F432041

General Info

Members Datasets Scaffolds Average Seq Length
391 170 391 306

Family's Representative Sequence

Representative Sequence 3300025918|Ga0207662_10068509|Ga0207662_100685092
Length 364
Sequence MAEDEPGVNAIHSVFNNCQKSGIIPAMNRKIDEEDHCLNCISVTTKVFLMEFGRVEPEELNEIDFRLPPEPPFNKSTLTGRKKPNARVYIGCSKWGRLEWIGKIYPSGTKEKDFLQHYVKHFNSIELNATHYKVYGPKAIENWRLKADGMDFLFCPKMYKGVTHFGKLTDKDFLINEFLRGVLTFKEHLGPILVQVSDAYGPKRKAELFEFLESLPTDVQFFLEVRHPDWFAKKERSEELIDTLRRLKMGFVITDVAGRRDCAHMHLTIPKAFIRFVGNSLHETDHTRIDTWVDRMKSWLAHGIEQVFFFIHMHDEATSPELAVELVDKLNAACGLNLLKPKFLKEPVLARLNACTPDNTRHLH

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
140 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 0.51
Rhizosphere 95.91
Stem 0
Stem Tuber 0
Unclassified 2.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10015304 3300002077 Unclassified 1533
2 JGI25406J46586_10003584 3300003203 Bacteria 7281
3 rootH2_10108403 3300003320 Bacteria 3546
4 rootH2_10272794 3300003320 Bacteria 1656
5 rootL2_10255628 3300003322 Bacteria 1240
6 JGI25160J50197_1000696 3300003354 Bacteria 18548
7 Ga0065714_10074766 3300005288 Bacteria 2992
8 Ga0065714_10146445 3300005288 Bacteria 1109
9 Ga0065712_10010803 3300005290 Unclassified 2926
10 Ga0065712_10029950 3300005290 Bacteria 1389
11 Ga0065712_10083359 3300005290 Bacteria 2840
12 Ga0065712_10084317 3300005290 Bacteria 2773
13 Ga0065712_10224000 3300005290 Bacteria 1032
14 Ga0065707_10128293 3300005295 Unclassified 1968
15 Ga0070658_10030642 3300005327 Bacteria 4321
16 Ga0070676_10004018 3300005328 Bacteria 7721
17 Ga0070676_10077759 3300005328 Bacteria 2006
18 Ga0070676_10141894 3300005328 Bacteria 1530
19 Ga0070683_100059517 3300005329 Bacteria 3549
20 Ga0070683_100064401 3300005329 Bacteria 3412
21 Ga0070683_100101094 3300005329 Bacteria 2715
22 Ga0070683_100181180 3300005329 Bacteria 2000
23 Ga0070683_100291094 3300005329 Bacteria 1553
24 Ga0070690_100051031 3300005330 Unclassified 2640
25 Ga0070690_100058343 3300005330 Bacteria 2478
26 Ga0070690_100376474 3300005330 Bacteria 1037
27 Ga0070670_100027400 3300005331 Bacteria 4902
28 Ga0070670_100037949 3300005331 Bacteria 4143
29 Ga0070670_100093174 3300005331 Bacteria 2591
30 Ga0070670_100106944 3300005331 Bacteria 2411
31 Ga0070670_100400121 3300005331 Unclassified 1212
32 Ga0068869_100004408 3300005334 Bacteria 8746
33 Ga0068869_100066506 3300005334 Bacteria 2656
34 Ga0068869_100137859 3300005334 Bacteria 1881
35 Ga0068869_100182983 3300005334 Bacteria 1644
36 Ga0068869_100344524 3300005334 Bacteria 1213
37 Ga0070682_100000019 3300005337 Bacteria 220844
38 Ga0070682_100070336 3300005337 Bacteria 2237
39 Ga0068868_100003601 3300005338 Bacteria 10796
40 Ga0068868_100010346 3300005338 Bacteria 6748
41 Ga0068868_100030075 3300005338 Bacteria 4164
42 Ga0068868_100377132 3300005338 Bacteria 1220
43 Ga0068868_100390130 3300005338 Bacteria 1200
44 Ga0070689_100034220 3300005340 Bacteria 3876
45 Ga0070689_100301592 3300005340 Bacteria 1334
46 Ga0070661_100003929 3300005344 Bacteria 10225
47 Ga0070661_100011480 3300005344 Bacteria 6170
48 Ga0070668_100053383 3300005347 Bacteria 3117
49 Ga0070669_100010882 3300005353 Bacteria 6458
50 Ga0070669_100133705 3300005353 Bacteria 1906
51 Ga0070669_100178762 3300005353 Bacteria 1659
52 Ga0070675_100008125 3300005354 Bacteria 8135
53 Ga0070675_100012292 3300005354 Bacteria 6709
54 Ga0070675_100146514 3300005354 Bacteria 2022
55 Ga0070671_100187694 3300005355 Bacteria 1751
56 Ga0070673_100021147 3300005364 Bacteria 4709
57 Ga0070673_100028134 3300005364 Bacteria 4176
58 Ga0070673_100051354 3300005364 Bacteria 3228
59 Ga0070673_100115028 3300005364 Unclassified 2236
60 Ga0070673_100383197 3300005364 Bacteria 1254
61 Ga0070688_100016849 3300005365 Bacteria 4184
62 Ga0070688_100046210 3300005365 Bacteria 2695
63 Ga0070688_100073370 3300005365 Unclassified 2195
64 Ga0070659_100008780 3300005366 Bacteria 7399
65 Ga0070667_100022805 3300005367 Bacteria 5191
66 Ga0070667_100153256 3300005367 Unclassified 2026
67 Ga0070678_100025047 3300005456 Bacteria 4006
68 Ga0070678_100120536 3300005456 Bacteria 2068
69 Ga0070662_100126646 3300005457 Bacteria 1964
70 Ga0070662_100135529 3300005457 Bacteria 1903
71 Ga0070662_100299285 3300005457 Bacteria 1306
72 Ga0070681_10460938 3300005458 Bacteria 1183
73 Ga0068867_100111407 3300005459 Bacteria 2103
74 Ga0070685_10005151 3300005466 Bacteria 6626
75 Ga0070685_10050233 3300005466 Bacteria 2409
76 Ga0070685_10080836 3300005466 Unclassified 1948
77 Ga0070685_10143963 3300005466 Bacteria 1504
78 Ga0070698_100003616 3300005471 Bacteria 16995
79 Ga0070684_100005435 3300005535 Bacteria 9756
80 Ga0070684_100255773 3300005535 Bacteria 1601
81 Ga0068853_100007230 3300005539 Bacteria 8894
82 Ga0068853_100008388 3300005539 Bacteria 8298
83 Ga0068853_100042074 3300005539 Bacteria 3905
84 Ga0070672_100006475 3300005543 Bacteria 7874
85 Ga0070672_100020157 3300005543 Bacteria 4859
86 Ga0070686_100010542 3300005544 Bacteria 5216
87 Ga0070686_100235360 3300005544 Bacteria 1331
88 Ga0070665_100022952 3300005548 Bacteria 6283
89 Ga0068855_100136033 3300005563 Bacteria 2804
90 Ga0070664_100026939 3300005564 Bacteria 4774
91 Ga0070664_100069895 3300005564 Bacteria 3005
92 Ga0070664_100265192 3300005564 Bacteria 1546
93 Ga0068857_100000845 3300005577 Bacteria 22943
94 Ga0068857_100018397 3300005577 Bacteria 6131
95 Ga0068857_100137236 3300005577 Bacteria 2209
96 Ga0068857_100164286 3300005577 Bacteria 2015
97 Ga0068857_100331791 3300005577 Bacteria 1406
98 Ga0068854_100013902 3300005578 Bacteria 5295
99 Ga0068854_100043106 3300005578 Bacteria 3196
100 Ga0068854_100185021 3300005578 Bacteria 1629
101 Ga0068854_100431710 3300005578 Bacteria 1096
102 Ga0068856_100038572 3300005614 Bacteria 4690
103 Ga0068852_100031547 3300005616 Bacteria 4375
104 Ga0068852_100437627 3300005616 Bacteria 1292
105 Ga0068859_100020036 3300005617 Bacteria 6717
106 Ga0068859_100057317 3300005617 Bacteria 3924
107 Ga0068859_100390497 3300005617 Bacteria 1487
108 Ga0068859_100517332 3300005617 Bacteria 1288
109 Ga0068864_100010549 3300005618 Bacteria 7636
110 Ga0068864_100012844 3300005618 Bacteria 6927
111 Ga0068864_100050014 3300005618 Unclassified 3596
112 Ga0068864_100300579 3300005618 Bacteria 1502
113 Ga0068864_100407180 3300005618 Bacteria 1294
114 Ga0068866_10298871 3300005718 Bacteria 1004
115 Ga0068861_100007340 3300005719 Bacteria 7551
116 Ga0068861_100018270 3300005719 Bacteria 4993
117 Ga0068861_100062798 3300005719 Bacteria 2854
118 Ga0068870_10013415 3300005840 Bacteria 3850
119 Ga0068870_10076582 3300005840 Bacteria 1837
120 Ga0068870_10104888 3300005840 Bacteria 1604
121 Ga0068870_10144485 3300005840 Bacteria 1395
122 Ga0068863_100003524 3300005841 Bacteria 15444
123 Ga0068863_100082014 3300005841 Bacteria 3056
124 Ga0068863_100165142 3300005841 Bacteria 2123
125 Ga0068858_100032362 3300005842 Bacteria 4857
126 Ga0068858_100072321 3300005842 Bacteria 3200
127 Ga0068858_100280991 3300005842 Unclassified 1585
128 Ga0068858_100297413 3300005842 Bacteria 1539
129 Ga0068860_100000700 3300005843 Bacteria 38538
130 Ga0068860_100013450 3300005843 Bacteria 8026
131 Ga0068860_100042447 3300005843 Bacteria 4343
132 Ga0068860_100199151 3300005843 Unclassified 1940
133 Ga0068862_100025878 3300005844 Bacteria 4929
134 Ga0081539_10000604 3300005985 Bacteria 73040
135 Ga0081539_10152611 3300005985 Unclassified 1109
136 Ga0075366_10027046 3300006195 Bacteria 3364
137 Ga0097621_100071115 3300006237 Bacteria 2875
138 Ga0097621_100086552 3300006237 Bacteria 2616
139 Ga0068871_100050325 3300006358 Bacteria 3370
140 Ga0068871_100055883 3300006358 Bacteria 3206
141 Ga0075428_100029872 3300006844 Bacteria 6029
142 Ga0075428_100032434 3300006844 Bacteria 5769
143 Ga0075430_100003699 3300006846 Bacteria 12849
144 Ga0075431_100015945 3300006847 Bacteria 7624
145 Ga0075434_100683215 3300006871 Bacteria 1044
146 Ga0075429_100015670 3300006880 Bacteria 6568
147 Ga0068865_100002887 3300006881 Bacteria 10243
148 Ga0097620_100020036 3300006931 Bacteria 6717
149 Ga0097620_100057319 3300006931 Bacteria 3924
150 Ga0097620_100390487 3300006931 Bacteria 1487
151 Ga0097620_100517339 3300006931 Bacteria 1288
152 Ga0105240_10316457 3300009093 Bacteria 1780
153 Ga0111539_10003341 3300009094 Bacteria 21191
154 Ga0105247_10001140 3300009101 Bacteria 19671
155 Ga0114129_10103401 3300009147 Bacteria 3938
156 Ga0105241_10273383 3300009174 Bacteria 1440
157 Ga0105242_10124691 3300009176 Bacteria 2215
158 Ga0105242_10186936 3300009176 Bacteria 1831
159 Ga0105242_10270892 3300009176 Bacteria 1538
160 Ga0105237_10198231 3300009545 Bacteria 2007
161 Ga0105249_10002254 3300009553 Bacteria 16736
162 Ga0105249_10005002 3300009553 Bacteria 11437
163 Ga0105249_10011183 3300009553 Bacteria 7883
164 Ga0105249_10057599 3300009553 Bacteria 3560
165 Ga0105249_10114837 3300009553 Bacteria 2550
166 Ga0105249_10132388 3300009553 Bacteria 2382
167 Ga0105239_10722264 3300010375 Bacteria 1140
168 Ga0157373_10015442 3300013100 Bacteria 5582
169 Ga0157373_10061907 3300013100 Bacteria 2650
170 Ga0157371_10107250 3300013102 Bacteria 1982
171 Ga0157374_10002154 3300013296 Bacteria 16590
172 Ga0157374_10009599 3300013296 Bacteria 8312
173 Ga0157374_10056084 3300013296 Bacteria 3678
174 Ga0157374_10220904 3300013296 Bacteria 1859
175 Ga0157374_10230050 3300013296 Bacteria 1821
176 Ga0157374_10241692 3300013296 Bacteria 1775
177 Ga0157374_10506230 3300013296 Bacteria 1212
178 Ga0157378_10018615 3300013297 Bacteria 6105
179 Ga0157378_10021605 3300013297 Bacteria 5660
180 Ga0157378_10052607 3300013297 Bacteria 3623
181 Ga0157378_10060740 3300013297 Bacteria 3372
182 Ga0157378_10225986 3300013297 Bacteria 1781
183 Ga0157378_10717801 3300013297 Bacteria 1020
184 Ga0163162_10001857 3300013306 Bacteria 19899
185 Ga0163162_10002704 3300013306 Bacteria 16820
186 Ga0163162_10005380 3300013306 Bacteria 12362
187 Ga0163162_10022536 3300013306 Bacteria 6207
188 Ga0163162_10027069 3300013306 Bacteria 5670
189 Ga0163162_10028810 3300013306 Bacteria 5496
190 Ga0163162_10437749 3300013306 Bacteria 1440
191 Ga0157372_10014957 3300013307 Bacteria 8307
192 Ga0157372_10202009 3300013307 Bacteria 2302
193 Ga0157372_10313856 3300013307 Unclassified 1825
194 Ga0157372_10554410 3300013307 Unclassified 1340
195 Ga0157375_10040400 3300013308 Bacteria 4496
196 Ga0157375_10064962 3300013308 Bacteria 3635
197 Ga0157375_10077663 3300013308 Bacteria 3351
198 Ga0157375_10115370 3300013308 Bacteria 2789
199 Ga0157375_10130428 3300013308 Bacteria 2632
200 Ga0157375_10223826 3300013308 Bacteria 2040
201 Ga0157375_10239878 3300013308 Bacteria 1972
202 Ga0157375_10277314 3300013308 Bacteria 1839
203 Ga0157375_10480017 3300013308 Unclassified 1408
204 Ga0163163_10001174 3300014325 Bacteria 22214
205 Ga0163163_10023248 3300014325 Bacteria 5881
206 Ga0163163_10148811 3300014325 Unclassified 2386
207 Ga0163163_10383597 3300014325 Unclassified 1463
208 Ga0157380_10005193 3300014326 Bacteria 9099
209 Ga0157380_10015905 3300014326 Bacteria 5536
210 Ga0157380_10079601 3300014326 Bacteria 2676
211 Ga0157380_10090198 3300014326 Bacteria 2528
212 Ga0157380_10128562 3300014326 Unclassified 2158
213 Ga0157380_10129441 3300014326 Bacteria 2151
214 Ga0157380_10139886 3300014326 Bacteria 2078
215 Ga0157377_10026846 3300014745 Bacteria 3085
216 Ga0157377_10060251 3300014745 Unclassified 2166
217 Ga0157377_10096341 3300014745 Bacteria 1755
218 Ga0157377_10166832 3300014745 Bacteria 1374
219 Ga0157377_10267015 3300014745 Bacteria 1116
220 Ga0157379_10011863 3300014968 Bacteria 7612
221 Ga0157376_10035286 3300014969 Bacteria 4045
222 Ga0157376_10064376 3300014969 Bacteria 3092
223 Ga0157376_10456406 3300014969 Bacteria 1248
224 Ga0163161_10002911 3300017792 Bacteria 12114
225 Ga0163161_10065437 3300017792 Bacteria 2653
226 Ga0163161_10160255 3300017792 Unclassified 1715
227 Ga0213876_10001514 3300021384 Bacteria 14378
228 Ga0213876_10007224 3300021384 Bacteria 6056
229 Ga0207426_1000189 3300025302 Bacteria 153457
230 Ga0207682_10127666 3300025893 Bacteria 1133
231 Ga0207642_10011224 3300025899 Bacteria 3187
232 Ga0207642_10026768 3300025899 Unclassified 2352
233 Ga0207688_10004274 3300025901 Bacteria 7786
234 Ga0207647_10018664 3300025904 Bacteria 4683
235 Ga0207645_10008358 3300025907 Bacteria 7222
236 Ga0207645_10104850 3300025907 Bacteria 1826
237 Ga0207643_10053016 3300025908 Bacteria 2304
238 Ga0207643_10095927 3300025908 Bacteria 1734
239 Ga0207705_10059861 3300025909 Bacteria 2749
240 Ga0207671_10091670 3300025914 Bacteria 2290
241 Ga0207671_10265868 3300025914 Unclassified 1350
242 Ga0207662_10068509 3300025918 Bacteria 2143
243 Ga0207649_10000692 3300025920 Bacteria 22205
244 Ga0207681_10442900 3300025923 Bacteria 1056
245 Ga0207650_10010774 3300025925 Bacteria 6277
246 Ga0207650_10049525 3300025925 Bacteria 3102
247 Ga0207659_10009955 3300025926 Bacteria 5953
248 Ga0207659_10107899 3300025926 Bacteria 2111
249 Ga0207659_10171119 3300025926 Bacteria 1714
250 Ga0207659_10215357 3300025926 Bacteria 1541
251 Ga0207690_10007455 3300025932 Bacteria 6493
252 Ga0207690_10128312 3300025932 Bacteria 1852
253 Ga0207706_10027242 3300025933 Bacteria 5111
254 Ga0207706_10031001 3300025933 Bacteria 4765
255 Ga0207706_10031213 3300025933 Unclassified 4748
256 Ga0207706_10063486 3300025933 Bacteria 3251
257 Ga0207706_10171625 3300025933 Bacteria 1905
258 Ga0207670_10018570 3300025936 Bacteria 4231
259 Ga0207670_10065690 3300025936 Bacteria 2490
260 Ga0207670_10072192 3300025936 Bacteria 2389
261 Ga0207670_10195465 3300025936 Bacteria 1533
262 Ga0207670_10345863 3300025936 Bacteria 1176
263 Ga0207669_10032955 3300025937 Bacteria 2917
264 Ga0207704_10282028 3300025938 Bacteria 1263
265 Ga0207704_10363469 3300025938 Bacteria 1131
266 Ga0207665_10416208 3300025939 Bacteria 1026
267 Ga0207691_10010670 3300025940 Bacteria 8819
268 Ga0207691_10026211 3300025940 Bacteria 5470
269 Ga0207689_10021028 3300025942 Bacteria 5485
270 Ga0207689_10056016 3300025942 Bacteria 3244
271 Ga0207689_10058372 3300025942 Bacteria 3174
272 Ga0207689_10063021 3300025942 Bacteria 3049
273 Ga0207661_10001026 3300025944 Bacteria 18511
274 Ga0207661_10053862 3300025944 Bacteria 3221
275 Ga0207661_10097420 3300025944 Bacteria 2463
276 Ga0207679_10004374 3300025945 Bacteria 8795
277 Ga0207679_10014754 3300025945 Bacteria 5147
278 Ga0207712_10026619 3300025961 Bacteria 3855
279 Ga0207712_10028218 3300025961 Bacteria 3752
280 Ga0207712_10076169 3300025961 Unclassified 2427
281 Ga0207712_10127158 3300025961 Bacteria 1936
282 Ga0207668_10227250 3300025972 Unclassified 1502
283 Ga0207668_10230114 3300025972 Bacteria 1494
284 Ga0207640_10023504 3300025981 Bacteria 3705
285 Ga0207640_10114566 3300025981 Bacteria 1918
286 Ga0207658_10051183 3300025986 Bacteria 3043
287 Ga0207658_10069205 3300025986 Bacteria 2666
288 Ga0207677_10020182 3300026023 Bacteria 4041
289 Ga0207677_10031475 3300026023 Bacteria 3398
290 Ga0207677_10057643 3300026023 Bacteria 2669
291 Ga0207677_10194707 3300026023 Bacteria 1606
292 Ga0207703_10009359 3300026035 Bacteria 7700
293 Ga0207703_10212432 3300026035 Unclassified 1726
294 Ga0207639_10032557 3300026041 Bacteria 3839
295 Ga0207639_10047710 3300026041 Bacteria 3238
296 Ga0207639_10050218 3300026041 Bacteria 3167
297 Ga0207639_10053718 3300026041 Bacteria 3075
298 Ga0207639_10558764 3300026041 Bacteria 1051
299 Ga0207678_10071212 3300026067 Bacteria 2981
300 Ga0207678_10092813 3300026067 Bacteria 2580
301 Ga0207702_10034794 3300026078 Bacteria 4214
302 Ga0207641_10000111 3300026088 Bacteria 120527
303 Ga0207641_10003543 3300026088 Bacteria 13815
304 Ga0207641_10076537 3300026088 Unclassified 2893
305 Ga0207641_10178315 3300026088 Bacteria 1944
306 Ga0207641_10419541 3300026088 Bacteria 1288
307 Ga0207641_10552232 3300026088 Unclassified 1123
308 Ga0207648_10000851 3300026089 Bacteria 34467
309 Ga0207648_10004206 3300026089 Bacteria 14872
310 Ga0207648_10008946 3300026089 Bacteria 9633
311 Ga0207676_10010555 3300026095 Bacteria 6583
312 Ga0207676_10020710 3300026095 Unclassified 4815
313 Ga0207676_10210666 3300026095 Bacteria 1724
314 Ga0207676_10392700 3300026095 Bacteria 1294
315 Ga0207674_10002085 3300026116 Bacteria 25310
316 Ga0207674_10015401 3300026116 Bacteria 8400
317 Ga0207674_10026348 3300026116 Bacteria 6177
318 Ga0207674_10063379 3300026116 Unclassified 3731
319 Ga0207674_10118643 3300026116 Bacteria 2616
320 Ga0207674_10198244 3300026116 Unclassified 1957
321 Ga0207674_10269403 3300026116 Bacteria 1650
322 Ga0207674_10360471 3300026116 Bacteria 1405
323 Ga0207675_100001676 3300026118 Bacteria 22158
324 Ga0207675_100104053 3300026118 Bacteria 2675
325 Ga0207675_100124178 3300026118 Bacteria 2444
326 Ga0207675_100165869 3300026118 Unclassified 2109
327 Ga0207683_10003429 3300026121 Bacteria 13817
328 Ga0207683_10011746 3300026121 Bacteria 7473
329 Ga0207698_10218903 3300026142 Bacteria 1719
330 Ga0207698_10457986 3300026142 Bacteria 1233
331 Ga0207698_10572374 3300026142 Bacteria 1110
332 Ga0207428_10099413 3300027907 Bacteria 2250
333 Ga0268265_10029445 3300028380 Bacteria 3941
334 Ga0268265_10240655 3300028380 Bacteria 1597
335 Ga0268264_10011611 3300028381 Bacteria 7267
336 Ga0268264_10015529 3300028381 Bacteria 6242
337 Ga0268264_10054656 3300028381 Bacteria 3335
338 Ga0268264_10065011 3300028381 Bacteria 3072
339 Ga0268264_10505196 3300028381 Bacteria 1180
340 Ga0307515_10000001 3300028794 Bacteria 4259510
341 Ga0265327_10009981 3300031251 Bacteria 6757
342 Ga0265327_10011192 3300031251 Bacteria 6214
343 Ga0307508_10002487 3300031616 Bacteria 19442
344 Ga0307414_10090152 3300032004 Bacteria 2275
345 Ga0307411_10000887 3300032005 Bacteria 11321
346 Ga0307411_10505390 3300032005 Bacteria 1023
347 Ga0373924_0038358 3300035410 Bacteria 1954
348 Ga0395899_0000006 3300037312 Bacteria 666341
349 Ga0395901_0001787 3300038443 Bacteria 22178
350 Ga0436365_0535724 3300039437 Bacteria 3253
351 Ga0436365_1333043 3300039437 Bacteria 1225
352 Ga0436365_1743396 3300039437 Bacteria 55864
353 Ga0451793_0815663 3300041452 Bacteria 1413
354 Ga0439449_0050299 3300042007 Bacteria 1542
355 Ga0453684_0000912 3300044712 Bacteria 98180
356 Ga0453684_0042366 3300044712 Bacteria 6138
357 Ga0495638_0080012 3300046460 Bacteria 1986
358 Ga0495653_0107460 3300046463 Bacteria 2011
359 Ga0495630_0079508 3300046517 Bacteria 2473
360 Ga0495643_0109666 3300046522 Bacteria 1404
361 Ga0495587_0190059 3300046536 Unclassified 1163
362 Ga0495645_0285536 3300046543 Unclassified 1084
363 Ga0495668_0000202 3300046616 Bacteria 87083
364 Ga0495674_0127120 3300047319 Bacteria 2150
365 Ga0495672_0003498 3300047320 Bacteria 13404
366 Ga0495672_0026815 3300047320 Bacteria 3670
367 Ga0495680_0091670 3300047322 Bacteria 2278
368 Ga0495684_0063283 3300047471 Bacteria 2813
369 Ga0495686_0000471 3300047472 Bacteria 60050
370 Ga0495686_0004797 3300047472 Bacteria 10915
371 Ga0495686_0182253 3300047472 Bacteria 1216
372 Ga0496110_0183654 3300048913 Bacteria 1899
373 Ga0501033_0012517 3300049570 Bacteria 6474
374 Ga0501034_0015358 3300049571 Bacteria 7869
375 Ga0501034_0129780 3300049571 Bacteria 2504
376 Ga0501038_0020690 3300049574 Bacteria 5914
377 Ga0501046_0020622 3300049580 Bacteria 5449
378 Ga0501073_0033356 3300049589 Bacteria 3666
379 Ga0501074_0017430 3300049590 Bacteria 5211
380 Ga0501079_0016763 3300049741 Bacteria 5596
381 Ga0501083_0154271 3300049744 Bacteria 1503
382 Ga0501035_0024282 3300049822 Bacteria 5560
383 Ga0501044_0033879 3300049823 Bacteria 5362
384 Ga0501044_0045248 3300049823 Unclassified 4561
385 nmdc:mga05p37_329468_c1 3300050507 Bacteria 1804
386 nmdc:mga09592_129035_c1 3300050508 Bacteria 2175
387 nmdc:mga09592_235118_c1 3300050508 Bacteria 1588
388 nmdc:mga0qj67_25282_c1 3300050509 Bacteria 4587
389 nmdc:mga08y16_131815_c1 3300050511 Bacteria 2599
390 nmdc:mga0n895_633012_c1 3300050512 Bacteria 1070
391 Ga0500611_000008 3300053727 Bacteria 198346

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10108403 rootH2_101084032 267
2 3300003354 JGI25160J50197_1000696 JGI25160J50197_10006966 285
3 3300009093 Ga0105240_10316457 Ga0105240_103164572 285
4 3300025302 Ga0207426_1000189 Ga0207426_100018919 285
5 3300003320 rootH2_10272794 rootH2_102727942 289
6 3300013308 Ga0157375_10223826 Ga0157375_102238262 289
7 3300014326 Ga0157380_10129441 Ga0157380_101294412 289
8 3300025939 Ga0207665_10416208 Ga0207665_104162081 289
9 3300009545 Ga0105237_10198231 Ga0105237_101982312 290
10 3300025914 Ga0207671_10265868 Ga0207671_102658682 290
11 3300026041 Ga0207639_10050218 Ga0207639_100502182 290
12 3300031251 Ga0265327_10011192 Ga0265327_100111922 291
13 3300013307 Ga0157372_10202009 Ga0157372_102020092 292
14 3300025932 Ga0207690_10128312 Ga0207690_101283121 292
15 3300005618 Ga0068864_100050014 Ga0068864_1000500142 294
16 3300005842 Ga0068858_100032362 Ga0068858_1000323622 294
17 3300013296 Ga0157374_10506230 Ga0157374_105062301 294
18 3300013306 Ga0163162_10005380 Ga0163162_1000538013 294
19 3300025961 Ga0207712_10127158 Ga0207712_101271581 294
20 3300003203 JGI25406J46586_10003584 JGI25406J46586_100035844 295
21 3300005295 Ga0065707_10128293 Ga0065707_101282932 295
22 3300005334 Ga0068869_100066506 Ga0068869_1000665062 295
23 3300005334 Ga0068869_100344524 Ga0068869_1003445241 295
24 3300005355 Ga0070671_100187694 Ga0070671_1001876941 295
25 3300005364 Ga0070673_100115028 Ga0070673_1001150282 295
26 3300005466 Ga0070685_10080836 Ga0070685_100808362 295
27 3300005563 Ga0068855_100136033 Ga0068855_1001360332 295
28 3300005577 Ga0068857_100331791 Ga0068857_1003317911 295
29 3300005578 Ga0068854_100185021 Ga0068854_1001850212 295
30 3300005614 Ga0068856_100038572 Ga0068856_1000385722 295
31 3300005618 Ga0068864_100407180 Ga0068864_1004071803 295
32 3300005841 Ga0068863_100082014 Ga0068863_1000820143 295
33 3300005843 Ga0068860_100000700 Ga0068860_1000007007 295
34 3300005985 Ga0081539_10000604 Ga0081539_1000060452 295
35 3300006237 Ga0097621_100086552 Ga0097621_1000865522 295
36 3300009176 Ga0105242_10124691 Ga0105242_101246911 295
37 3300013296 Ga0157374_10241692 Ga0157374_102416922 295
38 3300013297 Ga0157378_10021605 Ga0157378_100216052 295
39 3300013306 Ga0163162_10001857 Ga0163162_100018575 295
40 3300013308 Ga0157375_10077663 Ga0157375_100776632 295
41 3300014325 Ga0163163_10148811 Ga0163163_101488112 295
42 3300025925 Ga0207650_10010774 Ga0207650_100107748 295
43 3300025942 Ga0207689_10058372 Ga0207689_100583723 295
44 3300026023 Ga0207677_10057643 Ga0207677_100576431 295
45 3300026078 Ga0207702_10034794 Ga0207702_100347942 295
46 3300026088 Ga0207641_10003543 Ga0207641_1000354311 295
47 3300026089 Ga0207648_10004206 Ga0207648_100042063 295
48 3300026116 Ga0207674_10118643 Ga0207674_101186432 295
49 3300028381 Ga0268264_10011611 Ga0268264_100116114 295
50 3300031251 Ga0265327_10009981 Ga0265327_100099812 295
51 3300031616 Ga0307508_10002487 Ga0307508_1000248717 295
52 3300032004 Ga0307414_10090152 Ga0307414_100901522 295
53 3300032005 Ga0307411_10000887 Ga0307411_100008874 295
54 3300035410 Ga0373924_0038358 Ga0373924_0038358_635_1522 295
55 3300044712 Ga0453684_0000912 Ga0453684_0000912_36004_36909 295
56 3300046460 Ga0495638_0080012 Ga0495638_0080012_233_1132 295
57 3300046463 Ga0495653_0107460 Ga0495653_0107460_1011_1898 295
58 3300046517 Ga0495630_0079508 Ga0495630_0079508_962_1870 295
59 3300046536 Ga0495587_0190059 Ga0495587_0190059_74_982 295
60 3300046543 Ga0495645_0285536 Ga0495645_0285536_162_1070 295
61 3300047319 Ga0495674_0127120 Ga0495674_0127120_1081_1968 295
62 3300047322 Ga0495680_0091670 Ga0495680_0091670_1240_2127 295
63 3300003322 rootL2_10255628 rootL2_102556281 296
64 3300005577 Ga0068857_100137236 Ga0068857_1001372362 296
65 3300013100 Ga0157373_10015442 Ga0157373_100154424 296
66 3300013296 Ga0157374_10230050 Ga0157374_102300501 296
67 3300013297 Ga0157378_10018615 Ga0157378_100186153 296
68 3300013307 Ga0157372_10554410 Ga0157372_105544102 296
69 3300014326 Ga0157380_10015905 Ga0157380_100159052 296
70 3300025937 Ga0207669_10032955 Ga0207669_100329554 296
71 3300025938 Ga0207704_10282028 Ga0207704_102820281 296
72 3300026116 Ga0207674_10198244 Ga0207674_101982441 296
73 3300037312 Ga0395899_0000006 Ga0395899_0000006_170276_171181 296
74 3300038443 Ga0395901_0001787 Ga0395901_0001787_1749_2651 296
75 3300044712 Ga0453684_0042366 Ga0453684_0042366_1419_2324 296
76 3300049571 Ga0501034_0129780 Ga0501034_0129780_851_1762 296
77 3300049589 Ga0501073_0033356 Ga0501073_0033356_282_1193 296
78 3300049590 Ga0501074_0017430 Ga0501074_0017430_3347_4258 296
79 3300049741 Ga0501079_0016763 Ga0501079_0016763_1648_2559 296
80 3300049744 Ga0501083_0154271 Ga0501083_0154271_210_1121 296
81 3300049823 Ga0501044_0045248 Ga0501044_0045248_3410_4321 296
82 3300005288 Ga0065714_10074766 Ga0065714_100747661 297
83 3300005290 Ga0065712_10224000 Ga0065712_102240001 297
84 3300005328 Ga0070676_10077759 Ga0070676_100777591 297
85 3300005331 Ga0070670_100093174 Ga0070670_1000931742 297
86 3300005331 Ga0070670_100400121 Ga0070670_1004001211 297
87 3300005338 Ga0068868_100390130 Ga0068868_1003901301 297
88 3300005340 Ga0070689_100301592 Ga0070689_1003015922 297
89 3300005347 Ga0070668_100053383 Ga0070668_1000533831 297
90 3300005353 Ga0070669_100010882 Ga0070669_1000108826 297
91 3300005354 Ga0070675_100012292 Ga0070675_1000122925 297
92 3300005365 Ga0070688_100016849 Ga0070688_1000168491 297
93 3300005457 Ga0070662_100126646 Ga0070662_1001266462 297
94 3300005458 Ga0070681_10460938 Ga0070681_104609381 297
95 3300005543 Ga0070672_100020157 Ga0070672_1000201571 297
96 3300005616 Ga0068852_100437627 Ga0068852_1004376272 297
97 3300005617 Ga0068859_100057317 Ga0068859_1000573175 297
98 3300005617 Ga0068859_100517332 Ga0068859_1005173322 297
99 3300005618 Ga0068864_100012844 Ga0068864_1000128446 297
100 3300005719 Ga0068861_100007340 Ga0068861_1000073406 297
101 3300005840 Ga0068870_10013415 Ga0068870_100134153 297
102 3300005842 Ga0068858_100072321 Ga0068858_1000723212 297
103 3300005843 Ga0068860_100013450 Ga0068860_1000134505 297
104 3300006931 Ga0097620_100057319 Ga0097620_1000573195 297
105 3300006931 Ga0097620_100517339 Ga0097620_1005173392 297
106 3300009094 Ga0111539_10003341 Ga0111539_1000334111 297
107 3300009101 Ga0105247_10001140 Ga0105247_100011409 297
108 3300009176 Ga0105242_10270892 Ga0105242_102708921 297
109 3300009553 Ga0105249_10002254 Ga0105249_1000225412 297
110 3300009553 Ga0105249_10057599 Ga0105249_100575991 297
111 3300013100 Ga0157373_10061907 Ga0157373_100619073 297
112 3300013307 Ga0157372_10014957 Ga0157372_100149575 297
113 3300014325 Ga0163163_10383597 Ga0163163_103835972 297
114 3300014326 Ga0157380_10005193 Ga0157380_100051935 297
115 3300014745 Ga0157377_10267015 Ga0157377_102670152 297
116 3300025926 Ga0207659_10107899 Ga0207659_101078992 297
117 3300025933 Ga0207706_10027242 Ga0207706_100272421 297
118 3300025936 Ga0207670_10345863 Ga0207670_103458632 297
119 3300026067 Ga0207678_10071212 Ga0207678_100712121 297
120 3300026116 Ga0207674_10026348 Ga0207674_100263483 297
121 3300026116 Ga0207674_10269403 Ga0207674_102694032 297
122 3300026118 Ga0207675_100001676 Ga0207675_10000167612 297
123 3300027907 Ga0207428_10099413 Ga0207428_100994132 297
124 3300028380 Ga0268265_10029445 Ga0268265_100294453 297
125 3300028381 Ga0268264_10015529 Ga0268264_100155293 297
126 3300039437 Ga0436365_1333043 Ga0436365_1333043_157_1068 297
127 3300042007 Ga0439449_0050299 Ga0439449_0050299_341_1237 297
128 3300046616 Ga0495668_0000202 Ga0495668_0000202_84790_85701 297
129 3300047472 Ga0495686_0000471 Ga0495686_0000471_37598_38509 297
130 3300049570 Ga0501033_0012517 Ga0501033_0012517_2048_2956 297
131 3300049571 Ga0501034_0015358 Ga0501034_0015358_3223_4131 297
132 3300049823 Ga0501044_0033879 Ga0501044_0033879_2685_3593 297
133 3300050511 nmdc:mga08y16_131815_c1 nmdc:mga08y16_131815_c1_533_1426 297
134 3300005329 Ga0070683_100181180 Ga0070683_1001811804 298
135 3300005337 Ga0070682_100000019 Ga0070682_10000001953 298
136 3300005564 Ga0070664_100265192 Ga0070664_1002651922 298
137 3300005985 Ga0081539_10152611 Ga0081539_101526112 298
138 3300013306 Ga0163162_10028810 Ga0163162_100288102 298
139 3300013308 Ga0157375_10239878 Ga0157375_102398782 298
140 3300014969 Ga0157376_10456406 Ga0157376_104564062 298
141 3300017792 Ga0163161_10160255 Ga0163161_101602551 298
142 3300025944 Ga0207661_10097420 Ga0207661_100974204 298
143 3300026041 Ga0207639_10558764 Ga0207639_105587641 298
144 3300026142 Ga0207698_10457986 Ga0207698_104579861 298
145 3300028381 Ga0268264_10505196 Ga0268264_105051962 298
146 3300005288 Ga0065714_10146445 Ga0065714_101464451 299
147 3300005290 Ga0065712_10010803 Ga0065712_100108034 299
148 3300005290 Ga0065712_10029950 Ga0065712_100299502 299
149 3300005290 Ga0065712_10083359 Ga0065712_100833593 299
150 3300005290 Ga0065712_10084317 Ga0065712_100843172 299
151 3300005327 Ga0070658_10030642 Ga0070658_100306423 299
152 3300005328 Ga0070676_10004018 Ga0070676_100040183 299
153 3300005328 Ga0070676_10141894 Ga0070676_101418942 299
154 3300005329 Ga0070683_100059517 Ga0070683_1000595172 299
155 3300005329 Ga0070683_100064401 Ga0070683_1000644012 299
156 3300005329 Ga0070683_100101094 Ga0070683_1001010942 299
157 3300005329 Ga0070683_100291094 Ga0070683_1002910941 299
158 3300005330 Ga0070690_100051031 Ga0070690_1000510312 299
159 3300005330 Ga0070690_100058343 Ga0070690_1000583432 299
160 3300005330 Ga0070690_100376474 Ga0070690_1003764741 299
161 3300005331 Ga0070670_100027400 Ga0070670_1000274003 299
162 3300005331 Ga0070670_100037949 Ga0070670_1000379494 299
163 3300005331 Ga0070670_100106944 Ga0070670_1001069442 299
164 3300005334 Ga0068869_100004408 Ga0068869_1000044085 299
165 3300005334 Ga0068869_100137859 Ga0068869_1001378592 299
166 3300005334 Ga0068869_100182983 Ga0068869_1001829831 299
167 3300005337 Ga0070682_100070336 Ga0070682_1000703362 299
168 3300005338 Ga0068868_100003601 Ga0068868_1000036014 299
169 3300005338 Ga0068868_100010346 Ga0068868_1000103463 299
170 3300005338 Ga0068868_100030075 Ga0068868_1000300752 299
171 3300005338 Ga0068868_100377132 Ga0068868_1003771322 299
172 3300005340 Ga0070689_100034220 Ga0070689_1000342202 299
173 3300005344 Ga0070661_100003929 Ga0070661_1000039292 299
174 3300005344 Ga0070661_100011480 Ga0070661_1000114803 299
175 3300005353 Ga0070669_100133705 Ga0070669_1001337052 299
176 3300005353 Ga0070669_100178762 Ga0070669_1001787621 299
177 3300005354 Ga0070675_100008125 Ga0070675_1000081256 299
178 3300005354 Ga0070675_100146514 Ga0070675_1001465141 299
179 3300005364 Ga0070673_100021147 Ga0070673_1000211475 299
180 3300005364 Ga0070673_100028134 Ga0070673_1000281344 299
181 3300005364 Ga0070673_100051354 Ga0070673_1000513544 299
182 3300005364 Ga0070673_100383197 Ga0070673_1003831972 299
183 3300005365 Ga0070688_100046210 Ga0070688_1000462102 299
184 3300005365 Ga0070688_100073370 Ga0070688_1000733702 299
185 3300005366 Ga0070659_100008780 Ga0070659_1000087805 299
186 3300005367 Ga0070667_100022805 Ga0070667_1000228052 299
187 3300005367 Ga0070667_100153256 Ga0070667_1001532562 299
188 3300005456 Ga0070678_100025047 Ga0070678_1000250472 299
189 3300005456 Ga0070678_100120536 Ga0070678_1001205362 299
190 3300005457 Ga0070662_100135529 Ga0070662_1001355292 299
191 3300005457 Ga0070662_100299285 Ga0070662_1002992852 299
192 3300005459 Ga0068867_100111407 Ga0068867_1001114071 299
193 3300005466 Ga0070685_10005151 Ga0070685_100051513 299
194 3300005466 Ga0070685_10050233 Ga0070685_100502332 299
195 3300005466 Ga0070685_10143963 Ga0070685_101439632 299
196 3300005471 Ga0070698_100003616 Ga0070698_1000036165 299
197 3300005535 Ga0070684_100005435 Ga0070684_1000054355 299
198 3300005535 Ga0070684_100255773 Ga0070684_1002557732 299
199 3300005539 Ga0068853_100007230 Ga0068853_1000072308 299
200 3300005539 Ga0068853_100008388 Ga0068853_1000083882 299
201 3300005539 Ga0068853_100042074 Ga0068853_1000420744 299
202 3300005543 Ga0070672_100006475 Ga0070672_1000064756 299
203 3300005544 Ga0070686_100010542 Ga0070686_1000105423 299
204 3300005544 Ga0070686_100235360 Ga0070686_1002353601 299
205 3300005548 Ga0070665_100022952 Ga0070665_1000229526 299
206 3300005564 Ga0070664_100026939 Ga0070664_1000269395 299
207 3300005564 Ga0070664_100069895 Ga0070664_1000698952 299
208 3300005577 Ga0068857_100000845 Ga0068857_10000084517 299
209 3300005577 Ga0068857_100018397 Ga0068857_1000183975 299
210 3300005577 Ga0068857_100164286 Ga0068857_1001642862 299
211 3300005578 Ga0068854_100013902 Ga0068854_1000139026 299
212 3300005578 Ga0068854_100043106 Ga0068854_1000431063 299
213 3300005578 Ga0068854_100431710 Ga0068854_1004317102 299
214 3300005616 Ga0068852_100031547 Ga0068852_1000315473 299
215 3300005617 Ga0068859_100020036 Ga0068859_1000200367 299
216 3300005617 Ga0068859_100390497 Ga0068859_1003904972 299
217 3300005618 Ga0068864_100010549 Ga0068864_1000105495 299
218 3300005618 Ga0068864_100300579 Ga0068864_1003005792 299
219 3300005718 Ga0068866_10298871 Ga0068866_102988711 299
220 3300005719 Ga0068861_100018270 Ga0068861_1000182703 299
221 3300005719 Ga0068861_100062798 Ga0068861_1000627984 299
222 3300005840 Ga0068870_10076582 Ga0068870_100765822 299
223 3300005840 Ga0068870_10104888 Ga0068870_101048882 299
224 3300005840 Ga0068870_10144485 Ga0068870_101444852 299
225 3300005841 Ga0068863_100003524 Ga0068863_1000035245 299
226 3300005841 Ga0068863_100165142 Ga0068863_1001651422 299
227 3300005842 Ga0068858_100280991 Ga0068858_1002809912 299
228 3300005842 Ga0068858_100297413 Ga0068858_1002974132 299
229 3300005843 Ga0068860_100042447 Ga0068860_1000424471 299
230 3300005843 Ga0068860_100199151 Ga0068860_1001991512 299
231 3300005844 Ga0068862_100025878 Ga0068862_1000258782 299
232 3300006195 Ga0075366_10027046 Ga0075366_100270464 299
233 3300006237 Ga0097621_100071115 Ga0097621_1000711152 299
234 3300006358 Ga0068871_100050325 Ga0068871_1000503254 299
235 3300006358 Ga0068871_100055883 Ga0068871_1000558833 299
236 3300006844 Ga0075428_100029872 Ga0075428_1000298722 299
237 3300006844 Ga0075428_100032434 Ga0075428_1000324345 299
238 3300006846 Ga0075430_100003699 Ga0075430_1000036998 299
239 3300006847 Ga0075431_100015945 Ga0075431_1000159457 299
240 3300006871 Ga0075434_100683215 Ga0075434_1006832151 299
241 3300006880 Ga0075429_100015670 Ga0075429_1000156703 299
242 3300006881 Ga0068865_100002887 Ga0068865_1000028872 299
243 3300006931 Ga0097620_100020036 Ga0097620_1000200365 299
244 3300006931 Ga0097620_100390487 Ga0097620_1003904871 299
245 3300009147 Ga0114129_10103401 Ga0114129_101034015 299
246 3300009174 Ga0105241_10273383 Ga0105241_102733831 299
247 3300009176 Ga0105242_10186936 Ga0105242_101869362 299
248 3300009553 Ga0105249_10005002 Ga0105249_100050024 299
249 3300009553 Ga0105249_10011183 Ga0105249_100111832 299
250 3300009553 Ga0105249_10114837 Ga0105249_101148372 299
251 3300009553 Ga0105249_10132388 Ga0105249_101323882 299
252 3300010375 Ga0105239_10722264 Ga0105239_107222642 299
253 3300013102 Ga0157371_10107250 Ga0157371_101072502 299
254 3300013296 Ga0157374_10002154 Ga0157374_100021542 299
255 3300013296 Ga0157374_10009599 Ga0157374_100095994 299
256 3300013296 Ga0157374_10056084 Ga0157374_100560842 299
257 3300013296 Ga0157374_10220904 Ga0157374_102209042 299
258 3300013297 Ga0157378_10052607 Ga0157378_100526074 299
259 3300013297 Ga0157378_10060740 Ga0157378_100607404 299
260 3300013297 Ga0157378_10225986 Ga0157378_102259862 299
261 3300013297 Ga0157378_10717801 Ga0157378_107178011 299
262 3300013306 Ga0163162_10002704 Ga0163162_1000270410 299
263 3300013306 Ga0163162_10022536 Ga0163162_100225363 299
264 3300013306 Ga0163162_10027069 Ga0163162_100270691 299
265 3300013306 Ga0163162_10437749 Ga0163162_104377491 299
266 3300013307 Ga0157372_10313856 Ga0157372_103138562 299
267 3300013308 Ga0157375_10040400 Ga0157375_100404002 299
268 3300013308 Ga0157375_10064962 Ga0157375_100649623 299
269 3300013308 Ga0157375_10115370 Ga0157375_101153702 299
270 3300013308 Ga0157375_10130428 Ga0157375_101304283 299
271 3300013308 Ga0157375_10277314 Ga0157375_102773142 299
272 3300013308 Ga0157375_10480017 Ga0157375_104800172 299
273 3300014325 Ga0163163_10001174 Ga0163163_1000117412 299
274 3300014325 Ga0163163_10023248 Ga0163163_100232482 299
275 3300014326 Ga0157380_10079601 Ga0157380_100796012 299
276 3300014326 Ga0157380_10090198 Ga0157380_100901982 299
277 3300014326 Ga0157380_10128562 Ga0157380_101285622 299
278 3300014326 Ga0157380_10139886 Ga0157380_101398862 299
279 3300014745 Ga0157377_10026846 Ga0157377_100268463 299
280 3300014745 Ga0157377_10060251 Ga0157377_100602513 299
281 3300014745 Ga0157377_10096341 Ga0157377_100963412 299
282 3300014745 Ga0157377_10166832 Ga0157377_101668322 299
283 3300014968 Ga0157379_10011863 Ga0157379_100118638 299
284 3300014969 Ga0157376_10035286 Ga0157376_100352863 299
285 3300014969 Ga0157376_10064376 Ga0157376_100643763 299
286 3300017792 Ga0163161_10002911 Ga0163161_1000291110 299
287 3300017792 Ga0163161_10065437 Ga0163161_100654373 299
288 3300021384 Ga0213876_10001514 Ga0213876_1000151411 299
289 3300021384 Ga0213876_10007224 Ga0213876_100072245 299
290 3300025893 Ga0207682_10127666 Ga0207682_101276662 299
291 3300025899 Ga0207642_10011224 Ga0207642_100112242 299
292 3300025899 Ga0207642_10026768 Ga0207642_100267682 299
293 3300025901 Ga0207688_10004274 Ga0207688_100042743 299
294 3300025904 Ga0207647_10018664 Ga0207647_100186642 299
295 3300025907 Ga0207645_10008358 Ga0207645_100083586 299
296 3300025907 Ga0207645_10104850 Ga0207645_101048503 299
297 3300025908 Ga0207643_10053016 Ga0207643_100530162 299
298 3300025908 Ga0207643_10095927 Ga0207643_100959272 299
299 3300025909 Ga0207705_10059861 Ga0207705_100598611 299
300 3300025914 Ga0207671_10091670 Ga0207671_100916702 299
301 3300025918 Ga0207662_10068509 Ga0207662_100685092 299
302 3300025920 Ga0207649_10000692 Ga0207649_1000069211 299
303 3300025923 Ga0207681_10442900 Ga0207681_104429002 299
304 3300025925 Ga0207650_10049525 Ga0207650_100495252 299
305 3300025926 Ga0207659_10009955 Ga0207659_100099557 299
306 3300025926 Ga0207659_10171119 Ga0207659_101711191 299
307 3300025926 Ga0207659_10215357 Ga0207659_102153571 299
308 3300025932 Ga0207690_10007455 Ga0207690_100074556 299
309 3300025933 Ga0207706_10031001 Ga0207706_100310017 299
310 3300025933 Ga0207706_10031213 Ga0207706_100312137 299
311 3300025933 Ga0207706_10063486 Ga0207706_100634862 299
312 3300025933 Ga0207706_10171625 Ga0207706_101716252 299
313 3300025936 Ga0207670_10018570 Ga0207670_100185702 299
314 3300025936 Ga0207670_10065690 Ga0207670_100656903 299
315 3300025936 Ga0207670_10072192 Ga0207670_100721922 299
316 3300025936 Ga0207670_10195465 Ga0207670_101954652 299
317 3300025938 Ga0207704_10363469 Ga0207704_103634691 299
318 3300025940 Ga0207691_10010670 Ga0207691_100106703 299
319 3300025940 Ga0207691_10026211 Ga0207691_100262116 299
320 3300025942 Ga0207689_10021028 Ga0207689_100210284 299
321 3300025942 Ga0207689_10056016 Ga0207689_100560162 299
322 3300025942 Ga0207689_10063021 Ga0207689_100630212 299
323 3300025944 Ga0207661_10001026 Ga0207661_100010265 299
324 3300025944 Ga0207661_10053862 Ga0207661_100538622 299
325 3300025945 Ga0207679_10004374 Ga0207679_1000437410 299
326 3300025945 Ga0207679_10014754 Ga0207679_100147542 299
327 3300025961 Ga0207712_10026619 Ga0207712_100266193 299
328 3300025961 Ga0207712_10028218 Ga0207712_100282181 299
329 3300025961 Ga0207712_10076169 Ga0207712_100761692 299
330 3300025972 Ga0207668_10227250 Ga0207668_102272502 299
331 3300025972 Ga0207668_10230114 Ga0207668_102301141 299
332 3300025981 Ga0207640_10023504 Ga0207640_100235043 299
333 3300025981 Ga0207640_10114566 Ga0207640_101145662 299
334 3300025986 Ga0207658_10051183 Ga0207658_100511833 299
335 3300025986 Ga0207658_10069205 Ga0207658_100692052 299
336 3300026023 Ga0207677_10020182 Ga0207677_100201823 299
337 3300026023 Ga0207677_10031475 Ga0207677_100314753 299
338 3300026023 Ga0207677_10194707 Ga0207677_101947071 299
339 3300026035 Ga0207703_10009359 Ga0207703_100093593 299
340 3300026035 Ga0207703_10212432 Ga0207703_102124322 299
341 3300026041 Ga0207639_10032557 Ga0207639_100325573 299
342 3300026041 Ga0207639_10047710 Ga0207639_100477103 299
343 3300026041 Ga0207639_10053718 Ga0207639_100537184 299
344 3300026067 Ga0207678_10092813 Ga0207678_100928132 299
345 3300026088 Ga0207641_10000111 Ga0207641_1000011191 299
346 3300026088 Ga0207641_10076537 Ga0207641_100765371 299
347 3300026088 Ga0207641_10178315 Ga0207641_101783152 299
348 3300026088 Ga0207641_10419541 Ga0207641_104195412 299
349 3300026088 Ga0207641_10552232 Ga0207641_105522322 299
350 3300026089 Ga0207648_10000851 Ga0207648_100008517 299
351 3300026089 Ga0207648_10008946 Ga0207648_100089469 299
352 3300026095 Ga0207676_10010555 Ga0207676_100105558 299
353 3300026095 Ga0207676_10020710 Ga0207676_100207104 299
354 3300026095 Ga0207676_10210666 Ga0207676_102106662 299
355 3300026095 Ga0207676_10392700 Ga0207676_103927002 299
356 3300026116 Ga0207674_10002085 Ga0207674_1000208515 299
357 3300026116 Ga0207674_10015401 Ga0207674_100154013 299
358 3300026116 Ga0207674_10063379 Ga0207674_100633792 299
359 3300026116 Ga0207674_10360471 Ga0207674_103604711 299
360 3300026118 Ga0207675_100104053 Ga0207675_1001040532 299
361 3300026118 Ga0207675_100124178 Ga0207675_1001241782 299
362 3300026118 Ga0207675_100165869 Ga0207675_1001658692 299
363 3300026121 Ga0207683_10003429 Ga0207683_1000342911 299
364 3300026121 Ga0207683_10011746 Ga0207683_100117466 299
365 3300026142 Ga0207698_10218903 Ga0207698_102189032 299
366 3300026142 Ga0207698_10572374 Ga0207698_105723741 299
367 3300028380 Ga0268265_10240655 Ga0268265_102406553 299
368 3300028381 Ga0268264_10054656 Ga0268264_100546562 299
369 3300028381 Ga0268264_10065011 Ga0268264_100650112 299
370 3300028794 Ga0307515_10000001 Ga0307515_100000013334 299
371 3300032005 Ga0307411_10505390 Ga0307411_105053901 299
372 3300039437 Ga0436365_0535724 Ga0436365_0535724_68_994 299
373 3300039437 Ga0436365_1743396 Ga0436365_1743396_6211_7125 299
374 3300041452 Ga0451793_0815663 Ga0451793_0815663_313_1233 299
375 3300046522 Ga0495643_0109666 Ga0495643_0109666_191_1108 299
376 3300047320 Ga0495672_0003498 Ga0495672_0003498_9409_10344 299
377 3300047320 Ga0495672_0026815 Ga0495672_0026815_1834_2745 299
378 3300047471 Ga0495684_0063283 Ga0495684_0063283_1717_2637 299
379 3300047472 Ga0495686_0004797 Ga0495686_0004797_1907_2839 299
380 3300047472 Ga0495686_0182253 Ga0495686_0182253_218_1150 299
381 3300048913 Ga0496110_0183654 Ga0496110_0183654_885_1817 299
382 3300049574 Ga0501038_0020690 Ga0501038_0020690_601_1527 299
383 3300049580 Ga0501046_0020622 Ga0501046_0020622_2008_2934 299
384 3300049822 Ga0501035_0024282 Ga0501035_0024282_651_1577 299
385 3300050507 nmdc:mga05p37_329468_c1 nmdc:mga05p37_329468_c1_574_1494 299
386 3300050508 nmdc:mga09592_129035_c1 nmdc:mga09592_129035_c1_135_1055 299
387 3300050508 nmdc:mga09592_235118_c1 nmdc:mga09592_235118_c1_51_989 299
388 3300050509 nmdc:mga0qj67_25282_c1 nmdc:mga0qj67_25282_c1_118_1038 299
389 3300050512 nmdc:mga0n895_633012_c1 nmdc:mga0n895_633012_c1_66_995 299
390 3300053727 Ga0500611_000008 Ga0500611_000008_35013_35930 299
391 3300002077 JGI24744J21845_10015304 JGI24744J21845_100153043 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01904

DUF72

Protein of unknown function DUF72

105

329

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.7741 34 289
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.7713 34 289
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.7484 39 289
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.6866 39 289
7uek-assembly1.cif.gz_A crystal structure of a de novo designed ovoid tim barrel ot3 0.5792 37 281
ID Description Score Start End Superfamily
af_P37348_1_259_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8701 39 289 3.20.20.410
af_P37348_1_259_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.841 39 289 3.20.20.410
1vpyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7546 36 289 3.20.20.410
1ztvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7518 36 289 3.20.20.410
1vpyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7488 36 289 3.20.20.410
ID Description Score Start End GO Terms
AF-A0A561PNI0-F1-model_v4 Uncharacterized protein YecE (DUF72 family) 0.9798 1 295
AF-A0A317H2T4-F1-model_v4 DUF72 domain-containing protein 0.9788 1 295
AF-A0A4Q5YD53-F1-model_v4 DUF72 domain-containing protein 0.9757 35 300
AF-A0A3D1P5J1-F1-model_v4 DUF72 domain-containing protein 0.9751 40 207
AF-A0A6I6GBD0-F1-model_v4 DUF72 domain-containing protein 0.9747 25 299

Feature Viewer

pLDDT pTM Quality
89.53 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map