F431990

General Info

Members Datasets Scaffolds Average Seq Length
391 209 391 137

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100308991|Ga0097621_1003089912
Length 156
Sequence MVKRCCKDIGKLTFDPTFLTMVYLTRAEHFNAAHKLYNPAWSHEKNEEVFGKCANENWHGHNYELLVTVKGKPDPDTGFVFDVKRLSVIINEHIIEKLDHQNLNIDVDFMKGKMCSTENLAVAIWEQLKPHLPAGVSLHCIKLYETPRIYVEYYGE

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
161 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
162 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
163 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
164 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
206 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
207 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
208 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
209 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.05
Nodule 0
Rhizoplane 0.77
Rhizosphere 95.14
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10085119 3300001979 Bacteria 822
2 JGI24751J29686_10000772 3300002459 Bacteria 7557
3 rootL2_10121209 3300003322 Bacteria 1216
4 rootH1_10267672 3300003323 Bacteria 1353
5 Ga0065704_10174398 3300005289 Bacteria 1272
6 Ga0065712_10005324 3300005290 Bacteria 2917
7 Ga0065712_10429926 3300005290 Bacteria 704
8 Ga0065715_10154564 3300005293 Bacteria 1691
9 Ga0070658_10448498 3300005327 Unclassified 1111
10 Ga0070676_11027419 3300005328 Bacteria 620
11 Ga0070683_100131620 3300005329 Bacteria 2367
12 Ga0070670_100008042 3300005331 Bacteria 8971
13 Ga0070670_100155216 3300005331 Bacteria 1982
14 Ga0070670_100274846 3300005331 Bacteria 1470
15 Ga0070670_100791309 3300005331 Bacteria 856
16 Ga0070670_100837222 3300005331 Bacteria 832
17 Ga0070670_100932174 3300005331 Bacteria 788
18 Ga0070677_10070792 3300005333 Bacteria 1466
19 Ga0068869_100029417 3300005334 Bacteria 3848
20 Ga0068869_100032320 3300005334 Bacteria 3687
21 Ga0068869_100731840 3300005334 Bacteria 846
22 Ga0068869_101478483 3300005334 Bacteria 603
23 Ga0070666_10200916 3300005335 Bacteria 1402
24 Ga0070680_100001161 3300005336 Bacteria 18914
25 Ga0070680_101181699 3300005336 Bacteria 662
26 Ga0070682_100060378 3300005337 Bacteria 2398
27 Ga0068868_100019091 3300005338 Bacteria 5133
28 Ga0068868_100904639 3300005338 Unclassified 802
29 Ga0070660_100093540 3300005339 Unclassified 2374
30 Ga0070660_100115666 3300005339 Bacteria 2138
31 Ga0070660_100202827 3300005339 Bacteria 1609
32 Ga0070689_100003233 3300005340 Bacteria 10800
33 Ga0070689_100086757 3300005340 Bacteria 2461
34 Ga0070689_101508984 3300005340 Bacteria 609
35 Ga0070691_10641720 3300005341 Bacteria 631
36 Ga0070661_100155270 3300005344 Bacteria 1731
37 Ga0070668_100406164 3300005347 Bacteria 1164
38 Ga0070669_100184178 3300005353 Bacteria 1635
39 Ga0070669_100286317 3300005353 Bacteria 1322
40 Ga0070669_100559380 3300005353 Bacteria 954
41 Ga0070669_101176022 3300005353 Bacteria 662
42 Ga0070675_100090260 3300005354 Bacteria 2566
43 Ga0070675_100116537 3300005354 Bacteria 2266
44 Ga0070675_100313017 3300005354 Bacteria 1386
45 Ga0070674_100217318 3300005356 Bacteria 1485
46 Ga0070674_100771562 3300005356 Bacteria 828
47 Ga0070673_100148021 3300005364 Unclassified 1986
48 Ga0070673_100333219 3300005364 Bacteria 1343
49 Ga0070673_100635765 3300005364 Bacteria 976
50 Ga0070688_100062258 3300005365 Bacteria 2361
51 Ga0070688_100213391 3300005365 Bacteria 1356
52 Ga0070659_100024838 3300005366 Bacteria 4597
53 Ga0070659_100147402 3300005366 Bacteria 1918
54 Ga0070667_100238895 3300005367 Bacteria 1622
55 Ga0070667_100293329 3300005367 Bacteria 1463
56 Ga0070701_10234373 3300005438 Bacteria 1101
57 Ga0070701_10591447 3300005438 Bacteria 734
58 Ga0070663_100571723 3300005455 Bacteria 947
59 Ga0070663_100713652 3300005455 Bacteria 853
60 Ga0070662_100019726 3300005457 Bacteria 4581
61 Ga0070681_10148817 3300005458 Bacteria 2269
62 Ga0068867_100059460 3300005459 Bacteria 2833
63 Ga0070685_10013974 3300005466 Bacteria 4247
64 Ga0070685_10075641 3300005466 Bacteria 2006
65 Ga0070685_10559244 3300005466 Bacteria 818
66 Ga0070707_100721072 3300005468 Bacteria 960
67 Ga0070698_100004297 3300005471 Bacteria 15668
68 Ga0070698_100064272 3300005471 Bacteria 3698
69 Ga0070698_100933674 3300005471 Bacteria 814
70 Ga0070699_100219785 3300005518 Bacteria 1693
71 Ga0070679_100022880 3300005530 Bacteria 6112
72 Ga0070679_100249333 3300005530 Bacteria 1732
73 Ga0070684_100020996 3300005535 Bacteria 5424
74 Ga0068853_100014917 3300005539 Bacteria 6382
75 Ga0068853_100127583 3300005539 Bacteria 2274
76 Ga0068853_100527868 3300005539 Bacteria 1116
77 Ga0068853_101075864 3300005539 Unclassified 775
78 Ga0070695_100469127 3300005545 Unclassified 968
79 Ga0070693_100332702 3300005547 Unclassified 1034
80 Ga0070693_100355200 3300005547 Bacteria 1004
81 Ga0070693_100459843 3300005547 Unclassified 895
82 Ga0070665_101474084 3300005548 Bacteria 689
83 Ga0070704_100109363 3300005549 Bacteria 2100
84 Ga0068855_100004384 3300005563 Bacteria 17247
85 Ga0068855_100017986 3300005563 Bacteria 8493
86 Ga0068855_100308442 3300005563 Bacteria 1751
87 Ga0070664_100010365 3300005564 Bacteria 7562
88 Ga0068857_100053347 3300005577 Bacteria 3587
89 Ga0068857_100565443 3300005577 Bacteria 1072
90 Ga0068857_100606757 3300005577 Unclassified 1035
91 Ga0068857_101647631 3300005577 Bacteria 627
92 Ga0068857_102386775 3300005577 Unclassified 519
93 Ga0068854_100308481 3300005578 Unclassified 1283
94 Ga0068854_101451915 3300005578 Unclassified 621
95 Ga0068856_100028048 3300005614 Bacteria 5494
96 Ga0068856_100099393 3300005614 Bacteria 2900
97 Ga0070702_100227475 3300005615 Bacteria 1251
98 Ga0068852_100205110 3300005616 Bacteria 1867
99 Ga0068852_100336650 3300005616 Bacteria 1470
100 Ga0068859_100004125 3300005617 Bacteria 14825
101 Ga0068859_100094140 3300005617 Bacteria 3048
102 Ga0068859_100137450 3300005617 Bacteria 2517
103 Ga0068859_100584939 3300005617 Bacteria 1210
104 Ga0068859_100617976 3300005617 Bacteria 1176
105 Ga0068859_100724191 3300005617 Bacteria 1085
106 Ga0068859_101046216 3300005617 Bacteria 897
107 Ga0068864_100079743 3300005618 Bacteria 2867
108 Ga0068864_100209782 3300005618 Bacteria 1793
109 Ga0068864_101744316 3300005618 Bacteria 628
110 Ga0068864_102027031 3300005618 Bacteria 582
111 Ga0068866_10059633 3300005718 Bacteria 1975
112 Ga0068861_100041368 3300005719 Bacteria 3452
113 Ga0068861_100097817 3300005719 Bacteria 2329
114 Ga0068861_100772474 3300005719 Unclassified 899
115 Ga0068861_100908939 3300005719 Bacteria 834
116 Ga0068863_100075802 3300005841 Bacteria 3182
117 Ga0068863_100408859 3300005841 Unclassified 1328
118 Ga0068863_100427252 3300005841 Bacteria 1298
119 Ga0068858_101417076 3300005842 Bacteria 685
120 Ga0068860_100014161 3300005843 Bacteria 7822
121 Ga0068860_100062175 3300005843 Bacteria 3548
122 Ga0068862_100012084 3300005844 Bacteria 7135
123 Ga0068862_100135791 3300005844 Bacteria 2179
124 Ga0068862_101378265 3300005844 Unclassified 708
125 Ga0081539_10075288 3300005985 Unclassified 1794
126 Ga0070715_10392793 3300006163 Bacteria 769
127 Ga0097621_100174727 3300006237 Bacteria 1853
128 Ga0097621_100308991 3300006237 Bacteria 1398
129 Ga0068871_100096614 3300006358 Bacteria 2469
130 Ga0068871_100555260 3300006358 Unclassified 1040
131 Ga0075428_100097386 3300006844 Bacteria 3207
132 Ga0075428_100164168 3300006844 Bacteria 2409
133 Ga0075430_100775146 3300006846 Bacteria 790
134 Ga0075430_100885158 3300006846 Bacteria 736
135 Ga0075431_100063374 3300006847 Bacteria 3815
136 Ga0075429_100194687 3300006880 Bacteria 1776
137 Ga0068865_100129747 3300006881 Bacteria 1887
138 Ga0068865_100338215 3300006881 Unclassified 1216
139 Ga0068865_100917889 3300006881 Unclassified 762
140 Ga0097620_100004125 3300006931 Bacteria 14825
141 Ga0097620_100094139 3300006931 Bacteria 3048
142 Ga0097620_100137460 3300006931 Bacteria 2517
143 Ga0097620_100584900 3300006931 Bacteria 1210
144 Ga0097620_100618060 3300006931 Bacteria 1176
145 Ga0097620_100724133 3300006931 Bacteria 1085
146 Ga0097620_101046154 3300006931 Bacteria 897
147 Ga0111539_10003344 3300009094 Bacteria 21184
148 Ga0111539_10585795 3300009094 Unclassified 1299
149 Ga0105247_10000597 3300009101 Bacteria 29260
150 Ga0114129_10017099 3300009147 Bacteria 10328
151 Ga0105243_11400240 3300009148 Bacteria 720
152 Ga0105241_10149497 3300009174 Bacteria 1909
153 Ga0105241_10848250 3300009174 Bacteria 845
154 Ga0105242_10054894 3300009176 Bacteria 3258
155 Ga0105242_12230630 3300009176 Bacteria 593
156 Ga0105248_11642733 3300009177 Unclassified 728
157 Ga0105237_11551876 3300009545 Bacteria 669
158 Ga0105249_10000406 3300009553 Bacteria 41452
159 Ga0105249_10006136 3300009553 Bacteria 10425
160 Ga0105249_10006600 3300009553 Bacteria 10096
161 Ga0105249_10429093 3300009553 Bacteria 1357
162 Ga0105249_10882184 3300009553 Bacteria 961
163 Ga0105249_10976777 3300009553 Bacteria 915
164 Ga0105249_12180000 3300009553 Bacteria 627
165 Ga0157373_10000871 3300013100 Bacteria 23357
166 Ga0157371_10001281 3300013102 Bacteria 26505
167 Ga0157371_10004640 3300013102 Bacteria 11903
168 Ga0157371_10007255 3300013102 Bacteria 9003
169 Ga0157371_10029027 3300013102 Bacteria 4004
170 Ga0157371_10038966 3300013102 Bacteria 3399
171 Ga0157371_10355927 3300013102 Bacteria 1066
172 Ga0157371_11396587 3300013102 Unclassified 544
173 Ga0157370_10004123 3300013104 Bacteria 16845
174 Ga0157370_10048893 3300013104 Bacteria 4051
175 Ga0157370_10140521 3300013104 Bacteria 2250
176 Ga0157369_10016808 3300013105 Bacteria 8224
177 Ga0157369_10104568 3300013105 Unclassified 3015
178 Ga0157369_10324259 3300013105 Bacteria 1601
179 Ga0157369_10365523 3300013105 Bacteria 1498
180 Ga0157369_12141232 3300013105 Unclassified 567
181 Ga0157374_10719871 3300013296 Bacteria 1012
182 Ga0157378_10189175 3300013297 Bacteria 1941
183 Ga0157378_10339329 3300013297 Bacteria 1465
184 Ga0157378_11011054 3300013297 Bacteria 866
185 Ga0157378_13048836 3300013297 Bacteria 520
186 Ga0163162_10154555 3300013306 Bacteria 2413
187 Ga0163162_10471106 3300013306 Bacteria 1387
188 Ga0157372_10003325 3300013307 Bacteria 17373
189 Ga0157372_10189143 3300013307 Unclassified 2384
190 Ga0157372_10318825 3300013307 Bacteria 1810
191 Ga0157372_10834533 3300013307 Bacteria 1070
192 Ga0157372_11112463 3300013307 Bacteria 914
193 Ga0157375_10050994 3300013308 Bacteria 4061
194 Ga0163163_10075156 3300014325 Bacteria 3372
195 Ga0163163_10190436 3300014325 Bacteria 2100
196 Ga0163163_10371082 3300014325 Unclassified 1488
197 Ga0157380_13001134 3300014326 Bacteria 538
198 Ga0157377_10319397 3300014745 Bacteria 1031
199 Ga0157379_10351333 3300014968 Bacteria 1350
200 Ga0157379_11046519 3300014968 Unclassified 780
201 Ga0157376_10101062 3300014969 Bacteria 2519
202 Ga0157376_10367722 3300014969 Bacteria 1381
203 Ga0163161_10233103 3300017792 Bacteria 1429
204 Ga0213876_10326532 3300021384 Unclassified 816
205 Ga0213876_10545581 3300021384 Bacteria 617
206 Ga0207697_10119181 3300025315 Bacteria 1135
207 Ga0207656_10126305 3300025321 Bacteria 1195
208 Ga0207682_10168436 3300025893 Unclassified 996
209 Ga0207642_10184163 3300025899 Bacteria 1140
210 Ga0207710_10000352 3300025900 Bacteria 33079
211 Ga0207645_10099476 3300025907 Bacteria 1875
212 Ga0207643_10384916 3300025908 Unclassified 885
213 Ga0207705_10013020 3300025909 Bacteria 6004
214 Ga0207705_10047900 3300025909 Bacteria 3074
215 Ga0207705_10073876 3300025909 Bacteria 2474
216 Ga0207654_10196187 3300025911 Unclassified 1326
217 Ga0207654_10434699 3300025911 Bacteria 918
218 Ga0207695_10435017 3300025913 Bacteria 1195
219 Ga0207671_10871865 3300025914 Bacteria 712
220 Ga0207660_10004204 3300025917 Bacteria 9370
221 Ga0207662_10143816 3300025918 Bacteria 1512
222 Ga0207662_10159605 3300025918 Bacteria 1440
223 Ga0207657_10292507 3300025919 Bacteria 1291
224 Ga0207657_10535039 3300025919 Unclassified 917
225 Ga0207646_10161401 3300025922 Bacteria 2023
226 Ga0207681_10233099 3300025923 Bacteria 1430
227 Ga0207681_10371632 3300025923 Bacteria 1149
228 Ga0207681_10490263 3300025923 Bacteria 1005
229 Ga0207681_10495949 3300025923 Bacteria 999
230 Ga0207650_10047013 3300025925 Bacteria 3179
231 Ga0207650_10056844 3300025925 Bacteria 2908
232 Ga0207650_10825460 3300025925 Bacteria 786
233 Ga0207650_11047454 3300025925 Bacteria 694
234 Ga0207650_11190704 3300025925 Bacteria 649
235 Ga0207659_10089847 3300025926 Bacteria 2291
236 Ga0207659_10178151 3300025926 Bacteria 1682
237 Ga0207659_11277187 3300025926 Bacteria 630
238 Ga0207644_10223715 3300025931 Bacteria 1493
239 Ga0207690_10071336 3300025932 Bacteria 2395
240 Ga0207690_10329297 3300025932 Bacteria 1202
241 Ga0207686_10008317 3300025934 Bacteria 5597
242 Ga0207686_10046633 3300025934 Bacteria 2674
243 Ga0207670_10037359 3300025936 Bacteria 3164
244 Ga0207670_10125772 3300025936 Bacteria 1870
245 Ga0207704_10068888 3300025938 Unclassified 2233
246 Ga0207691_10204589 3300025940 Bacteria 1717
247 Ga0207689_10092180 3300025942 Bacteria 2489
248 Ga0207689_10109282 3300025942 Bacteria 2272
249 Ga0207689_10370806 3300025942 Bacteria 1191
250 Ga0207689_11145914 3300025942 Unclassified 655
251 Ga0207661_10118933 3300025944 Bacteria 2247
252 Ga0207661_10343186 3300025944 Bacteria 1346
253 Ga0207667_10000539 3300025949 Bacteria 49978
254 Ga0207667_10037172 3300025949 Bacteria 5207
255 Ga0207651_10165917 3300025960 Bacteria 1736
256 Ga0207651_11136221 3300025960 Unclassified 700
257 Ga0207712_10011571 3300025961 Bacteria 5625
258 Ga0207712_10015807 3300025961 Bacteria 4875
259 Ga0207712_10666503 3300025961 Bacteria 905
260 Ga0207668_10151329 3300025972 Bacteria 1797
261 Ga0207668_11514962 3300025972 Bacteria 605
262 Ga0207640_10052116 3300025981 Unclassified 2664
263 Ga0207640_11431567 3300025981 Bacteria 620
264 Ga0207658_10230522 3300025986 Bacteria 1563
265 Ga0207658_10266348 3300025986 Bacteria 1462
266 Ga0207677_10195386 3300026023 Bacteria 1604
267 Ga0207703_10880929 3300026035 Bacteria 857
268 Ga0207703_11333240 3300026035 Bacteria 690
269 Ga0207639_10019442 3300026041 Bacteria 4844
270 Ga0207639_10208852 3300026041 Unclassified 1679
271 Ga0207639_10871245 3300026041 Bacteria 841
272 Ga0207639_10874106 3300026041 Bacteria 840
273 Ga0207639_10978941 3300026041 Unclassified 792
274 Ga0207678_10373837 3300026067 Bacteria 1231
275 Ga0207678_10735269 3300026067 Bacteria 869
276 Ga0207708_11232684 3300026075 Unclassified 654
277 Ga0207702_11306556 3300026078 Bacteria 719
278 Ga0207641_10000394 3300026088 Bacteria 51467
279 Ga0207641_10021463 3300026088 Bacteria 5306
280 Ga0207641_10513005 3300026088 Bacteria 1165
281 Ga0207648_10012535 3300026089 Bacteria 7933
282 Ga0207676_10035984 3300026095 Unclassified 3763
283 Ga0207676_10058028 3300026095 Bacteria 3051
284 Ga0207676_10281504 3300026095 Bacteria 1510
285 Ga0207676_10997893 3300026095 Bacteria 825
286 Ga0207674_10086254 3300026116 Bacteria 3134
287 Ga0207674_11196934 3300026116 Bacteria 729
288 Ga0207674_12061371 3300026116 Unclassified 535
289 Ga0207675_100048494 3300026118 Bacteria 3964
290 Ga0207675_100413795 3300026118 Bacteria 1330
291 Ga0207683_10103636 3300026121 Bacteria 2542
292 Ga0207698_10285537 3300026142 Unclassified 1529
293 Ga0207698_10468583 3300026142 Unclassified 1219
294 Ga0209974_10135584 3300027876 Bacteria 880
295 Ga0268266_10946127 3300028379 Unclassified 833
296 Ga0268266_11316025 3300028379 Bacteria 698
297 Ga0268265_10216734 3300028380 Bacteria 1672
298 Ga0268265_10388972 3300028380 Unclassified 1285
299 Ga0268265_10448404 3300028380 Bacteria 1204
300 Ga0268265_11422499 3300028380 Bacteria 696
301 Ga0268265_11833891 3300028380 Bacteria 613
302 Ga0268264_10021029 3300028381 Bacteria 5332
303 Ga0268264_10040412 3300028381 Bacteria 3854
304 Ga0307515_10000036 3300028794 Bacteria 332188
305 Ga0265327_10025866 3300031251 Bacteria 3412
306 Ga0307516_10133562 3300031730 Bacteria 2259
307 Ga0307410_10043611 3300031852 Bacteria 2974
308 Ga0307407_10719566 3300031903 Bacteria 753
309 Ga0307412_11388515 3300031911 Bacteria 635
310 Ga0307412_11462294 3300031911 Bacteria 620
311 Ga0307412_11752488 3300031911 Bacteria 570
312 Ga0307409_102146085 3300031995 Bacteria 588
313 Ga0307416_100743429 3300032002 Bacteria 1073
314 Ga0307414_10612586 3300032004 Bacteria 978
315 Ga0307414_11299821 3300032004 Unclassified 675
316 Ga0395899_0003690 3300037312 Bacteria 12116
317 Ga0395899_0006392 3300037312 Bacteria 9127
318 Ga0395899_0042473 3300037312 Bacteria 3394
319 Ga0395899_0179246 3300037312 Bacteria 1488
320 Ga0395900_0021261 3300037418 Bacteria 6634
321 Ga0395900_0059584 3300037418 Bacteria 3930
322 Ga0395900_0097680 3300037418 Bacteria 3017
323 Ga0395900_0399724 3300037418 Unclassified 1338
324 Ga0395900_0413158 3300037418 Bacteria 1311
325 Ga0395898_0030436 3300037466 Bacteria 5401
326 Ga0395898_0032767 3300037466 Bacteria 5188
327 Ga0395898_0092311 3300037466 Bacteria 2911
328 Ga0395898_0261301 3300037466 Bacteria 1651
329 Ga0395898_1923066 3300037466 Bacteria 511
330 Ga0395905_0098876 3300037471 Bacteria 2740
331 Ga0395901_0010634 3300038443 Bacteria 9325
332 Ga0395901_0020749 3300038443 Bacteria 6726
333 Ga0395901_0042115 3300038443 Bacteria 4733
334 Ga0395901_0072115 3300038443 Bacteria 3599
335 Ga0395901_0328637 3300038443 Unclassified 1581
336 Ga0436365_0746598 3300039437 Bacteria 2111
337 Ga0436365_1718473 3300039437 Unclassified 692
338 Ga0439436_0115383 3300041404 Bacteria 750
339 Ga0439465_0009961 3300041413 Bacteria 2992
340 Ga0451793_1589203 3300041452 Bacteria 1109
341 Ga0439431_0011958 3300041997 Bacteria 1989
342 Ga0439445_0020543 3300042004 Bacteria 1654
343 Ga0439449_0003148 3300042007 Bacteria 6421
344 Ga0439434_0352638 3300042435 Bacteria 514
345 Ga0466965_0226189 3300044683 Unclassified 998
346 Ga0466965_0514000 3300044683 Unclassified 673
347 Ga0453684_1315737 3300044712 Bacteria 753
348 Ga0451576_0497089 3300045051 Bacteria 1281
349 Ga0495650_0036594 3300046471 Bacteria 2146
350 Ga0495639_0103258 3300046475 Bacteria 1348
351 Ga0495643_0035714 3300046522 Bacteria 2735
352 Ga0495668_0003488 3300046616 Bacteria 11743
353 Ga0495672_0006319 3300047320 Bacteria 9212
354 Ga0495686_0047203 3300047472 Bacteria 2720
355 Ga0496104_0936177 3300048907 Bacteria 771
356 Ga0496112_0740371 3300048915 Bacteria 910
357 Ga0501032_0005427 3300049569 Bacteria 9476
358 Ga0501034_0000693 3300049571 Bacteria 51177
359 Ga0501034_0002458 3300049571 Bacteria 22331
360 Ga0501036_0041710 3300049572 Bacteria 3883
361 Ga0501039_0022474 3300049575 Bacteria 4842
362 Ga0501043_0017398 3300049579 Bacteria 5635
363 Ga0501046_0023437 3300049580 Bacteria 5078
364 Ga0501047_0024377 3300049581 Bacteria 5807
365 Ga0501048_0424227 3300049582 Bacteria 951
366 Ga0501070_0058088 3300049586 Bacteria 3207
367 Ga0501073_0010670 3300049589 Bacteria 6726
368 Ga0501074_0177549 3300049590 Bacteria 1519
369 Ga0501219_000105 3300049703 Bacteria 14692
370 Ga0501080_0048501 3300049742 Bacteria 3952
371 Ga0501083_0005031 3300049744 Bacteria 9362
372 Ga0501241_012272 3300049758 Bacteria 1557
373 Ga0501035_0038124 3300049822 Bacteria 4352
374 Ga0501044_0008589 3300049823 Bacteria 11188
375 Ga0501044_0165307 3300049823 Bacteria 2187
376 Ga0501045_0452342 3300049824 Bacteria 955
377 Ga0501284_00008 3300050005 Bacteria 143517
378 nmdc:mga0k408_252049_c1 3300050493 Bacteria 1054
379 nmdc:mga07m45_622007_c1 3300050496 Unclassified 623
380 nmdc:mga05p37_51196_c1 3300050507 Bacteria 5079
381 nmdc:mga09592_195948_c1 3300050508 Bacteria 1749
382 nmdc:mga0qj67_724847_c1 3300050509 Bacteria 790
383 nmdc:mga06r32_151219_c1 3300050510 Bacteria 2300
384 nmdc:mga08y16_686746_c1 3300050511 Bacteria 1025
385 nmdc:mga08y16_815210_c1 3300050511 Unclassified 925
386 Ga0500641_0014843 3300053096 Bacteria 2880
387 Ga0500628_017820 3300053129 Bacteria 1392
388 Ga0500568_0001078 3300053139 Bacteria 18433
389 Ga0500588_0048873 3300053146 Bacteria 1310
390 Ga0500604_0009199 3300053151 Bacteria 2631
391 Ga0500645_018502 3300053730 Bacteria 2176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10121209 rootL2_101212091 135
2 3300005328 Ga0070676_11027419 Ga0070676_110274191 135
3 3300005331 Ga0070670_100791309 Ga0070670_1007913092 135
4 3300005334 Ga0068869_100032320 Ga0068869_1000323205 135
5 3300005347 Ga0070668_100406164 Ga0070668_1004061641 135
6 3300005353 Ga0070669_101176022 Ga0070669_1011760222 135
7 3300005459 Ga0068867_100059460 Ga0068867_1000594604 135
8 3300005545 Ga0070695_100469127 Ga0070695_1004691272 135
9 3300005718 Ga0068866_10059633 Ga0068866_100596333 135
10 3300006881 Ga0068865_100129747 Ga0068865_1001297472 135
11 3300009148 Ga0105243_11400240 Ga0105243_114002401 135
12 3300009174 Ga0105241_10149497 Ga0105241_101494973 135
13 3300009176 Ga0105242_12230630 Ga0105242_122306301 135
14 3300009553 Ga0105249_10882184 Ga0105249_108821841 135
15 3300013297 Ga0157378_10339329 Ga0157378_103393292 135
16 3300013307 Ga0157372_10189143 Ga0157372_101891432 135
17 3300025899 Ga0207642_10184163 Ga0207642_101841633 135
18 3300025907 Ga0207645_10099476 Ga0207645_100994762 135
19 3300025911 Ga0207654_10196187 Ga0207654_101961872 135
20 3300025913 Ga0207695_10435017 Ga0207695_104350172 135
21 3300025926 Ga0207659_11277187 Ga0207659_112771871 135
22 3300025931 Ga0207644_10223715 Ga0207644_102237153 135
23 3300025972 Ga0207668_10151329 Ga0207668_101513291 135
24 3300026023 Ga0207677_10195386 Ga0207677_101953863 135
25 3300026035 Ga0207703_10880929 Ga0207703_108809291 135
26 3300026075 Ga0207708_11232684 Ga0207708_112326841 135
27 3300026089 Ga0207648_10012535 Ga0207648_100125356 135
28 3300028380 Ga0268265_10216734 Ga0268265_102167343 135
29 3300028794 Ga0307515_10000036 Ga0307515_10000036164 135
30 3300050493 nmdc:mga0k408_252049_c1 nmdc:mga0k408_252049_c1_391_804 135
31 3300003323 rootH1_10267672 rootH1_102676723 136
32 3300005327 Ga0070658_10448498 Ga0070658_104484982 136
33 3300005331 Ga0070670_100155216 Ga0070670_1001552162 136
34 3300005331 Ga0070670_100274846 Ga0070670_1002748462 136
35 3300005331 Ga0070670_100837222 Ga0070670_1008372221 136
36 3300005331 Ga0070670_100932174 Ga0070670_1009321742 136
37 3300005334 Ga0068869_100029417 Ga0068869_1000294175 136
38 3300005334 Ga0068869_101478483 Ga0068869_1014784831 136
39 3300005336 Ga0070680_100001161 Ga0070680_10000116111 136
40 3300005336 Ga0070680_101181699 Ga0070680_1011816991 136
41 3300005338 Ga0068868_100904639 Ga0068868_1009046392 136
42 3300005339 Ga0070660_100093540 Ga0070660_1000935404 136
43 3300005339 Ga0070660_100115666 Ga0070660_1001156662 136
44 3300005341 Ga0070691_10641720 Ga0070691_106417201 136
45 3300005353 Ga0070669_100184178 Ga0070669_1001841783 136
46 3300005353 Ga0070669_100559380 Ga0070669_1005593801 136
47 3300005354 Ga0070675_100116537 Ga0070675_1001165373 136
48 3300005356 Ga0070674_100217318 Ga0070674_1002173182 136
49 3300005364 Ga0070673_100333219 Ga0070673_1003332192 136
50 3300005366 Ga0070659_100024838 Ga0070659_1000248385 136
51 3300005366 Ga0070659_100147402 Ga0070659_1001474022 136
52 3300005367 Ga0070667_100293329 Ga0070667_1002933293 136
53 3300005438 Ga0070701_10591447 Ga0070701_105914471 136
54 3300005455 Ga0070663_100713652 Ga0070663_1007136522 136
55 3300005466 Ga0070685_10559244 Ga0070685_105592441 136
56 3300005530 Ga0070679_100249333 Ga0070679_1002493333 136
57 3300005539 Ga0068853_100127583 Ga0068853_1001275833 136
58 3300005539 Ga0068853_100527868 Ga0068853_1005278682 136
59 3300005539 Ga0068853_101075864 Ga0068853_1010758642 136
60 3300005547 Ga0070693_100459843 Ga0070693_1004598432 136
61 3300005563 Ga0068855_100004384 Ga0068855_1000043847 136
62 3300005563 Ga0068855_100017986 Ga0068855_1000179868 136
63 3300005577 Ga0068857_100606757 Ga0068857_1006067572 136
64 3300005578 Ga0068854_100308481 Ga0068854_1003084812 136
65 3300005578 Ga0068854_101451915 Ga0068854_1014519151 136
66 3300005614 Ga0068856_100028048 Ga0068856_1000280482 136
67 3300005615 Ga0070702_100227475 Ga0070702_1002274752 136
68 3300005616 Ga0068852_100205110 Ga0068852_1002051103 136
69 3300005617 Ga0068859_100004125 Ga0068859_10000412510 136
70 3300005617 Ga0068859_100094140 Ga0068859_1000941403 136
71 3300005617 Ga0068859_100617976 Ga0068859_1006179762 136
72 3300005618 Ga0068864_100209782 Ga0068864_1002097823 136
73 3300005719 Ga0068861_100772474 Ga0068861_1007724742 136
74 3300005719 Ga0068861_100908939 Ga0068861_1009089392 136
75 3300005841 Ga0068863_100408859 Ga0068863_1004088592 136
76 3300005843 Ga0068860_100014161 Ga0068860_1000141618 136
77 3300005843 Ga0068860_100062175 Ga0068860_1000621753 136
78 3300005844 Ga0068862_100012084 Ga0068862_1000120844 136
79 3300005844 Ga0068862_101378265 Ga0068862_1013782651 136
80 3300006237 Ga0097621_100308991 Ga0097621_1003089912 136
81 3300006881 Ga0068865_100917889 Ga0068865_1009178891 136
82 3300006931 Ga0097620_100004125 Ga0097620_10000412510 136
83 3300006931 Ga0097620_100094139 Ga0097620_1000941393 136
84 3300006931 Ga0097620_100618060 Ga0097620_1006180602 136
85 3300009094 Ga0111539_10003344 Ga0111539_100033447 136
86 3300009094 Ga0111539_10585795 Ga0111539_105857952 136
87 3300009101 Ga0105247_10000597 Ga0105247_1000059711 136
88 3300009553 Ga0105249_10000406 Ga0105249_1000040610 136
89 3300009553 Ga0105249_10429093 Ga0105249_104290932 136
90 3300013100 Ga0157373_10000871 Ga0157373_1000087126 136
91 3300013102 Ga0157371_10001281 Ga0157371_1000128111 136
92 3300013102 Ga0157371_10004640 Ga0157371_100046402 136
93 3300013102 Ga0157371_10007255 Ga0157371_100072557 136
94 3300013102 Ga0157371_10029027 Ga0157371_100290275 136
95 3300013102 Ga0157371_10038966 Ga0157371_100389664 136
96 3300013104 Ga0157370_10004123 Ga0157370_1000412312 136
97 3300013104 Ga0157370_10048893 Ga0157370_100488933 136
98 3300013104 Ga0157370_10140521 Ga0157370_101405212 136
99 3300013105 Ga0157369_10016808 Ga0157369_100168084 136
100 3300013105 Ga0157369_10104568 Ga0157369_101045683 136
101 3300013105 Ga0157369_10324259 Ga0157369_103242593 136
102 3300013105 Ga0157369_10365523 Ga0157369_103655231 136
103 3300013297 Ga0157378_11011054 Ga0157378_110110541 136
104 3300013297 Ga0157378_13048836 Ga0157378_130488361 136
105 3300013306 Ga0163162_10154555 Ga0163162_101545553 136
106 3300013307 Ga0157372_10003325 Ga0157372_100033257 136
107 3300013307 Ga0157372_10318825 Ga0157372_103188253 136
108 3300013307 Ga0157372_11112463 Ga0157372_111124632 136
109 3300014325 Ga0163163_10075156 Ga0163163_100751565 136
110 3300014326 Ga0157380_13001134 Ga0157380_130011341 136
111 3300014745 Ga0157377_10319397 Ga0157377_103193972 136
112 3300021384 Ga0213876_10326532 Ga0213876_103265322 136
113 3300021384 Ga0213876_10545581 Ga0213876_105455811 136
114 3300025900 Ga0207710_10000352 Ga0207710_1000035225 136
115 3300025908 Ga0207643_10384916 Ga0207643_103849161 136
116 3300025909 Ga0207705_10013020 Ga0207705_100130207 136
117 3300025909 Ga0207705_10047900 Ga0207705_100479002 136
118 3300025909 Ga0207705_10073876 Ga0207705_100738762 136
119 3300025911 Ga0207654_10434699 Ga0207654_104346992 136
120 3300025914 Ga0207671_10871865 Ga0207671_108718651 136
121 3300025917 Ga0207660_10004204 Ga0207660_100042047 136
122 3300025919 Ga0207657_10292507 Ga0207657_102925072 136
123 3300025919 Ga0207657_10535039 Ga0207657_105350392 136
124 3300025923 Ga0207681_10233099 Ga0207681_102330993 136
125 3300025925 Ga0207650_10047013 Ga0207650_100470135 136
126 3300025925 Ga0207650_10825460 Ga0207650_108254602 136
127 3300025925 Ga0207650_11047454 Ga0207650_110474542 136
128 3300025925 Ga0207650_11190704 Ga0207650_111907042 136
129 3300025926 Ga0207659_10178151 Ga0207659_101781512 136
130 3300025932 Ga0207690_10071336 Ga0207690_100713363 136
131 3300025932 Ga0207690_10329297 Ga0207690_103292971 136
132 3300025934 Ga0207686_10046633 Ga0207686_100466333 136
133 3300025942 Ga0207689_10092180 Ga0207689_100921803 136
134 3300025942 Ga0207689_11145914 Ga0207689_111459142 136
135 3300025944 Ga0207661_10118933 Ga0207661_101189334 136
136 3300025944 Ga0207661_10343186 Ga0207661_103431863 136
137 3300025949 Ga0207667_10000539 Ga0207667_1000053912 136
138 3300025949 Ga0207667_10037172 Ga0207667_100371725 136
139 3300025961 Ga0207712_10011571 Ga0207712_100115717 136
140 3300025972 Ga0207668_11514962 Ga0207668_115149621 136
141 3300025981 Ga0207640_10052116 Ga0207640_100521162 136
142 3300025981 Ga0207640_11431567 Ga0207640_114315671 136
143 3300025986 Ga0207658_10230522 Ga0207658_102305223 136
144 3300026041 Ga0207639_10019442 Ga0207639_100194426 136
145 3300026041 Ga0207639_10871245 Ga0207639_108712452 136
146 3300026041 Ga0207639_10874106 Ga0207639_108741062 136
147 3300026041 Ga0207639_10978941 Ga0207639_109789412 136
148 3300026067 Ga0207678_10373837 Ga0207678_103738372 136
149 3300026078 Ga0207702_11306556 Ga0207702_113065562 136
150 3300026088 Ga0207641_10021463 Ga0207641_100214636 136
151 3300026095 Ga0207676_10281504 Ga0207676_102815042 136
152 3300026095 Ga0207676_10997893 Ga0207676_109978931 136
153 3300026116 Ga0207674_10086254 Ga0207674_100862542 136
154 3300026142 Ga0207698_10285537 Ga0207698_102855372 136
155 3300028379 Ga0268266_10946127 Ga0268266_109461271 136
156 3300028380 Ga0268265_10448404 Ga0268265_104484042 136
157 3300028380 Ga0268265_11422499 Ga0268265_114224992 136
158 3300028381 Ga0268264_10021029 Ga0268264_100210294 136
159 3300028381 Ga0268264_10040412 Ga0268264_100404123 136
160 3300031911 Ga0307412_11388515 Ga0307412_113885151 136
161 3300031911 Ga0307412_11462294 Ga0307412_114622942 136
162 3300032004 Ga0307414_10612586 Ga0307414_106125862 136
163 3300032004 Ga0307414_11299821 Ga0307414_112998212 136
164 3300037312 Ga0395899_0003690 Ga0395899_0003690_7662_8072 136
165 3300037312 Ga0395899_0006392 Ga0395899_0006392_554_964 136
166 3300037312 Ga0395899_0042473 Ga0395899_0042473_1376_1786 136
167 3300037312 Ga0395899_0179246 Ga0395899_0179246_60_470 136
168 3300037418 Ga0395900_0021261 Ga0395900_0021261_5658_6068 136
169 3300037418 Ga0395900_0059584 Ga0395900_0059584_1396_1806 136
170 3300037418 Ga0395900_0097680 Ga0395900_0097680_192_602 136
171 3300037418 Ga0395900_0399724 Ga0395900_0399724_189_599 136
172 3300037418 Ga0395900_0413158 Ga0395900_0413158_670_1080 136
173 3300037466 Ga0395898_0030436 Ga0395898_0030436_4179_4589 136
174 3300037466 Ga0395898_0032767 Ga0395898_0032767_3852_4262 136
175 3300037466 Ga0395898_0092311 Ga0395898_0092311_235_645 136
176 3300037466 Ga0395898_0261301 Ga0395898_0261301_320_730 136
177 3300037466 Ga0395898_1923066 Ga0395898_1923066_70_480 136
178 3300037471 Ga0395905_0098876 Ga0395905_0098876_2195_2605 136
179 3300038443 Ga0395901_0010634 Ga0395901_0010634_1640_2050 136
180 3300038443 Ga0395901_0020749 Ga0395901_0020749_678_1088 136
181 3300038443 Ga0395901_0042115 Ga0395901_0042115_3987_4397 136
182 3300038443 Ga0395901_0072115 Ga0395901_0072115_210_620 136
183 3300038443 Ga0395901_0328637 Ga0395901_0328637_719_1129 136
184 3300039437 Ga0436365_0746598 Ga0436365_0746598_257_667 136
185 3300039437 Ga0436365_1718473 Ga0436365_1718473_106_516 136
186 3300041404 Ga0439436_0115383 Ga0439436_0115383_261_671 136
187 3300041413 Ga0439465_0009961 Ga0439465_0009961_1684_2094 136
188 3300042004 Ga0439445_0020543 Ga0439445_0020543_1220_1630 136
189 3300042007 Ga0439449_0003148 Ga0439449_0003148_282_692 136
190 3300042435 Ga0439434_0352638 Ga0439434_0352638_59_469 136
191 3300044683 Ga0466965_0226189 Ga0466965_0226189_412_861 136
192 3300044683 Ga0466965_0514000 Ga0466965_0514000_221_631 136
193 3300044712 Ga0453684_1315737 Ga0453684_1315737_325_735 136
194 3300045051 Ga0451576_0497089 Ga0451576_0497089_218_637 136
195 3300046471 Ga0495650_0036594 Ga0495650_0036594_752_1162 136
196 3300046522 Ga0495643_0035714 Ga0495643_0035714_928_1338 136
197 3300046616 Ga0495668_0003488 Ga0495668_0003488_5037_5453 136
198 3300047472 Ga0495686_0047203 Ga0495686_0047203_1427_1837 136
199 3300049569 Ga0501032_0005427 Ga0501032_0005427_1716_2126 136
200 3300049571 Ga0501034_0002458 Ga0501034_0002458_20128_20538 136
201 3300049572 Ga0501036_0041710 Ga0501036_0041710_1727_2137 136
202 3300049575 Ga0501039_0022474 Ga0501039_0022474_505_915 136
203 3300049579 Ga0501043_0017398 Ga0501043_0017398_2026_2436 136
204 3300049580 Ga0501046_0023437 Ga0501046_0023437_1114_1524 136
205 3300049581 Ga0501047_0024377 Ga0501047_0024377_2041_2451 136
206 3300049582 Ga0501048_0424227 Ga0501048_0424227_437_847 136
207 3300049586 Ga0501070_0058088 Ga0501070_0058088_1863_2273 136
208 3300049589 Ga0501073_0010670 Ga0501073_0010670_3353_3763 136
209 3300049590 Ga0501074_0177549 Ga0501074_0177549_310_720 136
210 3300049703 Ga0501219_000105 Ga0501219_000105_3739_4149 136
211 3300049742 Ga0501080_0048501 Ga0501080_0048501_2646_3056 136
212 3300049744 Ga0501083_0005031 Ga0501083_0005031_518_928 136
213 3300049758 Ga0501241_012272 Ga0501241_012272_1033_1443 136
214 3300049822 Ga0501035_0038124 Ga0501035_0038124_962_1372 136
215 3300049823 Ga0501044_0008589 Ga0501044_0008589_4788_5198 136
216 3300049823 Ga0501044_0165307 Ga0501044_0165307_1571_1981 136
217 3300049824 Ga0501045_0452342 Ga0501045_0452342_50_460 136
218 3300050005 Ga0501284_00008 Ga0501284_00008_136672_137082 136
219 3300050496 nmdc:mga07m45_622007_c1 nmdc:mga07m45_622007_c1_179_589 136
220 3300050511 nmdc:mga08y16_686746_c1 nmdc:mga08y16_686746_c1_413_991 136
221 3300050511 nmdc:mga08y16_815210_c1 nmdc:mga08y16_815210_c1_400_810 136
222 3300053129 Ga0500628_017820 Ga0500628_017820_961_1371 136
223 3300053146 Ga0500588_0048873 Ga0500588_0048873_253_669 136
224 3300053151 Ga0500604_0009199 Ga0500604_0009199_37_453 136
225 3300053730 Ga0500645_018502 Ga0500645_018502_1091_1633 136
226 3300002459 JGI24751J29686_10000772 JGI24751J29686_100007724 137
227 3300005289 Ga0065704_10174398 Ga0065704_101743982 137
228 3300005290 Ga0065712_10005324 Ga0065712_100053243 137
229 3300005290 Ga0065712_10429926 Ga0065712_104299261 137
230 3300005293 Ga0065715_10154564 Ga0065715_101545641 137
231 3300005331 Ga0070670_100008042 Ga0070670_1000080424 137
232 3300005333 Ga0070677_10070792 Ga0070677_100707922 137
233 3300005334 Ga0068869_100731840 Ga0068869_1007318401 137
234 3300005340 Ga0070689_100003233 Ga0070689_10000323312 137
235 3300005340 Ga0070689_100086757 Ga0070689_1000867574 137
236 3300005340 Ga0070689_101508984 Ga0070689_1015089841 137
237 3300005353 Ga0070669_100286317 Ga0070669_1002863172 137
238 3300005354 Ga0070675_100090260 Ga0070675_1000902603 137
239 3300005356 Ga0070674_100771562 Ga0070674_1007715621 137
240 3300005364 Ga0070673_100148021 Ga0070673_1001480213 137
241 3300005364 Ga0070673_100635765 Ga0070673_1006357652 137
242 3300005365 Ga0070688_100062258 Ga0070688_1000622582 137
243 3300005365 Ga0070688_100213391 Ga0070688_1002133913 137
244 3300005367 Ga0070667_100238895 Ga0070667_1002388952 137
245 3300005438 Ga0070701_10234373 Ga0070701_102343731 137
246 3300005466 Ga0070685_10013974 Ga0070685_100139745 137
247 3300005466 Ga0070685_10075641 Ga0070685_100756413 137
248 3300005468 Ga0070707_100721072 Ga0070707_1007210722 137
249 3300005471 Ga0070698_100004297 Ga0070698_10000429719 137
250 3300005471 Ga0070698_100064272 Ga0070698_1000642726 137
251 3300005471 Ga0070698_100933674 Ga0070698_1009336742 137
252 3300005518 Ga0070699_100219785 Ga0070699_1002197852 137
253 3300005548 Ga0070665_101474084 Ga0070665_1014740842 137
254 3300005549 Ga0070704_100109363 Ga0070704_1001093632 137
255 3300005577 Ga0068857_100053347 Ga0068857_1000533473 137
256 3300005577 Ga0068857_101647631 Ga0068857_1016476312 137
257 3300005616 Ga0068852_100336650 Ga0068852_1003366502 137
258 3300005617 Ga0068859_100137450 Ga0068859_1001374502 137
259 3300005617 Ga0068859_100584939 Ga0068859_1005849391 137
260 3300005617 Ga0068859_100724191 Ga0068859_1007241911 137
261 3300005617 Ga0068859_101046216 Ga0068859_1010462162 137
262 3300005618 Ga0068864_100079743 Ga0068864_1000797435 137
263 3300005618 Ga0068864_101744316 Ga0068864_1017443161 137
264 3300005618 Ga0068864_102027031 Ga0068864_1020270311 137
265 3300005719 Ga0068861_100041368 Ga0068861_1000413682 137
266 3300005719 Ga0068861_100097817 Ga0068861_1000978174 137
267 3300005841 Ga0068863_100075802 Ga0068863_1000758024 137
268 3300005841 Ga0068863_100427252 Ga0068863_1004272522 137
269 3300005842 Ga0068858_101417076 Ga0068858_1014170762 137
270 3300005844 Ga0068862_100135791 Ga0068862_1001357914 137
271 3300005985 Ga0081539_10075288 Ga0081539_100752883 137
272 3300006163 Ga0070715_10392793 Ga0070715_103927932 137
273 3300006358 Ga0068871_100555260 Ga0068871_1005552602 137
274 3300006844 Ga0075428_100164168 Ga0075428_1001641682 137
275 3300006846 Ga0075430_100885158 Ga0075430_1008851582 137
276 3300006881 Ga0068865_100338215 Ga0068865_1003382152 137
277 3300006931 Ga0097620_100137460 Ga0097620_1001374603 137
278 3300006931 Ga0097620_100584900 Ga0097620_1005849001 137
279 3300006931 Ga0097620_100724133 Ga0097620_1007241331 137
280 3300006931 Ga0097620_101046154 Ga0097620_1010461542 137
281 3300009176 Ga0105242_10054894 Ga0105242_100548943 137
282 3300009177 Ga0105248_11642733 Ga0105248_116427332 137
283 3300009545 Ga0105237_11551876 Ga0105237_115518762 137
284 3300009553 Ga0105249_10006136 Ga0105249_100061364 137
285 3300009553 Ga0105249_10006600 Ga0105249_100066007 137
286 3300009553 Ga0105249_10976777 Ga0105249_109767772 137
287 3300009553 Ga0105249_12180000 Ga0105249_121800001 137
288 3300013296 Ga0157374_10719871 Ga0157374_107198712 137
289 3300013306 Ga0163162_10471106 Ga0163162_104711062 137
290 3300013308 Ga0157375_10050994 Ga0157375_100509944 137
291 3300014325 Ga0163163_10190436 Ga0163163_101904363 137
292 3300014325 Ga0163163_10371082 Ga0163163_103710822 137
293 3300014968 Ga0157379_11046519 Ga0157379_110465192 137
294 3300014969 Ga0157376_10101062 Ga0157376_101010622 137
295 3300014969 Ga0157376_10367722 Ga0157376_103677223 137
296 3300017792 Ga0163161_10233103 Ga0163161_102331032 137
297 3300025315 Ga0207697_10119181 Ga0207697_101191812 137
298 3300025321 Ga0207656_10126305 Ga0207656_101263052 137
299 3300025893 Ga0207682_10168436 Ga0207682_101684362 137
300 3300025918 Ga0207662_10143816 Ga0207662_101438161 137
301 3300025918 Ga0207662_10159605 Ga0207662_101596052 137
302 3300025922 Ga0207646_10161401 Ga0207646_101614013 137
303 3300025923 Ga0207681_10371632 Ga0207681_103716322 137
304 3300025923 Ga0207681_10490263 Ga0207681_104902632 137
305 3300025923 Ga0207681_10495949 Ga0207681_104959491 137
306 3300025925 Ga0207650_10056844 Ga0207650_100568444 137
307 3300025926 Ga0207659_10089847 Ga0207659_100898472 137
308 3300025934 Ga0207686_10008317 Ga0207686_100083175 137
309 3300025936 Ga0207670_10037359 Ga0207670_100373593 137
310 3300025936 Ga0207670_10125772 Ga0207670_101257724 137
311 3300025938 Ga0207704_10068888 Ga0207704_100688883 137
312 3300025940 Ga0207691_10204589 Ga0207691_102045893 137
313 3300025942 Ga0207689_10109282 Ga0207689_101092823 137
314 3300025942 Ga0207689_10370806 Ga0207689_103708061 137
315 3300025960 Ga0207651_10165917 Ga0207651_101659172 137
316 3300025960 Ga0207651_11136221 Ga0207651_111362211 137
317 3300025961 Ga0207712_10015807 Ga0207712_100158074 137
318 3300025961 Ga0207712_10666503 Ga0207712_106665032 137
319 3300025986 Ga0207658_10266348 Ga0207658_102663483 137
320 3300026035 Ga0207703_11333240 Ga0207703_113332401 137
321 3300026041 Ga0207639_10208852 Ga0207639_102088522 137
322 3300026088 Ga0207641_10000394 Ga0207641_1000039413 137
323 3300026088 Ga0207641_10513005 Ga0207641_105130053 137
324 3300026095 Ga0207676_10035984 Ga0207676_100359844 137
325 3300026095 Ga0207676_10058028 Ga0207676_100580281 137
326 3300026116 Ga0207674_11196934 Ga0207674_111969342 137
327 3300026118 Ga0207675_100048494 Ga0207675_1000484945 137
328 3300026118 Ga0207675_100413795 Ga0207675_1004137951 137
329 3300026121 Ga0207683_10103636 Ga0207683_101036363 137
330 3300026142 Ga0207698_10468583 Ga0207698_104685831 137
331 3300028379 Ga0268266_11316025 Ga0268266_113160251 137
332 3300028380 Ga0268265_10388972 Ga0268265_103889722 137
333 3300028380 Ga0268265_11833891 Ga0268265_118338911 137
334 3300031251 Ga0265327_10025866 Ga0265327_100258664 137
335 3300031730 Ga0307516_10133562 Ga0307516_101335623 137
336 3300031852 Ga0307410_10043611 Ga0307410_100436113 137
337 3300031903 Ga0307407_10719566 Ga0307407_107195662 137
338 3300031911 Ga0307412_11752488 Ga0307412_117524881 137
339 3300031995 Ga0307409_102146085 Ga0307409_1021460851 137
340 3300032002 Ga0307416_100743429 Ga0307416_1007434293 137
341 3300041452 Ga0451793_1589203 Ga0451793_1589203_81_494 137
342 3300046475 Ga0495639_0103258 Ga0495639_0103258_474_887 137
343 3300047320 Ga0495672_0006319 Ga0495672_0006319_5685_6098 137
344 3300048907 Ga0496104_0936177 Ga0496104_0936177_141_554 137
345 3300048915 Ga0496112_0740371 Ga0496112_0740371_128_541 137
346 3300053096 Ga0500641_0014843 Ga0500641_0014843_948_1361 137
347 3300053139 Ga0500568_0001078 Ga0500568_0001078_1709_2122 137
348 3300005547 Ga0070693_100332702 Ga0070693_1003327022 138
349 3300005577 Ga0068857_102386775 Ga0068857_1023867751 138
350 3300006844 Ga0075428_100097386 Ga0075428_1000973862 138
351 3300006846 Ga0075430_100775146 Ga0075430_1007751462 138
352 3300006847 Ga0075431_100063374 Ga0075431_1000633745 138
353 3300006880 Ga0075429_100194687 Ga0075429_1001946872 138
354 3300009147 Ga0114129_10017099 Ga0114129_100170994 138
355 3300013102 Ga0157371_11396587 Ga0157371_113965872 138
356 3300013105 Ga0157369_12141232 Ga0157369_121412321 138
357 3300026067 Ga0207678_10735269 Ga0207678_107352692 138
358 3300026116 Ga0207674_12061371 Ga0207674_120613711 138
359 3300027876 Ga0209974_10135584 Ga0209974_101355842 138
360 3300041997 Ga0439431_0011958 Ga0439431_0011958_584_1000 138
361 3300050507 nmdc:mga05p37_51196_c1 nmdc:mga05p37_51196_c1_4109_4525 138
362 3300050508 nmdc:mga09592_195948_c1 nmdc:mga09592_195948_c1_978_1394 138
363 3300050509 nmdc:mga0qj67_724847_c1 nmdc:mga0qj67_724847_c1_220_636 138
364 3300050510 nmdc:mga06r32_151219_c1 nmdc:mga06r32_151219_c1_875_1291 138
365 3300001979 JGI24740J21852_10085119 JGI24740J21852_100851192 140
366 3300005329 Ga0070683_100131620 Ga0070683_1001316203 140
367 3300005335 Ga0070666_10200916 Ga0070666_102009162 140
368 3300005337 Ga0070682_100060378 Ga0070682_1000603782 140
369 3300005338 Ga0068868_100019091 Ga0068868_1000190914 140
370 3300005339 Ga0070660_100202827 Ga0070660_1002028272 140
371 3300005344 Ga0070661_100155270 Ga0070661_1001552702 140
372 3300005354 Ga0070675_100313017 Ga0070675_1003130172 140
373 3300005455 Ga0070663_100571723 Ga0070663_1005717231 140
374 3300005457 Ga0070662_100019726 Ga0070662_1000197265 140
375 3300005458 Ga0070681_10148817 Ga0070681_101488172 140
376 3300005530 Ga0070679_100022880 Ga0070679_1000228802 140
377 3300005535 Ga0070684_100020996 Ga0070684_1000209965 140
378 3300005539 Ga0068853_100014917 Ga0068853_1000149175 140
379 3300005547 Ga0070693_100355200 Ga0070693_1003552002 140
380 3300005563 Ga0068855_100308442 Ga0068855_1003084422 140
381 3300005564 Ga0070664_100010365 Ga0070664_1000103654 140
382 3300005577 Ga0068857_100565443 Ga0068857_1005654431 140
383 3300005614 Ga0068856_100099393 Ga0068856_1000993932 140
384 3300006237 Ga0097621_100174727 Ga0097621_1001747272 140
385 3300006358 Ga0068871_100096614 Ga0068871_1000966142 140
386 3300009174 Ga0105241_10848250 Ga0105241_108482502 140
387 3300013102 Ga0157371_10355927 Ga0157371_103559272 140
388 3300013297 Ga0157378_10189175 Ga0157378_101891753 140
389 3300013307 Ga0157372_10834533 Ga0157372_108345332 140
390 3300014968 Ga0157379_10351333 Ga0157379_103513332 140
391 3300049571 Ga0501034_0000693 Ga0501034_0000693_42630_43061 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

23

156

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.955 2 136
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.9519 2 136
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.9329 2 134
2g64-assembly1.cif.gz_A structure of caenorhabditis elegans 6-pyruvoyl tetrahydropterin synthase 0.9273 2 135
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.9218 2 136
ID Description Score Start End Superfamily
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9549 2 136 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9274 1 135 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9273 2 135 3.30.479.10
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.921 2 136 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9195 1 135 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A4Q5QX76-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9917 41 136 GO:0046872
GO:0070497
AF-A0A1I5SAZ0-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9826 2 136 GO:0046872
GO:0070497
AF-A0A7Y5BAF7-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9807 1 135 GO:0008616
GO:0016829
GO:0046872
AF-A0A1G0SL75-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9781 1 137 GO:0008616
GO:0046872
GO:0070497
AF-A0A7W1SIT2-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9775 2 135 GO:0008616
GO:0016829
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.15 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map