495645_0006182 3300046543 Bacteria 8289
247 Ga0495667_0007367 3300046559 Bacteria 7462
248 Ga0495634_0158312 3300046642 Bacteria 1429
249 Ga0495635_0007467 3300046663 Bacteria 7631
250 Ga0495635_0292284 3300046663 Bacteria 1093
251 Ga0495646_0063141 3300046680 Bacteria 2200
252 Ga0495589_0049254 3300046794 Bacteria 2085
253 Ga0495589_0135180 3300046794 Bacteria 1183
254 Ga0495600_0257713 3300046809 Bacteria 1108
255 Ga0495604_0000996 3300047317 Bacteria 23554
256 Ga0495672_0006030 3300047320 Bacteria 9475
257 Ga0495675_0214128 3300047444 Bacteria 1168
258 Ga0495602_0062363 3300048088 Bacteria 3234
259 Ga0496100_0002642 3300048903 Bacteria 9143
260 Ga0496100_0149008 3300048903 Bacteria 1666
261 Ga0496100_0335081 3300048903 Bacteria 1140
262 Ga0496102_0000019 3300048905 Bacteria 264583
263 Ga0496102_0089014 3300048905 Bacteria 2855
264 Ga0496103_0000104 3300048906 Bacteria 93132
265 Ga0496103_0258245 3300048906 Bacteria 1121
266 Ga0496104_0000033 3300048907 Bacteria 189758
267 Ga0496104_0016018 3300048907 Bacteria 6807
268 Ga0496104_0085579 3300048907 Bacteria 3009
269 Ga0496104_0476099 3300048907 Bacteria 1160
270 Ga0496105_0003307 3300048908 Bacteria 11908
271 Ga0496105_0185648 3300048908 Bacteria 1702
272 Ga0496106_0040305 3300048909 Bacteria 3497
273 Ga0496106_0086225 3300048909 Bacteria 2418
274 Ga0496108_0006386 3300048911 Bacteria 9556
275 Ga0496108_0130402 3300048911 Bacteria 2161
276 Ga0496108_0351948 3300048911 Bacteria 1285
277 Ga0496109_0011661 3300048912 Bacteria 7558
278 Ga0496109_0012138 3300048912 Bacteria 7430
279 Ga0496109_0335693 3300048912 Bacteria 1427
280 Ga0496110_0002722 3300048913 Bacteria 13348
281 Ga0496111_0000068 3300048914 Bacteria 42400
282 Ga0496111_0068563 3300048914 Bacteria 2578
283 Ga0496111_0085689 3300048914 Bacteria 2304
284 Ga0496111_0112062 3300048914 Bacteria 2010
285 Ga0496111_0361255 3300048914 Bacteria 1075
286 Ga0496112_0007418 3300048915 Bacteria 9735
287 Ga0496112_0068645 3300048915 Bacteria 3501
288 Ga0496112_0120976 3300048915 Bacteria 2588
289 Ga0496112_0301913 3300048915 Bacteria 1546
290 Ga0496112_0327509 3300048915 Bacteria 1476
291 Ga0496113_0081296 3300048916 Bacteria 2483
292 Ga0496113_0097813 3300048916 Bacteria 2271
293 Ga0496113_0150692 3300048916 Bacteria 1834
294 Ga0496114_0059542 3300048917 Bacteria 3191
295 Ga0496115_0000068 3300048918 Bacteria 93725
296 Ga0496115_0036760 3300048918 Bacteria 3878
297 Ga0496115_0089346 3300048918 Bacteria 2516
298 Ga0501031_0016452 3300049568 Bacteria 4804
299 Ga0501031_0059999 3300049568 Bacteria 2479
300 Ga0501031_0082022 3300049568 Bacteria 2102
301 Ga0501033_0032753 3300049570 Bacteria 3903
302 Ga0501033_0038203 3300049570 Bacteria 3591
303 Ga0501034_0297012 3300049571 Bacteria 1552
304 Ga0501036_0016470 3300049572 Bacteria 6174
305 Ga0501036_0032580 3300049572 Bacteria 4404
306 Ga0501037_0027042 3300049573 Bacteria 4238
307 Ga0501038_0017912 3300049574 Bacteria 6399
308 Ga0501038_0049427 3300049574 Bacteria 3636
309 Ga0501038_0069314 3300049574 Bacteria 2996
310 Ga0501039_0009442 3300049575 Bacteria 7437
311 Ga0501039_0039596 3300049575 Bacteria 3640
312 Ga0501039_0053146 3300049575 Bacteria 3135
313 Ga0501039_0281163 3300049575 Bacteria 1308
314 Ga0501040_0008334 3300049576 Bacteria 6741
315 Ga0501040_0030175 3300049576 Bacteria 3662
316 Ga0501041_0003483 3300049577 Bacteria 9059
317 Ga0501041_0073935 3300049577 Bacteria 2094
318 Ga0501041_0131826 3300049577 Bacteria 1557
319 Ga0501042_0016990 3300049578 Bacteria 5010
320 Ga0501042_0027215 3300049578 Bacteria 4020
321 Ga0501042_0239837 3300049578 Bacteria 1308
322 Ga0501043_0022804 3300049579 Bacteria 4909
323 Ga0501043_0072972 3300049579 Bacteria 2695
324 Ga0501046_0004549 3300049580 Bacteria 12563
325 Ga0501046_0004779 3300049580 Bacteria 12209
326 Ga0501046_0211364 3300049580 Bacteria 1440
327 Ga0501046_0348803 3300049580 Bacteria 1075
328 Ga0501047_0404593 3300049581 Bacteria 1197
329 Ga0501048_0025277 3300049582 Bacteria 4328
330 Ga0501048_0038449 3300049582 Bacteria 3433
331 Ga0501048_0254933 3300049582 Bacteria 1246
332 Ga0501048_0439248 3300049582 Bacteria 934
333 Ga0501067_0033973 3300049583 Bacteria 2830
334 Ga0501068_0116865 3300049584 Bacteria 1661
335 Ga0501070_0074834 3300049586 Bacteria 2803
336 Ga0501070_0122926 3300049586 Bacteria 2145
337 Ga0501071_0052227 3300049587 Bacteria 2947
338 Ga0501071_0116777 3300049587 Bacteria 1975
339 Ga0501071_0128996 3300049587 Bacteria 1878
340 Ga0501072_0141058 3300049588 Bacteria 1921
341 Ga0501073_0019703 3300049589 Bacteria 4869
342 Ga0501074_0020687 3300049590 Bacteria 4781
343 Ga0501074_0051377 3300049590 Bacteria 2975
344 Ga0501075_0012188 3300049591 Bacteria 6103
345 Ga0501075_0135618 3300049591 Bacteria 1875
346 Ga0501076_0003064 3300049592 Bacteria 11632
347 Ga0501076_0034005 3300049592 Bacteria 3982
348 Ga0501076_0107107 3300049592 Bacteria 2257
349 Ga0501077_0000293 3300049593 Bacteria 29649
350 Ga0501079_0009588 3300049741 Bacteria 7342
351 Ga0501080_0043893 3300049742 Bacteria 4162
352 Ga0501080_0301442 3300049742 Bacteria 1453
353 Ga0501081_0006077 3300049743 Bacteria 7823
354 Ga0501083_0062469 3300049744 Bacteria 2485
355 Ga0501083_0078014 3300049744 Bacteria 2197
356 Ga0501035_0056122 3300049822 Bacteria 3515
357 Ga0501044_0292640 3300049823 Bacteria 1559
358 Ga0501045_0013484 3300049824 Bacteria 5772
359 nmdc:mga03n38_190430_c1 3300050490 Bacteria 1056
360 nmdc:mga00v17_105809_c1 3300050491 Bacteria 1780
361 nmdc:mga00v17_83362_c1 3300050491 Bacteria 1999
362 nmdc:mga0yw44_16119_c1 3300050492 Bacteria 4029
363 nmdc:mga0yw44_67647_c1 3300050492 Bacteria 2208
364 nmdc:mga06z11_132837_c1 3300050494 Bacteria 1399
365 nmdc:mga05p37_264065_c1 3300050507 Bacteria 2059
366 nmdc:mga05p37_39170_c1 3300050507 Bacteria 5817
367 nmdc:mga05p37_422684_c1 3300050507 Bacteria 1550
368 nmdc:mga09592_184012_c1 3300050508 Bacteria 1807
369 nmdc:mga09592_8747_c1 3300050508 Bacteria 8239
370 nmdc:mga0qj67_102249_c1 3300050509 Bacteria 2311
371 nmdc:mga06r32_181931_c1 3300050510 Bacteria 2088
372 nmdc:mga08y16_177563_c1 3300050511 Bacteria 2211
373 nmdc:mga08y16_31433_c1 3300050511 Bacteria 5583
374 nmdc:mga08y16_352973_c1 3300050511 Bacteria 1510
375 Ga0495601_0001935 3300053077 Bacteria 11584
376 Ga0495601_0083560 3300053077 Bacteria 2051
377 Ga0495612_0000065 3300053078 Bacteria 47942
378 Ga0495595_0003402 3300053084 Bacteria 6323
379 Ga0495619_0320038 3300053085 Bacteria 1074
380 Ga0500556_0000837 3300053104 Bacteria 17673
381 Ga0500616_0022772 3300053153 Bacteria 3495
382 Ga0501084_0001041 3300054114 Bacteria 21556
383 Ga0501084_0091340 3300054114 Bacteria 2557
384 Ga0501084_0173231 3300054114 Bacteria 1821
385 Ga0501082_0010633 3300060353 Bacteria 7922
386 Ga0501082_0172066 3300060353 Bacteria 1883
387 Ga0466962_0000721 3300061719 Bacteria 14771
388 Ga0530510_0002036 3300061734 Bacteria 13887
389 Ga0530510_0060785 3300061734 Bacteria 2735
390 Ga0530510_0088431 3300061734 Bacteria 2258
391 2857711933 2857710386 Bacteria 3186771
392 3001890539 3001889506 Bacteria 2975194
393 JGI25407J50210_10000691
394 JGI25407J50210_10000016
395 Ga0070658_10002580
396 Ga0070676_10091651
397 Ga0070683_100012837
398 Ga0070683_100405205
399 Ga0070682_100111938
400 Ga0070660_100000603
401 Ga0070661_100016974
402 Ga0070692_10001624
403 Ga0070668_100008209
404 Ga0070668_100045445
405 Ga0070669_100150521
406 Ga0070675_100008653
407 Ga0070674_100004552
408 Ga0070659_100028497
409 Ga0070713_100007499
410 Ga0070713_100024016
411 Ga0070713_100091141
412 Ga0070711_100015506
413 Ga0070700_100035865
414 Ga0070700_100037970
415 Ga0070663_100069615
416 Ga0070662_100001697
417 Ga0070685_10014862
418 Ga0068853_100312272
419 Ga0070686_100083879
420 Ga0070693_100031336
421 Ga0070664_100003953
422 Ga0070664_100023301
423 Ga0068852_100007992
424 Ga0068852_100158406
425 Ga0068861_100014690
426 Ga0068861_100110785
427 Ga0068861_100242373
428 Ga0068851_10029756
429 Ga0068851_10196488
430 Ga0081455_10007657
431 Ga0081455_10013414
432 Ga0081455_10018546
433 Ga0081538_10000077
434 Ga0081538_10000107
435 Ga0081538_10000223
436 Ga0081538_10001086
437 Ga0081538_10001793
438 Ga0081538_10002024
439 Ga0081538_10002112
440 Ga0081538_10004182
441 Ga0081538_10011231
442 Ga0081538_10022873
443 Ga0081538_10028268
444 Ga0081538_10054213
445 Ga0081538_10086811
446 Ga0081540_1093055
447 Ga0070717_10010791
448 Ga0070717_10204839
449 Ga0075365_10008348
450 Ga0075365_10068767
451 Ga0075365_10193928
452 Ga0075363_100068520
453 Ga0075363_100117599
454 Ga0075364_10090137
455 Ga0075364_10105990
456 Ga0075364_10239288
457 Ga0070712_100003760
458 Ga0075367_10023867
459 Ga0075428_100013444
460 Ga0075428_100026049
461 Ga0075428_100095325
462 Ga0075428_100243527
463 Ga0075430_100009178
464 Ga0075430_100029532
465 Ga0075431_100545405
466 Ga0075429_100017950
467 Ga0068865_100016278
468 Ga0111539_10327161
469 Ga0111539_10431116
470 Ga0105245_10006881
471 Ga0114129_10002947
472 Ga0114129_10028945
473 Ga0114129_10144993
474 Ga0105243_10002373
475 Ga0105248_10289724
476 Ga0105248_10765985
477 Ga0105237_10025126
478 Ga0105249_10016864
479 Ga0105239_10040897
480 Ga0105239_10593568
481 Ga0163162_10030535
482 Ga0163162_10142973
483 Ga0157372_10141852
484 Ga0157375_10016157
485 Ga0157380_10054124
486 Ga0157377_10049277
487 Ga0206353_11849605
488 Ga0213873_10003579
489 Ga0213874_10023414
490 Ga0213876_10013328
491 Ga0213876_10040694
492 Ga0213875_10060118
493 Ga0207656_10073962
494 Ga0207688_10009452
495 Ga0207688_10017895
496 Ga0207699_10049609
497 Ga0207699_10114578
498 Ga0207705_10044157
499 Ga0207705_10341268
500 Ga0207671_10010682
501 Ga0207693_10023390
502 Ga0207693_10031656
503 Ga0207693_10385809
504 Ga0207657_10000668
505 Ga0207681_10179240
506 Ga0207659_10064255
507 Ga0207687_10022452
508 Ga0207700_10063757
509 Ga0207664_10000577
510 Ga0207664_10050350
511 Ga0207690_10055259
512 Ga0207706_10001477
513 Ga0207706_10004017
514 Ga0207709_10109338
515 Ga0207709_10153940
516 Ga0207670_10063757
517 Ga0207669_10260225
518 Ga0207704_10179822
519 Ga0207665_10013749
520 Ga0207691_10018329
521 Ga0207689_10062551
522 Ga0207661_10002102
523 Ga0207661_10170957
524 Ga0207679_10016097
525 Ga0207679_10074193
526 Ga0207679_10168340
527 Ga0207712_10071164
528 Ga0207712_10101888
529 Ga0207640_10246361
530 Ga0207639_10140476
531 Ga0207678_10002805
532 Ga0207708_10003448
533 Ga0207708_10021665
534 Ga0207674_10018498
535 Ga0207675_100001320
536 Ga0207675_100167539
537 Ga0207675_100342170
538 Ga0207683_10118684
539 Ga0207683_10305273
540 Ga0207698_10036400
541 Ga0268266_10014056
542 Ga0268264_10037405
543 Ga0316182_1363690
544 Ga0307408_100126562
545 Ga0307405_10036921
546 Ga0307405_10047273
547 Ga0307406_10026650
548 Ga0307406_10072486
549 Ga0307406_10074255
550 Ga0307409_100016947
551 Ga0307409_100042204
552 Ga0307409_100287163
553 Ga0307416_100013813
554 Ga0307416_100046732
555 Ga0307414_10234642
556 Ga0373953_0048063
557 Ga0373955_0083562
558 Ga0316574_0218327
559 Ga0373924_0007944
560 Ga0373931_0054657
561 Ga0373933_0081988
562 Ga0373937_0006516
563 Ga0395899_0241494
564 Ga0395900_0058372
565 Ga0395900_0154381
566 Ga0395898_0004779
567 Ga0395898_0087577
568 Ga0395898_0121159
569 Ga0395898_0194628
570 Ga0395898_0458314
571 Ga0395905_0035786
572 Ga0436364_0112083
573 Ga0436364_0830799
574 Ga0436364_1421865
575 Ga0395901_0002671
576 Ga0395901_0009111
577 Ga0395901_0061148
578 Ga0395901_0085958
579 Ga0395901_0629524
580 Ga0436365_0262453
581 Ga0436365_0498829
582 Ga0436365_0627820
583 Ga0436365_0721292
584 Ga0436365_0928468
585 Ga0436365_0934035
586 Ga0436365_1248132
587 Ga0436360_0331962
588 Ga0436363_0365955
589 Ga0436363_0453008
590 Ga0436362_0338080
591 Ga0436362_0877036
592 Ga0439450_018658
593 Ga0439463_026388
594 Ga0439464_0001838
595 Ga0439460_0032199
596 Ga0439440_0006673
597 Ga0466966_0027318
598 Ga0466966_0158386
599 Ga0466966_0308524
600 Ga0466961_0015002
601 Ga0466963_0015375
602 Ga0466963_0027463
603 Ga0466963_0090057
604 Ga0466963_0284948
605 Ga0466964_0043547
606 Ga0466964_0066885
607 Ga0466964_0206321
608 Ga0466971_0054496
609 Ga0466970_0021489
610 Ga0466957_0088993
611 Ga0466957_0130100
612 Ga0466960_0004281
613 Ga0466959_0012049
614 Ga0466959_0089161
615 Ga0466959_0217438
616 Ga0466959_0297602
617 Ga0466958_0073441
618 Ga0466958_0218023
619 Ga0466967_0012387
620 Ga0466967_0045211
621 Ga0466967_0076931
622 Ga0466967_0077312
623 Ga0466967_0196715
624 Ga0495592_0098139
625 Ga0495651_0006035
626 Ga0495651_0368514
627 Ga0495653_0039669
628 Ga0495664_0000066
629 Ga0495664_0044629
630 Ga0495608_0005776
631 Ga0495618_0013039
632 Ga0495628_0032982
633 Ga0495630_0311711
634 Ga0495652_0062415
635 Ga0495652_0082082
636 Ga0495652_0087285
637 Ga0495640_0021674
638 Ga0495645_0006182
639 Ga0495667_0007367
640 Ga0495634_0158312
641 Ga0495635_0007467
642 Ga0495635_0292284
643 Ga0495646_0063141
644 Ga0495589_0049254
645 Ga0495589_0135180
646 Ga0495600_0257713
647 Ga0495604_0000996
648 Ga0495672_0006030
649 Ga0495675_0214128
650 Ga0495602_0062363
651 Ga0496100_0002642
652 Ga0496100_0149008
653 Ga0496100_0335081
654 Ga0496102_0000019
655 Ga0496102_0089014
656 Ga0496103_0000104
657 Ga0496103_0258245
658 Ga0496104_0000033
659 Ga0496104_0016018
660 Ga0496104_0085579
661 Ga0496104_0476099
662 Ga0496105_0003307
663 Ga0496105_0185648
664 Ga0496106_0040305
665 Ga0496106_0086225
666 Ga0496108_0006386
667 Ga0496108_0130402
668 Ga0496108_0351948
669 Ga0496109_0011661
670 Ga0496109_0012138
671 Ga0496109_0335693
672 Ga0496110_0002722
673 Ga0496111_0000068
674 Ga0496111_0068563
675 Ga0496111_0085689
676 Ga0496111_0112062
677 Ga0496111_0361255
678 Ga0496112_0007418
679 Ga0496112_0068645
680 Ga0496112_0120976
681 Ga0496112_0301913
682 Ga0496112_0327509
683 Ga0496113_0081296
684 Ga0496113_0097813
685 Ga0496113_0150692
686 Ga0496114_0059542
687 Ga0496115_0000068
688 Ga0496115_0036760
689 Ga0496115_0089346
690 Ga0501031_0016452
691 Ga0501031_0059999
692 Ga0501031_0082022
693 Ga0501033_0032753
694 Ga0501033_0038203
695 Ga0501034_0297012
696 Ga0501036_0016470
697 Ga0501036_0032580
698 Ga0501037_0027042
699 Ga0501038_0017912
700 Ga0501038_0049427
701 Ga0501038_0069314
702 Ga0501039_0009442
703 Ga0501039_0039596
704 Ga0501039_0053146
705 Ga0501039_0281163
706 Ga0501040_0008334
707 Ga0501040_0030175
708 Ga0501041_0003483
709 Ga0501041_0073935
710 Ga0501041_0131826
711 Ga0501042_0016990
712 Ga0501042_0027215
713 Ga0501042_0239837
714 Ga0501043_0022804
715 Ga0501043_0072972
716 Ga0501046_0004549
717 Ga0501046_0004779
718 Ga0501046_0211364
719 Ga0501046_0348803
720 Ga0501047_0404593
721 Ga0501048_0025277
722 Ga0501048_0038449
723 Ga0501048_0254933
724 Ga0501048_0439248
725 Ga0501067_0033973
726 Ga0501068_0116865
727 Ga0501070_0074834
728 Ga0501070_0122926
729 Ga0501071_0052227
730 Ga0501071_0116777
731 Ga0501071_0128996
732 Ga0501072_0141058
733 Ga0501073_0019703
734 Ga0501074_0020687
735 Ga0501074_0051377
736 Ga0501075_0012188
737 Ga0501075_0135618
738 Ga0501076_0003064
739 Ga0501076_0034005
740 Ga0501076_0107107
741 Ga0501077_0000293
742 Ga0501079_0009588
743 Ga0501080_0043893
744 Ga0501080_0301442
745 Ga0501081_0006077
746 Ga0501083_0062469
747 Ga0501083_0078014
748 Ga0501035_0056122
749 Ga0501044_0292640
750 Ga0501045_0013484
751 nmdc:mga03n38_190430_c1
752 nmdc:mga00v17_105809_c1
753 nmdc:mga00v17_83362_c1
754 nmdc:mga0yw44_16119_c1
755 nmdc:mga0yw44_67647_c1
756 nmdc:mga06z11_132837_c1
757 nmdc:mga05p37_264065_c1
758 nmdc:mga05p37_39170_c1
759 nmdc:mga05p37_422684_c1
760 nmdc:mga09592_184012_c1
761 nmdc:mga09592_8747_c1
762 nmdc:mga0qj67_102249_c1
763 nmdc:mga06r32_181931_c1
764 nmdc:mga08y16_177563_c1
765 nmdc:mga08y16_31433_c1
766 nmdc:mga08y16_352973_c1
767 Ga0495601_0001935
768 Ga0495601_0083560
769 Ga0495612_0000065
770 Ga0495595_0003402
771 Ga0495619_0320038
772 Ga0500556_0000837
773 Ga0500616_0022772
774 Ga0501084_0001041
775 Ga0501084_0091340
776 Ga0501084_0173231
777 Ga0501082_0010633
778 Ga0501082_0172066
779 Ga0466962_0000721
780 Ga0530510_0002036
781 Ga0530510_0060785
782 Ga0530510_0088431
783 2857711933
784 3001890539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

156

285

0.94

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

32

115

0.84

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

188

325

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eye-assembly1.cif.gz_A crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.945 24 317
4eye-assembly2.cif.gz_B crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.9439 24 317
1yb5-assembly1.cif.gz_A crystal structure of human zeta-crystallin with bound nadp 0.9373 24 317
1iz0-assembly1.cif.gz_A crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph 0.9087 5 317
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9031 25 317
ID Description Score Start End Superfamily
af_P95185_121_286_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9617 118 281 3.40.50.720
af_B0BNC9_25_138_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9507 24 108 3.90.180.10
af_I1LVH0_176_320_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9471 120 252 3.40.50.720
af_P95185_121_286_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9448 118 281 3.40.50.720
af_O45496_3_328_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9426 25 318 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A355B5N3-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9638 107 315 GO:0008270
GO:0016491
AF-A0A1F2U9M1-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9589 24 317 GO:0008270
GO:0016651
GO:0070402
AF-A0A6L8W9Y5-F1-model_v4 Zinc-binding dehydrogenase 0.9553 25 315 GO:0016491
AF-A0A812KMX0-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9551 25 316 GO:0016020
GO:0016491
AF-A0A7X4D0G7-F1-model_v4 NADPH:quinone oxidoreductase family protein 0.9537 28 318 GO:0016491

Map