F432090

General Info

Members Datasets Scaffolds Average Seq Length
391 213 782 147

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0156955|Ga0395900_0156955_1265_1780
Length 171
Sequence VRLVSKRGFLNFELAGFGIRLFYMSLKDKITSDLTEAMKAKDAARLSTLRMVKANLMNRQIEKGGELTDEEITKALQSLVKQRRDSIEQYQTAGRAELAEKEAAEIAFIEAYLPQAASPVEIEAAVRSAISETGASSMKDMGTVMKAALAKLAGKTADGKAVSETVKSILQ

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
143 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
184 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
185 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
186 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
187 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
188 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
189 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
190 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
193 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
194 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
195 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
196 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
212 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
213 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 1.79
Rhizosphere 97.19
Stem 0
Stem Tuber 0
Unclassified 38.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0156955 3300037418 Bacteria 2324
2 JGI24748J21848_1000002 3300002074 Bacteria 426946
3 JGI24748J21848_1042258 3300002074 Unclassified 582
4 JGI24034J26672_10000004 3300002239 Bacteria 426946
5 Ga0065712_10172834 3300005290 Bacteria 1234
6 Ga0065707_10114992 3300005295 Bacteria 2281
7 Ga0070690_100040904 3300005330 Unclassified 2933
8 Ga0070670_100060466 3300005331 Bacteria 3253
9 Ga0070670_100119887 3300005331 Bacteria 2269
10 Ga0070670_100668359 3300005331 Bacteria 933
11 Ga0070677_10623163 3300005333 Bacteria 600
12 Ga0068869_100009818 3300005334 Bacteria 6217
13 Ga0068869_100123292 3300005334 Bacteria 1984
14 Ga0068869_101391508 3300005334 Bacteria 621
15 Ga0070666_10021356 3300005335 Bacteria 4197
16 Ga0070666_10048931 3300005335 Unclassified 2840
17 Ga0070680_100430256 3300005336 Bacteria 1126
18 Ga0070682_101567438 3300005337 Unclassified 568
19 Ga0068868_100029781 3300005338 Bacteria 4182
20 Ga0068868_100043539 3300005338 Unclassified 3507
21 Ga0070689_100097452 3300005340 Unclassified 2325
22 Ga0070661_100163586 3300005344 Bacteria 1686
23 Ga0070668_100042222 3300005347 Unclassified 3495
24 Ga0070669_100033837 3300005353 Bacteria 3698
25 Ga0070669_100797618 3300005353 Unclassified 802
26 Ga0070675_100042623 3300005354 Bacteria 3708
27 Ga0070675_100129312 3300005354 Bacteria 2151
28 Ga0070675_100399664 3300005354 Bacteria 1226
29 Ga0070675_101056251 3300005354 Unclassified 746
30 Ga0070675_101981148 3300005354 Unclassified 537
31 Ga0070671_100011252 3300005355 Bacteria 7188
32 Ga0070671_100236443 3300005355 Bacteria 1551
33 Ga0070659_100129987 3300005366 Bacteria 2045
34 Ga0070659_100205959 3300005366 Bacteria 1620
35 Ga0070659_101107113 3300005366 Unclassified 698
36 Ga0070667_100115679 3300005367 Unclassified 2329
37 Ga0070667_100498738 3300005367 Unclassified 1116
38 Ga0070667_100827426 3300005367 Unclassified 860
39 Ga0070709_10135887 3300005434 Unclassified 1684
40 Ga0070705_100507707 3300005440 Unclassified 916
41 Ga0070694_101641744 3300005444 Unclassified 546
42 Ga0070708_100161463 3300005445 Unclassified 2088
43 Ga0070663_100052560 3300005455 Bacteria 2906
44 Ga0070678_100612626 3300005456 Unclassified 973
45 Ga0070662_100060383 3300005457 Unclassified 2764
46 Ga0070662_100497251 3300005457 Unclassified 1017
47 Ga0070681_10035686 3300005458 Bacteria 4993
48 Ga0070681_10161303 3300005458 Bacteria 2166
49 Ga0068867_100991901 3300005459 Bacteria 761
50 Ga0070685_10110219 3300005466 Unclassified 1694
51 Ga0070685_10202940 3300005466 Unclassified 1290
52 Ga0070707_100220956 3300005468 Bacteria 1845
53 Ga0070698_100270142 3300005471 Bacteria 1632
54 Ga0070679_100098158 3300005530 Bacteria 2917
55 Ga0070679_100136196 3300005530 Bacteria 2436
56 Ga0068853_100076994 3300005539 Bacteria 2913
57 Ga0068853_100084083 3300005539 Bacteria 2788
58 Ga0068853_100167474 3300005539 Bacteria 1986
59 Ga0070672_100281938 3300005543 Unclassified 1405
60 Ga0070672_100372687 3300005543 Unclassified 1220
61 Ga0070686_100118621 3300005544 Bacteria 1814
62 Ga0070686_100759446 3300005544 Bacteria 778
63 Ga0070695_100786149 3300005545 Unclassified 761
64 Ga0070693_100075937 3300005547 Unclassified 1991
65 Ga0070704_100264224 3300005549 Bacteria 1419
66 Ga0068855_100245996 3300005563 Bacteria 1996
67 Ga0068855_100669187 3300005563 Unclassified 1113
68 Ga0068855_101665976 3300005563 Unclassified 651
69 Ga0070664_100033461 3300005564 Bacteria 4305
70 Ga0070664_100039328 3300005564 Bacteria 3985
71 Ga0070664_100245972 3300005564 Unclassified 1607
72 Ga0070664_100330809 3300005564 Unclassified 1382
73 Ga0070664_101075708 3300005564 Unclassified 757
74 Ga0070664_101411221 3300005564 Unclassified 658
75 Ga0068857_100046548 3300005577 Bacteria 3850
76 Ga0068857_100286783 3300005577 Bacteria 1515
77 Ga0068854_100114596 3300005578 Unclassified 2038
78 Ga0068854_100194301 3300005578 Unclassified 1592
79 Ga0070702_100602251 3300005615 Unclassified 824
80 Ga0068852_100060258 3300005616 Unclassified 3295
81 Ga0068852_100469892 3300005616 Bacteria 1248
82 Ga0068859_100011890 3300005617 Bacteria 8745
83 Ga0068859_100022365 3300005617 Bacteria 6339
84 Ga0068859_100093955 3300005617 Bacteria 3050
85 Ga0068859_100647206 3300005617 Unclassified 1149
86 Ga0068864_100024600 3300005618 Bacteria 5067
87 Ga0068864_100067924 3300005618 Unclassified 3096
88 Ga0068864_100085412 3300005618 Plasmid 2775
89 Ga0068864_100150186 3300005618 Bacteria 2110
90 Ga0068864_100265630 3300005618 Unclassified 1597
91 Ga0068866_10221397 3300005718 Unclassified 1142
92 Ga0068861_100064256 3300005719 Unclassified 2823
93 Ga0068861_101676655 3300005719 Bacteria 628
94 Ga0068851_10356011 3300005834 Unclassified 853
95 Ga0068870_10031273 3300005840 Bacteria 2696
96 Ga0068870_10346514 3300005840 Unclassified 952
97 Ga0068863_100082399 3300005841 Unclassified 3049
98 Ga0068863_100172334 3300005841 Bacteria 2076
99 Ga0068863_100219533 3300005841 Unclassified 1831
100 Ga0068863_100337821 3300005841 Bacteria 1465
101 Ga0068858_100000105 3300005842 Bacteria 87839
102 Ga0068858_100020865 3300005842 Bacteria 6123
103 Ga0068858_100191691 3300005842 Unclassified 1931
104 Ga0068860_100086615 3300005843 Unclassified 2981
105 Ga0068860_100110288 3300005843 Bacteria 2630
106 Ga0068862_100023706 3300005844 Bacteria 5143
107 Ga0068862_100056795 3300005844 Bacteria 3354
108 Ga0068862_100490163 3300005844 Bacteria 1165
109 Ga0081539_10062578 3300005985 Bacteria 2034
110 Ga0075364_10003764 3300006051 Bacteria 8670
111 Ga0075364_10270112 3300006051 Bacteria 1157
112 Ga0070716_100051003 3300006173 Archaea 2350
113 Ga0070716_100517843 3300006173 Unclassified 883
114 Ga0097621_100032937 3300006237 Bacteria 4122
115 Ga0097621_100215067 3300006237 Unclassified 1673
116 Ga0068871_100034490 3300006358 Bacteria 4016
117 Ga0068871_100169640 3300006358 Unclassified 1870
118 Ga0068871_100307128 3300006358 Bacteria 1394
119 Ga0068871_100461947 3300006358 Unclassified 1139
120 Ga0068871_100888854 3300006358 Unclassified 825
121 Ga0075434_100167577 3300006871 Bacteria 2216
122 Ga0068865_101642203 3300006881 Unclassified 578
123 Ga0075436_100000009 3300006914 Bacteria 256132
124 Ga0097620_100011890 3300006931 Bacteria 8745
125 Ga0097620_100022365 3300006931 Bacteria 6339
126 Ga0097620_100093958 3300006931 Bacteria 3050
127 Ga0097620_100647230 3300006931 Unclassified 1149
128 Ga0075435_100000561 3300007076 Bacteria 22825
129 Ga0105251_10170973 3300009011 Unclassified 979
130 Ga0105240_10014852 3300009093 Bacteria 10615
131 Ga0111539_10022548 3300009094 Bacteria 7735
132 Ga0111539_10026390 3300009094 Bacteria 7102
133 Ga0111539_10151560 3300009094 Bacteria 2713
134 Ga0111539_10364424 3300009094 Unclassified 1682
135 Ga0105245_10055121 3300009098 Bacteria 3570
136 Ga0105247_10000005 3300009101 Bacteria 426989
137 Ga0105247_10145965 3300009101 Unclassified 1555
138 Ga0114129_10097781 3300009147 Bacteria 4064
139 Ga0114129_10672327 3300009147 Bacteria 1334
140 Ga0105241_10517430 3300009174 Unclassified 1067
141 Ga0105242_10027271 3300009176 Bacteria 4533
142 Ga0105242_10919211 3300009176 Unclassified 876
143 Ga0105248_10126670 3300009177 Bacteria 2880
144 Ga0105248_10704238 3300009177 Unclassified 1139
145 Ga0105248_10853770 3300009177 Bacteria 1028
146 Ga0105237_10230354 3300009545 Bacteria 1853
147 Ga0105238_11758816 3300009551 Unclassified 651
148 Ga0105249_10013873 3300009553 Bacteria 7122
149 Ga0105249_10191086 3300009553 Unclassified 1998
150 Ga0105249_10193290 3300009553 Unclassified 1987
151 Ga0105249_10346518 3300009553 Unclassified 1504
152 Ga0105239_10022808 3300010375 Bacteria 6901
153 Ga0105239_11958848 3300010375 Unclassified 680
154 Ga0157373_10035537 3300013100 Unclassified 3577
155 Ga0157373_10107477 3300013100 Bacteria 1961
156 Ga0157370_10862404 3300013104 Unclassified 823
157 Ga0157369_10159687 3300013105 Bacteria 2380
158 Ga0157369_10238075 3300013105 Bacteria 1901
159 Ga0157374_10159878 3300013296 Bacteria 2194
160 Ga0157374_10413357 3300013296 Bacteria 1347
161 Ga0157378_10021843 3300013297 Bacteria 5627
162 Ga0157378_10294336 3300013297 Unclassified 1569
163 Ga0157378_10801061 3300013297 Unclassified 968
164 Ga0163162_10019198 3300013306 Bacteria 6702
165 Ga0163162_10224949 3300013306 Unclassified 2006
166 Ga0163162_10346153 3300013306 Unclassified 1619
167 Ga0163162_10347036 3300013306 Unclassified 1617
168 Ga0157372_10112820 3300013307 Bacteria 3115
169 Ga0157372_11087847 3300013307 Unclassified 925
170 Ga0157375_10044129 3300013308 Bacteria 4328
171 Ga0157375_10265664 3300013308 Bacteria 1877
172 Ga0157375_10447091 3300013308 Bacteria 1458
173 Ga0157375_12440360 3300013308 Unclassified 624
174 Ga0163163_10163783 3300014325 Unclassified 2270
175 Ga0163163_10181004 3300014325 Unclassified 2155
176 Ga0163163_10437651 3300014325 Unclassified 1367
177 Ga0157380_10020005 3300014326 Archaea 4997
178 Ga0157380_10041981 3300014326 Bacteria 3573
179 Ga0157380_10602604 3300014326 Bacteria 1087
180 Ga0157380_13273552 3300014326 Unclassified 518
181 Ga0157379_10042236 3300014968 Bacteria 4070
182 Ga0157379_10126584 3300014968 Unclassified 2299
183 Ga0157376_10017805 3300014969 Bacteria 5430
184 Ga0157376_10108504 3300014969 Unclassified 2439
185 Ga0157376_10239894 3300014969 Bacteria 1688
186 Ga0157376_10413860 3300014969 Unclassified 1306
187 Ga0157376_10683152 3300014969 Unclassified 1030
188 Ga0163161_10000346 3300017792 Bacteria 39215
189 Ga0163161_10132892 3300017792 Unclassified 1879
190 Ga0163161_10571812 3300017792 Bacteria 929
191 Ga0207672_1000276 3300025223 Bacteria 6994
192 Ga0207713_1181433 3300025735 Unclassified 657
193 Ga0207710_10000004 3300025900 Bacteria 846540
194 Ga0207710_10075500 3300025900 Unclassified 1553
195 Ga0207688_10065120 3300025901 Bacteria 2059
196 Ga0207699_10122764 3300025906 Unclassified 1683
197 Ga0207645_10849518 3300025907 Unclassified 620
198 Ga0207643_10090557 3300025908 Unclassified 1783
199 Ga0207684_10025309 3300025910 Bacteria 5057
200 Ga0207707_10107748 3300025912 Bacteria 2436
201 Ga0207707_10452884 3300025912 Unclassified 1098
202 Ga0207671_10342085 3300025914 Bacteria 1185
203 Ga0207660_10106493 3300025917 Bacteria 2102
204 Ga0207660_10455280 3300025917 Unclassified 1035
205 Ga0207649_10319492 3300025920 Unclassified 1140
206 Ga0207652_10234412 3300025921 Bacteria 1654
207 Ga0207652_10245777 3300025921 Bacteria 1613
208 Ga0207646_10138473 3300025922 Bacteria 2192
209 Ga0207650_10056349 3300025925 Bacteria 2920
210 Ga0207650_10101957 3300025925 Bacteria 2210
211 Ga0207650_10166066 3300025925 Bacteria 1752
212 Ga0207659_10018746 3300025926 Bacteria 4541
213 Ga0207659_10172002 3300025926 Unclassified 1709
214 Ga0207659_11837249 3300025926 Unclassified 514
215 Ga0207687_10031653 3300025927 Bacteria 3577
216 Ga0207687_10064881 3300025927 Bacteria 2591
217 Ga0207644_10056700 3300025931 Unclassified 2827
218 Ga0207644_10188845 3300025931 Bacteria 1619
219 Ga0207690_10848848 3300025932 Unclassified 756
220 Ga0207690_10895970 3300025932 Bacteria 736
221 Ga0207706_10035439 3300025933 Bacteria 4436
222 Ga0207706_11196587 3300025933 Unclassified 632
223 Ga0207686_10010503 3300025934 Bacteria 5044
224 Ga0207670_10231854 3300025936 Bacteria 1418
225 Ga0207704_10066364 3300025938 Bacteria 2265
226 Ga0207704_10479802 3300025938 Bacteria 998
227 Ga0207665_10041715 3300025939 Archaea 3066
228 Ga0207711_10033053 3300025941 Bacteria 4375
229 Ga0207711_10037024 3300025941 Bacteria 4142
230 Ga0207711_10129433 3300025941 Unclassified 2262
231 Ga0207689_10272314 3300025942 Bacteria 1402
232 Ga0207689_10299319 3300025942 Unclassified 1333
233 Ga0207661_11066533 3300025944 Unclassified 744
234 Ga0207679_10060810 3300025945 Bacteria 2809
235 Ga0207679_10231363 3300025945 Unclassified 1561
236 Ga0207679_10374878 3300025945 Unclassified 1246
237 Ga0207679_11035819 3300025945 Bacteria 752
238 Ga0207667_10315171 3300025949 Bacteria 1598
239 Ga0207667_10872647 3300025949 Unclassified 893
240 Ga0207712_10059579 3300025961 Unclassified 2703
241 Ga0207712_10077498 3300025961 Unclassified 2409
242 Ga0207712_10117134 3300025961 Bacteria 2009
243 Ga0207712_10228790 3300025961 Unclassified 1491
244 Ga0207712_10912805 3300025961 Unclassified 777
245 Ga0207668_10627653 3300025972 Bacteria 938
246 Ga0207640_10265527 3300025981 Unclassified 1340
247 Ga0207658_10649955 3300025986 Unclassified 950
248 Ga0207658_10794512 3300025986 Unclassified 859
249 Ga0207677_10019307 3300026023 Bacteria 4114
250 Ga0207677_10021807 3300026023 Unclassified 3923
251 Ga0207703_10000127 3300026035 Bacteria 91856
252 Ga0207703_10024004 3300026035 Bacteria 4797
253 Ga0207703_10071888 3300026035 Unclassified 2858
254 Ga0207703_10146284 3300026035 Bacteria 2056
255 Ga0207639_10093244 3300026041 Bacteria 2414
256 Ga0207639_10135571 3300026041 Bacteria 2044
257 Ga0207639_10822990 3300026041 Unclassified 866
258 Ga0207641_10067503 3300026088 Bacteria 3064
259 Ga0207641_10162477 3300026088 Unclassified 2031
260 Ga0207648_10427776 3300026089 Bacteria 1203
261 Ga0207648_11413781 3300026089 Bacteria 654
262 Ga0207676_10065228 3300026095 Bacteria 2899
263 Ga0207676_10157364 3300026095 Unclassified 1964
264 Ga0207676_11628307 3300026095 Bacteria 643
265 Ga0207674_10054569 3300026116 Bacteria 4067
266 Ga0207674_10069772 3300026116 Unclassified 3534
267 Ga0207674_12280679 3300026116 Unclassified 504
268 Ga0207675_100000603 3300026118 Bacteria 35080
269 Ga0207675_100331519 3300026118 Bacteria 1488
270 Ga0207675_102433946 3300026118 Bacteria 535
271 Ga0207698_10478521 3300026142 Unclassified 1207
272 Ga0207698_10515088 3300026142 Unclassified 1166
273 Ga0207698_10799452 3300026142 Unclassified 945
274 Ga0209971_1054089 3300027682 Bacteria 970
275 Ga0209974_10014242 3300027876 Bacteria 2648
276 Ga0207428_10330101 3300027907 Bacteria 1125
277 Ga0268265_10682011 3300028380 Bacteria 991
278 Ga0268265_11496811 3300028380 Unclassified 678
279 Ga0268264_10122911 3300028381 Unclassified 2290
280 Ga0268264_10581004 3300028381 Unclassified 1102
281 Ga0268264_12165117 3300028381 Unclassified 564
282 Ga0265337_1085581 3300028556 Unclassified 861
283 Ga0307408_100227252 3300031548 Bacteria 1526
284 Ga0307408_100497067 3300031548 Bacteria 1067
285 Ga0316575_10004815 3300031665 Bacteria 4769
286 Ga0316579_10022885 3300031691 Bacteria 2799
287 Ga0307405_10011106 3300031731 Bacteria 4701
288 Ga0307405_10991561 3300031731 Unclassified 716
289 Ga0316577_10058895 3300031733 Bacteria 2144
290 Ga0307413_10007511 3300031824 Bacteria 5069
291 Ga0307413_10013255 3300031824 Unclassified 4136
292 Ga0307413_10538595 3300031824 Unclassified 945
293 Ga0307410_10007496 3300031852 Bacteria 5976
294 Ga0307410_10752144 3300031852 Unclassified 825
295 Ga0307410_10919011 3300031852 Bacteria 750
296 Ga0307410_10999116 3300031852 Bacteria 721
297 Ga0326468_10061680 3300031889 Bacteria 599
298 Ga0307406_10005640 3300031901 Bacteria 6843
299 Ga0307407_10001228 3300031903 Bacteria 9087
300 Ga0307407_10239138 3300031903 Bacteria 1238
301 Ga0307409_100002063 3300031995 Bacteria 10328
302 Ga0307409_100056495 3300031995 Bacteria 3036
303 Ga0307409_100958989 3300031995 Bacteria 871
304 Ga0307409_100980085 3300031995 Bacteria 863
305 Ga0307409_101036339 3300031995 Bacteria 840
306 Ga0307409_101195652 3300031995 Bacteria 783
307 Ga0307416_100068916 3300032002 Bacteria 2925
308 Ga0307416_100497798 3300032002 Bacteria 1282
309 Ga0307416_101154671 3300032002 Unclassified 880
310 Ga0307416_101362713 3300032002 Unclassified 815
311 Ga0307416_101542070 3300032002 Unclassified 770
312 Ga0307414_10008182 3300032004 Bacteria 5915
313 Ga0307414_11730832 3300032004 Unclassified 583
314 Ga0307414_11755150 3300032004 Unclassified 579
315 Ga0307411_10095358 3300032005 Bacteria 2088
316 Ga0307411_10221956 3300032005 Unclassified 1467
317 Ga0307411_10339690 3300032005 Unclassified 1220
318 Ga0307411_10357052 3300032005 Bacteria 1193
319 Ga0307411_10673492 3300032005 Unclassified 898
320 Ga0307415_100040041 3300032126 Bacteria 3102
321 Ga0307415_100632940 3300032126 Bacteria 956
322 Ga0316574_0065088 3300035398 Bacteria 2294
323 Ga0373937_0099396 3300036401 Bacteria 2699
324 Ga0316582_0074754 3300036647 Bacteria 2200
325 Ga0316584_0218915 3300036712 Bacteria 1399
326 Ga0373925_0436370 3300037068 Bacteria 1071
327 Ga0395900_0004721 3300037418 Bacteria 14372
328 Ga0395900_1073438 3300037418 Bacteria 723
329 Ga0395905_0082936 3300037471 Bacteria 3004
330 Ga0395905_0109549 3300037471 Unclassified 2593
331 Ga0395905_0986866 3300037471 Bacteria 745
332 Ga0316581_0076145 3300037588 Bacteria 1031
333 Ga0395901_0271521 3300038443 Unclassified 1764
334 Ga0436365_0329471 3300039437 Bacteria 4174
335 Ga0451789_0209738 3300041443 Bacteria 737
336 Ga0453683_0441737 3300044673 Unclassified 841
337 Ga0451576_0611704 3300045051 Unclassified 1145
338 Ga0466967_1536861 3300045976 Bacteria 663
339 Ga0495603_0051162 3300046455 Bacteria 2455
340 Ga0495629_0220272 3300046459 Bacteria 1309
341 Ga0495641_0249110 3300046461 Bacteria 799
342 Ga0495639_0521186 3300046475 Unclassified 608
343 Ga0495635_0039304 3300046663 Bacteria 3273
344 Ga0496101_0119328 3300048904 Bacteria 1993
345 Ga0496105_0095551 3300048908 Unclassified 2455
346 Ga0496109_0344151 3300048912 Unclassified 1408
347 Ga0496109_0999459 3300048912 Unclassified 774
348 Ga0496113_1213788 3300048916 Unclassified 589
349 Ga0496114_0028245 3300048917 Bacteria 4602
350 Ga0501034_0037690 3300049571 Bacteria 4897
351 Ga0501071_0874621 3300049587 Unclassified 693
352 Ga0501075_0095991 3300049591 Bacteria 2250
353 Ga0501075_0271613 3300049591 Bacteria 1292
354 Ga0501076_0780062 3300049592 Unclassified 789
355 Ga0501209_023504 3300049656 Bacteria 1491
356 Ga0501210_039598 3300049657 Bacteria 514
357 Ga0501217_020385 3300049661 Bacteria 1557
358 Ga0501235_008427 3300049669 Bacteria 2250
359 Ga0501247_005037 3300049677 Bacteria 1461
360 Ga0501249_030957 3300049679 Bacteria 1192
361 Ga0501219_028930 3300049703 Bacteria 514
362 Ga0501221_127875 3300049704 Bacteria 655
363 Ga0501081_0726499 3300049743 Unclassified 746
364 Ga0501267_017553 3300049764 Bacteria 770
365 Ga0501268_000862 3300049765 Bacteria 3534
366 Ga0501270_061900 3300049767 Bacteria 704
367 Ga0501272_015135 3300049769 Bacteria 896
368 Ga0501273_004386 3300049770 Bacteria 1548
369 Ga0501044_0004893 3300049823 Bacteria 14967
370 Ga0501212_019933 3300049851 Bacteria 1030
371 nmdc:mga00v17_96835_c1 3300050491 Bacteria 1859
372 nmdc:mga05p37_142107_c1 3300050507 Bacteria 2940
373 nmdc:mga05p37_624152_c1 3300050507 Bacteria 1212
374 nmdc:mga06r32_590278_c1 3300050510 Bacteria 1082
375 nmdc:mga08y16_246349_c1 3300050511 Bacteria 1847
376 nmdc:mga08y16_26334_c1 3300050511 Bacteria 6132
377 nmdc:mga08y16_26681_c1 3300050511 Bacteria 6088
378 nmdc:mga08y16_397483_c1 3300050511 Unclassified 1411
379 nmdc:mga0n895_98695_c1 3300050512 Bacteria 2928
380 nmdc:mga0rr50_236_c1 3300050513 Bacteria 29962
381 nmdc:mga08x19_31_c1 3300050514 Bacteria 209591
382 nmdc:mga08x19_947226_c1 3300050514 Unclassified 612
383 nmdc:mga0a205_233250_c1 3300050515 Bacteria 1723
384 nmdc:mga0a205_88680_c1 3300050515 Bacteria 2990
385 Ga0495601_0623275 3300053077 Unclassified 691
386 Ga0495595_0243544 3300053084 Bacteria 900
387 Ga0495619_0027824 3300053085 Bacteria 3646
388 Ga0501084_0773556 3300054114 Bacteria 809
389 Ga0530510_0009173 3300061734 Bacteria 6931
390 2899275767 2899275550 Bacteria 3958688
391 8057135376 8057132660 Bacteria 4061191
392 Ga0395900_0156955
393 JGI24748J21848_1000002
394 JGI24748J21848_1042258
395 JGI24034J26672_10000004
396 Ga0065712_10172834
397 Ga0065707_10114992
398 Ga0070690_100040904
399 Ga0070670_100060466
400 Ga0070670_100119887
401 Ga0070670_100668359
402 Ga0070677_10623163
403 Ga0068869_100009818
404 Ga0068869_100123292
405 Ga0068869_101391508
406 Ga0070666_10021356
407 Ga0070666_10048931
408 Ga0070680_100430256
409 Ga0070682_101567438
410 Ga0068868_100029781
411 Ga0068868_100043539
412 Ga0070689_100097452
413 Ga0070661_100163586
414 Ga0070668_100042222
415 Ga0070669_100033837
416 Ga0070669_100797618
417 Ga0070675_100042623
418 Ga0070675_100129312
419 Ga0070675_100399664
420 Ga0070675_101056251
421 Ga0070675_101981148
422 Ga0070671_100011252
423 Ga0070671_100236443
424 Ga0070659_100129987
425 Ga0070659_100205959
426 Ga0070659_101107113
427 Ga0070667_100115679
428 Ga0070667_100498738
429 Ga0070667_100827426
430 Ga0070709_10135887
431 Ga0070705_100507707
432 Ga0070694_101641744
433 Ga0070708_100161463
434 Ga0070663_100052560
435 Ga0070678_100612626
436 Ga0070662_100060383
437 Ga0070662_100497251
438 Ga0070681_10035686
439 Ga0070681_10161303
440 Ga0068867_100991901
441 Ga0070685_10110219
442 Ga0070685_10202940
443 Ga0070707_100220956
444 Ga0070698_100270142
445 Ga0070679_100098158
446 Ga0070679_100136196
447 Ga0068853_100076994
448 Ga0068853_100084083
449 Ga0068853_100167474
450 Ga0070672_100281938
451 Ga0070672_100372687
452 Ga0070686_100118621
453 Ga0070686_100759446
454 Ga0070695_100786149
455 Ga0070693_100075937
456 Ga0070704_100264224
457 Ga0068855_100245996
458 Ga0068855_100669187
459 Ga0068855_101665976
460 Ga0070664_100033461
461 Ga0070664_100039328
462 Ga0070664_100245972
463 Ga0070664_100330809
464 Ga0070664_101075708
465 Ga0070664_101411221
466 Ga0068857_100046548
467 Ga0068857_100286783
468 Ga0068854_100114596
469 Ga0068854_100194301
470 Ga0070702_100602251
471 Ga0068852_100060258
472 Ga0068852_100469892
473 Ga0068859_100011890
474 Ga0068859_100022365
475 Ga0068859_100093955
476 Ga0068859_100647206
477 Ga0068864_100024600
478 Ga0068864_100067924
479 Ga0068864_100085412
480 Ga0068864_100150186
481 Ga0068864_100265630
482 Ga0068866_10221397
483 Ga0068861_100064256
484 Ga0068861_101676655
485 Ga0068851_10356011
486 Ga0068870_10031273
487 Ga0068870_10346514
488 Ga0068863_100082399
489 Ga0068863_100172334
490 Ga0068863_100219533
491 Ga0068863_100337821
492 Ga0068858_100000105
493 Ga0068858_100020865
494 Ga0068858_100191691
495 Ga0068860_100086615
496 Ga0068860_100110288
497 Ga0068862_100023706
498 Ga0068862_100056795
499 Ga0068862_100490163
500 Ga0081539_10062578
501 Ga0075364_10003764
502 Ga0075364_10270112
503 Ga0070716_100051003
504 Ga0070716_100517843
505 Ga0097621_100032937
506 Ga0097621_100215067
507 Ga0068871_100034490
508 Ga0068871_100169640
509 Ga0068871_100307128
510 Ga0068871_100461947
511 Ga0068871_100888854
512 Ga0075434_100167577
513 Ga0068865_101642203
514 Ga0075436_100000009
515 Ga0097620_100011890
516 Ga0097620_100022365
517 Ga0097620_100093958
518 Ga0097620_100647230
519 Ga0075435_100000561
520 Ga0105251_10170973
521 Ga0105240_10014852
522 Ga0111539_10022548
523 Ga0111539_10026390
524 Ga0111539_10151560
525 Ga0111539_10364424
526 Ga0105245_10055121
527 Ga0105247_10000005
528 Ga0105247_10145965
529 Ga0114129_10097781
530 Ga0114129_10672327
531 Ga0105241_10517430
532 Ga0105242_10027271
533 Ga0105242_10919211
534 Ga0105248_10126670
535 Ga0105248_10704238
536 Ga0105248_10853770
537 Ga0105237_10230354
538 Ga0105238_11758816
539 Ga0105249_10013873
540 Ga0105249_10191086
541 Ga0105249_10193290
542 Ga0105249_10346518
543 Ga0105239_10022808
544 Ga0105239_11958848
545 Ga0157373_10035537
546 Ga0157373_10107477
547 Ga0157370_10862404
548 Ga0157369_10159687
549 Ga0157369_10238075
550 Ga0157374_10159878
551 Ga0157374_10413357
552 Ga0157378_10021843
553 Ga0157378_10294336
554 Ga0157378_10801061
555 Ga0163162_10019198
556 Ga0163162_10224949
557 Ga0163162_10346153
558 Ga0163162_10347036
559 Ga0157372_10112820
560 Ga0157372_11087847
561 Ga0157375_10044129
562 Ga0157375_10265664
563 Ga0157375_10447091
564 Ga0157375_12440360
565 Ga0163163_10163783
566 Ga0163163_10181004
567 Ga0163163_10437651
568 Ga0157380_10020005
569 Ga0157380_10041981
570 Ga0157380_10602604
571 Ga0157380_13273552
572 Ga0157379_10042236
573 Ga0157379_10126584
574 Ga0157376_10017805
575 Ga0157376_10108504
576 Ga0157376_10239894
577 Ga0157376_10413860
578 Ga0157376_10683152
579 Ga0163161_10000346
580 Ga0163161_10132892
581 Ga0163161_10571812
582 Ga0207672_1000276
583 Ga0207713_1181433
584 Ga0207710_10000004
585 Ga0207710_10075500
586 Ga0207688_10065120
587 Ga0207699_10122764
588 Ga0207645_10849518
589 Ga0207643_10090557
590 Ga0207684_10025309
591 Ga0207707_10107748
592 Ga0207707_10452884
593 Ga0207671_10342085
594 Ga0207660_10106493
595 Ga0207660_10455280
596 Ga0207649_10319492
597 Ga0207652_10234412
598 Ga0207652_10245777
599 Ga0207646_10138473
600 Ga0207650_10056349
601 Ga0207650_10101957
602 Ga0207650_10166066
603 Ga0207659_10018746
604 Ga0207659_10172002
605 Ga0207659_11837249
606 Ga0207687_10031653
607 Ga0207687_10064881
608 Ga0207644_10056700
609 Ga0207644_10188845
610 Ga0207690_10848848
611 Ga0207690_10895970
612 Ga0207706_10035439
613 Ga0207706_11196587
614 Ga0207686_10010503
615 Ga0207670_10231854
616 Ga0207704_10066364
617 Ga0207704_10479802
618 Ga0207665_10041715
619 Ga0207711_10033053
620 Ga0207711_10037024
621 Ga0207711_10129433
622 Ga0207689_10272314
623 Ga0207689_10299319
624 Ga0207661_11066533
625 Ga0207679_10060810
626 Ga0207679_10231363
627 Ga0207679_10374878
628 Ga0207679_11035819
629 Ga0207667_10315171
630 Ga0207667_10872647
631 Ga0207712_10059579
632 Ga0207712_10077498
633 Ga0207712_10117134
634 Ga0207712_10228790
635 Ga0207712_10912805
636 Ga0207668_10627653
637 Ga0207640_10265527
638 Ga0207658_10649955
639 Ga0207658_10794512
640 Ga0207677_10019307
641 Ga0207677_10021807
642 Ga0207703_10000127
643 Ga0207703_10024004
644 Ga0207703_10071888
645 Ga0207703_10146284
646 Ga0207639_10093244
647 Ga0207639_10135571
648 Ga0207639_10822990
649 Ga0207641_10067503
650 Ga0207641_10162477
651 Ga0207648_10427776
652 Ga0207648_11413781
653 Ga0207676_10065228
654 Ga0207676_10157364
655 Ga0207676_11628307
656 Ga0207674_10054569
657 Ga0207674_10069772
658 Ga0207674_12280679
659 Ga0207675_100000603
660 Ga0207675_100331519
661 Ga0207675_102433946
662 Ga0207698_10478521
663 Ga0207698_10515088
664 Ga0207698_10799452
665 Ga0209971_1054089
666 Ga0209974_10014242
667 Ga0207428_10330101
668 Ga0268265_10682011
669 Ga0268265_11496811
670 Ga0268264_10122911
671 Ga0268264_10581004
672 Ga0268264_12165117
673 Ga0265337_1085581
674 Ga0307408_100227252
675 Ga0307408_100497067
676 Ga0316575_10004815
677 Ga0316579_10022885
678 Ga0307405_10011106
679 Ga0307405_10991561
680 Ga0316577_10058895
681 Ga0307413_10007511
682 Ga0307413_10013255
683 Ga0307413_10538595
684 Ga0307410_10007496
685 Ga0307410_10752144
686 Ga0307410_10919011
687 Ga0307410_10999116
688 Ga0326468_10061680
689 Ga0307406_10005640
690 Ga0307407_10001228
691 Ga0307407_10239138
692 Ga0307409_100002063
693 Ga0307409_100056495
694 Ga0307409_100958989
695 Ga0307409_100980085
696 Ga0307409_101036339
697 Ga0307409_101195652
698 Ga0307416_100068916
699 Ga0307416_100497798
700 Ga0307416_101154671
701 Ga0307416_101362713
702 Ga0307416_101542070
703 Ga0307414_10008182
704 Ga0307414_11730832
705 Ga0307414_11755150
706 Ga0307411_10095358
707 Ga0307411_10221956
708 Ga0307411_10339690
709 Ga0307411_10357052
710 Ga0307411_10673492
711 Ga0307415_100040041
712 Ga0307415_100632940
713 Ga0316574_0065088
714 Ga0373937_0099396
715 Ga0316582_0074754
716 Ga0316584_0218915
717 Ga0373925_0436370
718 Ga0395900_0004721
719 Ga0395900_1073438
720 Ga0395905_0082936
721 Ga0395905_0109549
722 Ga0395905_0986866
723 Ga0316581_0076145
724 Ga0395901_0271521
725 Ga0436365_0329471
726 Ga0451789_0209738
727 Ga0453683_0441737
728 Ga0451576_0611704
729 Ga0466967_1536861
730 Ga0495603_0051162
731 Ga0495629_0220272
732 Ga0495641_0249110
733 Ga0495639_0521186
734 Ga0495635_0039304
735 Ga0496101_0119328
736 Ga0496105_0095551
737 Ga0496109_0344151
738 Ga0496109_0999459
739 Ga0496113_1213788
740 Ga0496114_0028245
741 Ga0501034_0037690
742 Ga0501071_0874621
743 Ga0501075_0095991
744 Ga0501075_0271613
745 Ga0501076_0780062
746 Ga0501209_023504
747 Ga0501210_039598
748 Ga0501217_020385
749 Ga0501235_008427
750 Ga0501247_005037
751 Ga0501249_030957
752 Ga0501219_028930
753 Ga0501221_127875
754 Ga0501081_0726499
755 Ga0501267_017553
756 Ga0501268_000862
757 Ga0501270_061900
758 Ga0501272_015135
759 Ga0501273_004386
760 Ga0501044_0004893
761 Ga0501212_019933
762 nmdc:mga00v17_96835_c1
763 nmdc:mga05p37_142107_c1
764 nmdc:mga05p37_624152_c1
765 nmdc:mga06r32_590278_c1
766 nmdc:mga08y16_246349_c1
767 nmdc:mga08y16_26334_c1
768 nmdc:mga08y16_26681_c1
769 nmdc:mga08y16_397483_c1
770 nmdc:mga0n895_98695_c1
771 nmdc:mga0rr50_236_c1
772 nmdc:mga08x19_31_c1
773 nmdc:mga08x19_947226_c1
774 nmdc:mga0a205_233250_c1
775 nmdc:mga0a205_88680_c1
776 Ga0495601_0623275
777 Ga0495595_0243544
778 Ga0495619_0027824
779 Ga0501084_0773556
780 Ga0530510_0009173
781 2899275767
782 8057135376

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09424

YqeY

Yqey-like protein

27

170

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.7347 1 147
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.7263 1 147
2c41-assembly1.cif.gz_C x-ray structure of dps from thermosynechococcus elongatus 0.6128 14 89
2p06-assembly1.cif.gz_A-2 crystal structure of a predicted coding region af_0060 from archaeoglobus fulgidus dsm 4304 0.5686 24 89
8e12-assembly1.cif.gz_C homotrimeric variant of tctrp9, bgl14 0.5642 4 89
ID Description Score Start End Superfamily
af_I6X831_2_93_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9757 3 90 1.10.1510.10
1ng6A01 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9638 1 90 1.10.1510.10
af_C6Y4B8_28_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9632 2 90 1.10.1510.10
af_C6Y4B8_28_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9527 2 90 1.10.1510.10
1ng6A01 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9435 1 90 1.10.1510.10
ID Description Score Start End GO Terms
AF-A0A7X8DSJ1-F1-model_v4 GatB/YqeY domain-containing protein 0.9935 1 91 GO:0016884
AF-A0A539DTT2-F1-model_v4 GatB/YqeY domain-containing protein 0.9923 1 91 GO:0016884
AF-A0A7V5TNJ7-F1-model_v4 GatB/YqeY domain-containing protein 0.9869 1 92 GO:0016884
AF-X1CMI8-F1-model_v4 GatB/YqeY domain-containing protein 0.9833 1 91 GO:0016884
AF-A0A800JZ68-F1-model_v4 GatB/YqeY domain-containing protein 0.9806 1 91 GO:0016884

Map