F431977

General Info

Members Datasets Scaffolds Average Seq Length
391 214 371 427

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100130262|Ga0068863_1001302622
Length 454
Sequence MNNDQRTTGLRTTNYELSYLCRPMTYQQTLDYLFTKLPMYSRIGAAAFKADLTNTIALCEALGNPQKKIKSIHVAGTNGKGSTSHMLASILQTAGYKTGLYTSPHLKDFRERIRVNGDMIAESFVVDFVERIKPLVLSLEPSFFEITVAMAFDYFVQEQVDIAVIEVGLGGRLDSTNIITPELSVITNIGWDHMNMLGNTIEAIASEKAGIIKPGVPVVIGEVIPATKTVFTEKALKENAALSIATDQLFVSAWEELAHSLQVTVVNKKNDEHTVYELDLQGIYQIKNILTVLESVKIMQQQGWKISQSAIKKGLQHTKKQTGLHGRWDIIQREPLLVLDVGHNEDGVKQIAEQIEITDHENLHIVIGLVKDKEVDKVLSLLPKQATYYFTKAQIPRALPEDQLAAKGYTAGLSGHYYADVNTALKAALVNAKKKDLILVCGSVFVVGEVMYSA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
3 2600255229 Lactobacillus acidophilus A 16 Isolate Rhizosphere
4 2643221735 Bacillus sp. Root920 Isolate Unclassified
5 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
6 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
7 2738541278 Niastella sp. CF465 Isolate Unclassified
8 2738543017 Bacillus sp. OV186 Isolate Unclassified
9 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
10 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
11 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
12 2811994870 Bacillus sp. JB4 Isolate Unclassified
13 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
14 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
15 2857586860 Bacillus sp. R-71935 Isolate Unclassified
16 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
17 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
18 2919726948 Bacillus pumilus 4489 Isolate Unclassified
19 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
20 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
21 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
27 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
165 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
194 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
195 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
196 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
197 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
198 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
199 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
200 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
201 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
202 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
212 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.63
Metatranscriptomes 0.26
Isolates 5.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.09
Nodule 0
Rhizoplane 1.02
Rhizosphere 89.51
Stem 0
Stem Tuber 0
Unclassified 5.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3344168 2162886007 Bacteria 4566
2 JGI25151J46595_10000060 3300003187 Bacteria 146867
3 JGI25151J46595_10001917 3300003187 Bacteria 13191
4 JGI25151J46595_10009644 3300003187 Bacteria 4554
5 JGI25151J46595_10009711 3300003187 Bacteria 4533
6 rootH2_10039737 3300003320 Bacteria 27034
7 rootL2_10295692 3300003322 Bacteria 1770
8 rootH1_10060141 3300003323 Bacteria 11490
9 Ga0006562J51391_1005834 3300003578 Bacteria 10082
10 Ga0055532_1000078 3300003758 Bacteria 121493
11 Ga0065704_10076563 3300005289 Bacteria 5077
12 Ga0070658_10000095 3300005327 Bacteria 77839
13 Ga0070658_10035016 3300005327 Bacteria 4042
14 Ga0070658_10037804 3300005327 Unclassified 3892
15 Ga0070658_10038171 3300005327 Bacteria 3874
16 Ga0070676_10000252 3300005328 Bacteria 23270
17 Ga0070676_10008980 3300005328 Bacteria 5407
18 Ga0070683_100013648 3300005329 Bacteria 7092
19 Ga0070683_100180289 3300005329 Bacteria 2005
20 Ga0070690_100003099 3300005330 Bacteria 9044
21 Ga0070670_100074680 3300005331 Unclassified 2913
22 Ga0070670_100084902 3300005331 Bacteria 2720
23 Ga0068869_100011787 3300005334 Bacteria 5749
24 Ga0068869_100016214 3300005334 Bacteria 5017
25 Ga0068869_100045369 3300005334 Bacteria 3164
26 Ga0068869_100112106 3300005334 Bacteria 2076
27 Ga0070666_10000192 3300005335 Bacteria 41657
28 Ga0070666_10000271 3300005335 Bacteria 34684
29 Ga0070666_10125055 3300005335 Bacteria 1785
30 Ga0070680_100088167 3300005336 Bacteria 2566
31 Ga0068868_100000091 3300005338 Bacteria 55405
32 Ga0068868_100020590 3300005338 Bacteria 4959
33 Ga0070660_100016737 3300005339 Bacteria 5331
34 Ga0070660_100114801 3300005339 Bacteria 2146
35 Ga0070661_100119348 3300005344 Unclassified 1974
36 Ga0070668_100000043 3300005347 Bacteria 78564
37 Ga0070668_100026920 3300005347 Bacteria 4365
38 Ga0070669_100133122 3300005353 Bacteria 1910
39 Ga0070669_100150429 3300005353 Unclassified 1802
40 Ga0070671_100113601 3300005355 Bacteria 2276
41 Ga0070671_100207991 3300005355 Bacteria 1659
42 Ga0070671_100227232 3300005355 Bacteria 1583
43 Ga0070673_100006626 3300005364 Bacteria 7544
44 Ga0070673_100043860 3300005364 Unclassified 3459
45 Ga0070659_100002579 3300005366 Bacteria 12876
46 Ga0070667_100000086 3300005367 Bacteria 114861
47 Ga0070667_100001632 3300005367 Bacteria 20064
48 Ga0070678_100033486 3300005456 Bacteria 3568
49 Ga0070662_100004021 3300005457 Bacteria 9226
50 Ga0070681_10106725 3300005458 Unclassified 2742
51 Ga0070681_10112024 3300005458 Bacteria 2668
52 Ga0070681_10123007 3300005458 Bacteria 2527
53 Ga0068867_100006741 3300005459 Bacteria 8120
54 Ga0068867_100110356 3300005459 Bacteria 2113
55 Ga0070685_10090158 3300005466 Bacteria 1854
56 Ga0070698_100004171 3300005471 Bacteria 15883
57 Ga0070679_100003446 3300005530 Bacteria 14482
58 Ga0070679_100005217 3300005530 Bacteria 12025
59 Ga0070679_100066411 3300005530 Unclassified 3595
60 Ga0070679_100069271 3300005530 Bacteria 3519
61 Ga0070684_100268848 3300005535 Unclassified 1560
62 Ga0068853_100006204 3300005539 Bacteria 9466
63 Ga0068853_100029690 3300005539 Bacteria 4612
64 Ga0068853_100038692 3300005539 Bacteria 4064
65 Ga0068853_100260243 3300005539 Bacteria 1595
66 Ga0070672_100000160 3300005543 Bacteria 37362
67 Ga0070665_100000350 3300005548 Bacteria 69455
68 Ga0070665_100026916 3300005548 Bacteria 5792
69 Ga0068855_100001013 3300005563 Bacteria 35012
70 Ga0068855_100002499 3300005563 Bacteria 22644
71 Ga0068855_100020814 3300005563 Bacteria 7865
72 Ga0068855_100037568 3300005563 Bacteria 5758
73 Ga0068855_100123974 3300005563 Bacteria 2955
74 Ga0070664_100093393 3300005564 Bacteria 2607
75 Ga0068854_100027595 3300005578 Bacteria 3915
76 Ga0068856_100014298 3300005614 Bacteria 7675
77 Ga0068852_100027368 3300005616 Bacteria 4647
78 Ga0068852_100111170 3300005616 Bacteria 2491
79 Ga0068859_100000041 3300005617 Bacteria 162415
80 Ga0068859_100032819 3300005617 Bacteria 5216
81 Ga0068864_100006586 3300005618 Bacteria 9508
82 Ga0068864_100059644 3300005618 Bacteria 3301
83 Ga0068864_100130466 3300005618 Bacteria 2257
84 Ga0068866_10066176 3300005718 Bacteria 1893
85 Ga0068861_100025193 3300005719 Bacteria 4312
86 Ga0068861_100168611 3300005719 Bacteria 1812
87 Ga0068851_10000487 3300005834 Bacteria 17401
88 Ga0068851_10018031 3300005834 Bacteria 3398
89 Ga0068870_10020460 3300005840 Bacteria 3224
90 Ga0068863_100002653 3300005841 Bacteria 17694
91 Ga0068863_100079247 3300005841 Bacteria 3111
92 Ga0068863_100130262 3300005841 Bacteria 2401
93 Ga0068858_100000662 3300005842 Bacteria 35985
94 Ga0068858_100031654 3300005842 Bacteria 4914
95 Ga0068860_100003210 3300005843 Bacteria 16864
96 Ga0068860_100007493 3300005843 Bacteria 10915
97 Ga0068860_100020750 3300005843 Bacteria 6364
98 Ga0068860_100036681 3300005843 Bacteria 4695
99 Ga0068860_100125713 3300005843 Bacteria 2458
100 Ga0068862_100015517 3300005844 Bacteria 6326
101 Ga0075366_10093626 3300006195 Bacteria 1800
102 Ga0097621_100000390 3300006237 Bacteria 30528
103 Ga0097621_100000695 3300006237 Bacteria 23615
104 Ga0097621_100047871 3300006237 Bacteria 3466
105 Ga0097621_100193593 3300006237 Bacteria 1762
106 Ga0068871_100000091 3300006358 Bacteria 52582
107 Ga0068871_100002236 3300006358 Bacteria 13149
108 Ga0068871_100080691 3300006358 Bacteria 2694
109 Ga0068871_100101930 3300006358 Bacteria 2406
110 Ga0075428_100110826 3300006844 Bacteria 2990
111 Ga0075431_100005955 3300006847 Bacteria 12071
112 Ga0068865_100000552 3300006881 Bacteria 20801
113 Ga0097620_100000041 3300006931 Bacteria 162415
114 Ga0097620_100032819 3300006931 Bacteria 5216
115 Ga0105240_10000358 3300009093 Bacteria 85909
116 Ga0105240_10020499 3300009093 Bacteria 8814
117 Ga0111539_10005606 3300009094 Bacteria 16233
118 Ga0105247_10004128 3300009101 Bacteria 9322
119 Ga0114129_10003278 3300009147 Bacteria 22719
120 Ga0114129_10093714 3300009147 Bacteria 4160
121 Ga0105243_10206624 3300009148 Unclassified 1726
122 Ga0105241_10001122 3300009174 Bacteria 20412
123 Ga0105241_10007105 3300009174 Bacteria 8245
124 Ga0105242_10149076 3300009176 Bacteria 2038
125 Ga0105248_10036462 3300009177 Bacteria 5499
126 Ga0105237_10000169 3300009545 Bacteria 92124
127 Ga0105237_10004610 3300009545 Bacteria 15889
128 Ga0105237_10022929 3300009545 Bacteria 6402
129 Ga0105237_10036664 3300009545 Bacteria 4962
130 Ga0105249_10004235 3300009553 Bacteria 12404
131 Ga0105249_10015628 3300009553 Bacteria 6720
132 Ga0105249_10092754 3300009553 Bacteria 2828
133 Ga0105239_10113086 3300010375 Unclassified 3010
134 Ga0105246_10040342 3300011119 Bacteria 3150
135 Ga0157373_10002046 3300013100 Bacteria 15279
136 Ga0157373_10007142 3300013100 Bacteria 8328
137 Ga0157373_10016733 3300013100 Bacteria 5345
138 Ga0157373_10151293 3300013100 Bacteria 1632
139 Ga0157371_10001101 3300013102 Bacteria 29303
140 Ga0157371_10001198 3300013102 Bacteria 27781
141 Ga0157371_10002260 3300013102 Bacteria 18589
142 Ga0157371_10002284 3300013102 Bacteria 18472
143 Ga0157371_10010357 3300013102 Bacteria 7272
144 Ga0157371_10020291 3300013102 Bacteria 4891
145 Ga0157371_10028802 3300013102 Bacteria 4020
146 Ga0157371_10037567 3300013102 Bacteria 3465
147 Ga0157371_10098546 3300013102 Unclassified 2073
148 Ga0157371_10114972 3300013102 Bacteria 1911
149 Ga0157370_10000257 3300013104 Bacteria 67219
150 Ga0157370_10001136 3300013104 Bacteria 33269
151 Ga0157370_10009435 3300013104 Bacteria 10427
152 Ga0157370_10067642 3300013104 Bacteria 3376
153 Ga0157370_10129748 3300013104 Bacteria 2352
154 Ga0157369_10021269 3300013105 Bacteria 7255
155 Ga0157369_10208610 3300013105 Unclassified 2048
156 Ga0157374_10000084 3300013296 Bacteria 94138
157 Ga0157374_10360886 3300013296 Bacteria 1445
158 Ga0157378_10016309 3300013297 Bacteria 6507
159 Ga0157378_10019655 3300013297 Bacteria 5938
160 Ga0157378_10022685 3300013297 Bacteria 5524
161 Ga0157378_10032015 3300013297 Bacteria 4645
162 Ga0157378_10093448 3300013297 Bacteria 2738
163 Ga0163162_10000113 3300013306 Bacteria 71491
164 Ga0163162_10000546 3300013306 Bacteria 34761
165 Ga0163162_10000798 3300013306 Bacteria 29316
166 Ga0163162_10003909 3300013306 Bacteria 14314
167 Ga0163162_10064868 3300013306 Bacteria 3698
168 Ga0163162_10384036 3300013306 Bacteria 1538
169 Ga0157372_10018551 3300013307 Bacteria 7483
170 Ga0157372_10032123 3300013307 Bacteria 5753
171 Ga0157372_10032147 3300013307 Bacteria 5751
172 Ga0157372_10066887 3300013307 Bacteria 4038
173 Ga0157372_10137139 3300013307 Bacteria 2818
174 Ga0157372_10171876 3300013307 Bacteria 2507
175 Ga0157372_10199806 3300013307 Bacteria 2316
176 Ga0157375_10000118 3300013308 Bacteria 77255
177 Ga0157375_10006522 3300013308 Bacteria 10156
178 Ga0157375_10025925 3300013308 Bacteria 5455
179 Ga0157375_10028532 3300013308 Bacteria 5233
180 Ga0157375_10258765 3300013308 Bacteria 1902
181 Ga0163163_10000306 3300014325 Bacteria 48215
182 Ga0163163_10000694 3300014325 Bacteria 28641
183 Ga0157377_10017611 3300014745 Bacteria 3697
184 Ga0157379_10000245 3300014968 Bacteria 42570
185 Ga0157379_10011641 3300014968 Bacteria 7681
186 Ga0157379_10043915 3300014968 Bacteria 3991
187 Ga0157379_10051103 3300014968 Bacteria 3692
188 Ga0157376_10000276 3300014969 Bacteria 35001
189 Ga0157376_10003519 3300014969 Bacteria 10800
190 Ga0157376_10136065 3300014969 Bacteria 2199
191 Ga0157376_10190635 3300014969 Bacteria 1880
192 Ga0182006_1009306 3300015261 Bacteria 4408
193 Ga0163161_10002287 3300017792 Bacteria 13739
194 Ga0163161_10003110 3300017792 Bacteria 11703
195 Ga0163161_10059700 3300017792 Bacteria 2774
196 Ga0163161_10226231 3300017792 Bacteria 1450
197 Ga0213876_10003390 3300021384 Bacteria 9121
198 Ga0209147_100114 3300025229 Bacteria 144205
199 Ga0209676_1004439 3300025292 Bacteria 7826
200 Ga0209025_1000001 3300025294 Bacteria 1888151
201 Ga0209025_1000219 3300025294 Bacteria 137235
202 Ga0209025_1003637 3300025294 Bacteria 14318
203 Ga0209025_1003799 3300025294 Bacteria 13806
204 Ga0207656_10003536 3300025321 Bacteria 5380
205 Ga0207710_10012875 3300025900 Unclassified 3523
206 Ga0207710_10026380 3300025900 Bacteria 2510
207 Ga0207688_10042941 3300025901 Bacteria 2517
208 Ga0207688_10053537 3300025901 Bacteria 2263
209 Ga0207680_10000029 3300025903 Bacteria 78814
210 Ga0207680_10023505 3300025903 Unclassified 3368
211 Ga0207645_10002237 3300025907 Bacteria 15407
212 Ga0207705_10003864 3300025909 Bacteria 11391
213 Ga0207705_10059119 3300025909 Bacteria 2766
214 Ga0207705_10197773 3300025909 Unclassified 1522
215 Ga0207705_10214839 3300025909 Bacteria 1459
216 Ga0207707_10111702 3300025912 Bacteria 2389
217 Ga0207695_10000073 3300025913 Bacteria 312565
218 Ga0207695_10015953 3300025913 Bacteria 8820
219 Ga0207671_10001921 3300025914 Bacteria 23070
220 Ga0207671_10033022 3300025914 Bacteria 3852
221 Ga0207671_10043455 3300025914 Bacteria 3323
222 Ga0207660_10174198 3300025917 Unclassified 1667
223 Ga0207662_10004441 3300025918 Bacteria 7377
224 Ga0207657_10022365 3300025919 Bacteria 5918
225 Ga0207657_10093211 3300025919 Bacteria 2509
226 Ga0207652_10000159 3300025921 Bacteria 73101
227 Ga0207652_10000367 3300025921 Bacteria 46853
228 Ga0207652_10018991 3300025921 Bacteria 5645
229 Ga0207652_10044219 3300025921 Bacteria 3794
230 Ga0207652_10088827 3300025921 Unclassified 2712
231 Ga0207650_10064426 3300025925 Bacteria 2743
232 Ga0207650_10244994 3300025925 Bacteria 1449
233 Ga0207659_10108345 3300025926 Bacteria 2107
234 Ga0207690_10050830 3300025932 Bacteria 2769
235 Ga0207706_10008752 3300025933 Bacteria 9316
236 Ga0207704_10032930 3300025938 Bacteria 2941
237 Ga0207691_10001704 3300025940 Bacteria 21708
238 Ga0207691_10009845 3300025940 Bacteria 9173
239 Ga0207691_10012122 3300025940 Bacteria 8264
240 Ga0207691_10031008 3300025940 Bacteria 4993
241 Ga0207711_10044317 3300025941 Bacteria 3797
242 Ga0207689_10002539 3300025942 Bacteria 16945
243 Ga0207689_10004419 3300025942 Bacteria 12759
244 Ga0207689_10081926 3300025942 Bacteria 2653
245 Ga0207689_10181189 3300025942 Bacteria 1737
246 Ga0207661_10009701 3300025944 Bacteria 6912
247 Ga0207679_10046073 3300025945 Bacteria 3159
248 Ga0207667_10000863 3300025949 Bacteria 39055
249 Ga0207667_10016804 3300025949 Bacteria 8255
250 Ga0207667_10036567 3300025949 Bacteria 5261
251 Ga0207667_10040333 3300025949 Bacteria 4972
252 Ga0207667_10062464 3300025949 Bacteria 3894
253 Ga0207651_10007629 3300025960 Bacteria 5775
254 Ga0207712_10059625 3300025961 Unclassified 2702
255 Ga0207668_10000520 3300025972 Bacteria 24120
256 Ga0207668_10177426 3300025972 Bacteria 1677
257 Ga0207640_10141687 3300025981 Unclassified 1753
258 Ga0207640_10146531 3300025981 Bacteria 1728
259 Ga0207658_10000559 3300025986 Bacteria 33814
260 Ga0207658_10024983 3300025986 Bacteria 4181
261 Ga0207658_10046282 3300025986 Bacteria 3176
262 Ga0207658_10051604 3300025986 Bacteria 3032
263 Ga0207677_10002274 3300026023 Bacteria 10090
264 Ga0207703_10005041 3300026035 Bacteria 10702
265 Ga0207703_10006086 3300026035 Bacteria 9648
266 Ga0207639_10022682 3300026041 Bacteria 4524
267 Ga0207639_10040555 3300026041 Bacteria 3476
268 Ga0207678_10022450 3300026067 Bacteria 5526
269 Ga0207702_10148723 3300026078 Bacteria 2128
270 Ga0207641_10000044 3300026088 Bacteria 183824
271 Ga0207641_10010315 3300026088 Bacteria 7680
272 Ga0207641_10025459 3300026088 Bacteria 4879
273 Ga0207641_10085996 3300026088 Bacteria 2741
274 Ga0207648_10015867 3300026089 Bacteria 6907
275 Ga0207648_10250106 3300026089 Bacteria 1580
276 Ga0207676_10118164 3300026095 Bacteria 2231
277 Ga0207675_100136910 3300026118 Unclassified 2324
278 Ga0207683_10044695 3300026121 Bacteria 3872
279 Ga0207683_10128921 3300026121 Bacteria 2274
280 Ga0207698_10005229 3300026142 Bacteria 7983
281 Ga0268266_10010442 3300028379 Bacteria 8113
282 Ga0268264_10005303 3300028381 Bacteria 10917
283 Ga0268264_10006770 3300028381 Bacteria 9626
284 Ga0268264_10022574 3300028381 Bacteria 5136
285 Ga0268264_10100801 3300028381 Bacteria 2509
286 Ga0307513_10291836 3300031456 Bacteria 1402
287 Ga0307516_10003021 3300031730 Bacteria 21944
288 Ga0307405_10000005 3300031731 Bacteria 376536
289 Ga0307406_10003950 3300031901 Bacteria 8059
290 Ga0307414_10005192 3300032004 Bacteria 7148
291 Ga0307510_10000058 3300033180 Bacteria 85118
292 Ga0395899_0001157 3300037312 Bacteria 23307
293 Ga0395899_0040211 3300037312 Bacteria 3497
294 Ga0395900_0001840 3300037418 Bacteria 24172
295 Ga0395900_0026367 3300037418 Bacteria 5951
296 Ga0395898_0000480 3300037466 Bacteria 79611
297 Ga0395898_0032694 3300037466 Bacteria 5193
298 Ga0395898_0044105 3300037466 Bacteria 4392
299 Ga0395905_0044239 3300037471 Bacteria 4179
300 Ga0395905_0152326 3300037471 Unclassified 2175
301 Ga0395901_0005715 3300038443 Bacteria 12593
302 Ga0395901_0009833 3300038443 Bacteria 9697
303 Ga0436365_0103853 3300039437 Bacteria 48297
304 Ga0439436_0021241 3300041404 Bacteria 1931
305 Ga0439457_000577 3300042014 Bacteria 10722
306 Ga0451577_0001383 3300042876 Bacteria 32504
307 Ga0466969_0000033 3300044656 Bacteria 82227
308 Ga0466972_0000328 3300044658 Bacteria 26748
309 Ga0466972_0133299 3300044658 Bacteria 1170
310 Ga0453684_0000004 3300044712 Bacteria 1469893
311 Ga0453684_0404719 3300044712 Bacteria 1528
312 Ga0466957_0013358 3300044842 Bacteria 4764
313 Ga0466957_0019631 3300044842 Bacteria 3975
314 Ga0466959_0000048 3300045049 Bacteria 83528
315 Ga0495607_0002790 3300046501 Bacteria 13908
316 Ga0495606_0005512 3300046507 Bacteria 12095
317 Ga0495606_0023905 3300046507 Bacteria 4416
318 Ga0495616_0018469 3300046513 Bacteria 3827
319 Ga0495643_0000985 3300046522 Bacteria 29208
320 Ga0495668_0002071 3300046616 Bacteria 17380
321 Ga0495611_0000337 3300046648 Bacteria 30560
322 Ga0495625_0002098 3300046660 Bacteria 22270
323 Ga0496100_0107247 3300048903 Bacteria 1935
324 Ga0496102_0228412 3300048905 Bacteria 1755
325 Ga0496102_0234178 3300048905 Bacteria 1731
326 Ga0501034_0011434 3300049571 Bacteria 9196
327 Ga0501034_0039341 3300049571 Bacteria 4790
328 Ga0501034_0362079 3300049571 Unclassified 1377
329 Ga0501036_0062542 3300049572 Unclassified 3153
330 Ga0501037_0016590 3300049573 Bacteria 5420
331 Ga0501037_0016819 3300049573 Bacteria 5381
332 Ga0501037_0224603 3300049573 Unclassified 1320
333 Ga0501038_0010021 3300049574 Bacteria 8679
334 Ga0501038_0020295 3300049574 Bacteria 5977
335 Ga0501039_0007942 3300049575 Bacteria 8083
336 Ga0501043_0010414 3300049579 Bacteria 7285
337 Ga0501043_0052187 3300049579 Bacteria 3213
338 Ga0501043_0142449 3300049579 Bacteria 1877
339 Ga0501043_0152122 3300049579 Bacteria 1811
340 Ga0501046_0011578 3300049580 Bacteria 7541
341 Ga0501047_0017200 3300049581 Bacteria 6922
342 Ga0501048_0114906 3300049582 Unclassified 1902
343 Ga0501070_0015820 3300049586 Bacteria 6343
344 Ga0501073_0005702 3300049589 Bacteria 9313
345 Ga0501074_0003660 3300049590 Bacteria 10907
346 Ga0501201_000313 3300049651 Bacteria 4459
347 Ga0501202_000409 3300049652 Bacteria 6022
348 Ga0501208_002834 3300049655 Unclassified 1861
349 Ga0501217_001001 3300049661 Bacteria 5110
350 Ga0501217_002104 3300049661 Unclassified 3863
351 Ga0501224_000069 3300049664 Bacteria 11229
352 Ga0501235_000555 3300049669 Bacteria 7481
353 Ga0501243_005274 3300049675 Bacteria 1942
354 Ga0501259_000051 3300049688 Bacteria 16457
355 Ga0501225_0000620 3300049705 Bacteria 11077
356 Ga0501245_001014 3300049708 Unclassified 3607
357 Ga0501080_0033145 3300049742 Bacteria 4821
358 Ga0501266_002004 3300049763 Bacteria 2566
359 Ga0501035_0005410 3300049822 Bacteria 12070
360 Ga0501035_0072709 3300049822 Bacteria 3043
361 Ga0501044_0095006 3300049823 Bacteria 3005
362 Ga0501044_0165922 3300049823 Unclassified 2183
363 nmdc:mga05p37_5326_c1 3300050507 Bacteria 15106
364 nmdc:mga05p37_76239_c1 3300050507 Bacteria 4128
365 nmdc:mga09592_10500_c1 3300050508 Bacteria 6918
366 nmdc:mga06r32_16523_c1 3300050510 Bacteria 6727
367 nmdc:mga08y16_17682_c1 3300050511 Bacteria 7509
368 Ga0500578_0000097 3300053086 Bacteria 100607
369 Ga0500641_0000305 3300053096 Bacteria 18258
370 Ga0500568_0002028 3300053139 Bacteria 12326
371 Ga0500611_000075 3300053727 Bacteria 39695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100016737 Ga0070660_1000167371 308
2 3300049573 Ga0501037_0224603 Ga0501037_0224603_149_1261 324
3 3300049823 Ga0501044_0165922 Ga0501044_0165922_1064_2170 341
4 3300005458 Ga0070681_10112024 Ga0070681_101120243 342
5 3300044658 Ga0466972_0133299 Ga0466972_0133299_34_1137 342
6 3300013100 Ga0157373_10016733 Ga0157373_100167333 349
7 3300049571 Ga0501034_0362079 Ga0501034_0362079_163_1359 352
8 3300005327 Ga0070658_10037804 Ga0070658_100378043 365
9 3300025909 Ga0207705_10059119 Ga0207705_100591193 365
10 3300025901 Ga0207688_10042941 Ga0207688_100429412 372
11 3300005459 Ga0068867_100110356 Ga0068867_1001103562 374
12 3300025925 Ga0207650_10244994 Ga0207650_102449941 374
13 3300005564 Ga0070664_100093393 Ga0070664_1000933933 381
14 3300005539 Ga0068853_100038692 Ga0068853_1000386924 383
15 3300013102 Ga0157371_10114972 Ga0157371_101149722 384
16 3300013307 Ga0157372_10032123 Ga0157372_100321234 384
17 3300046648 Ga0495611_0000337 Ga0495611_0000337_19043_20329 385
18 3300049571 Ga0501034_0011434 Ga0501034_0011434_6832_8130 386
19 3300049572 Ga0501036_0062542 Ga0501036_0062542_592_1890 386
20 3300049579 Ga0501043_0052187 Ga0501043_0052187_855_2153 386
21 iso_pu_bacteria 2600255229 2601445427 387
22 3300005336 Ga0070680_100088167 Ga0070680_1000881672 388
23 3300005530 Ga0070679_100003446 Ga0070679_1000034469 388
24 3300005530 Ga0070679_100069271 Ga0070679_1000692712 388
25 3300005563 Ga0068855_100020814 Ga0068855_1000208146 388
26 3300005563 Ga0068855_100123974 Ga0068855_1001239742 388
27 3300005616 Ga0068852_100111170 Ga0068852_1001111703 388
28 3300013102 Ga0157371_10001101 Ga0157371_1000110129 388
29 3300013102 Ga0157371_10001198 Ga0157371_100011987 388
30 3300013102 Ga0157371_10002260 Ga0157371_100022607 388
31 3300013102 Ga0157371_10002284 Ga0157371_100022849 388
32 3300013102 Ga0157371_10010357 Ga0157371_100103574 388
33 3300013102 Ga0157371_10020291 Ga0157371_100202912 388
34 3300013102 Ga0157371_10028802 Ga0157371_100288025 388
35 3300013104 Ga0157370_10001136 Ga0157370_1000113617 388
36 3300013104 Ga0157370_10009435 Ga0157370_100094359 388
37 3300013307 Ga0157372_10032147 Ga0157372_100321472 388
38 3300013307 Ga0157372_10066887 Ga0157372_100668875 388
39 3300013307 Ga0157372_10137139 Ga0157372_101371392 388
40 3300013307 Ga0157372_10199806 Ga0157372_101998062 388
41 3300025909 Ga0207705_10214839 Ga0207705_102148391 388
42 3300025919 Ga0207657_10022365 Ga0207657_100223651 388
43 3300025921 Ga0207652_10000159 Ga0207652_1000015937 388
44 3300025921 Ga0207652_10044219 Ga0207652_100442192 388
45 3300025932 Ga0207690_10050830 Ga0207690_100508304 388
46 3300025949 Ga0207667_10016804 Ga0207667_100168047 388
47 3300025949 Ga0207667_10036567 Ga0207667_100365674 388
48 3300026067 Ga0207678_10022450 Ga0207678_100224502 388
49 3300037312 Ga0395899_0001157 Ga0395899_0001157_8148_9419 388
50 3300037312 Ga0395899_0040211 Ga0395899_0040211_1479_2720 388
51 3300037418 Ga0395900_0001840 Ga0395900_0001840_16989_18260 388
52 3300037418 Ga0395900_0026367 Ga0395900_0026367_3185_4426 388
53 3300037466 Ga0395898_0000480 Ga0395898_0000480_8497_9768 388
54 3300037466 Ga0395898_0032694 Ga0395898_0032694_393_1634 388
55 3300037466 Ga0395898_0044105 Ga0395898_0044105_1416_2657 388
56 3300037471 Ga0395905_0044239 Ga0395905_0044239_368_1609 388
57 3300038443 Ga0395901_0005715 Ga0395901_0005715_6253_7524 388
58 3300038443 Ga0395901_0009833 Ga0395901_0009833_8304_9545 388
59 3300005330 Ga0070690_100003099 Ga0070690_10000309910 389
60 3300005344 Ga0070661_100119348 Ga0070661_1001193482 389
61 3300005355 Ga0070671_100207991 Ga0070671_1002079911 389
62 3300005364 Ga0070673_100043860 Ga0070673_1000438603 389
63 3300005456 Ga0070678_100033486 Ga0070678_1000334861 389
64 3300005466 Ga0070685_10090158 Ga0070685_100901582 389
65 3300005719 Ga0068861_100168611 Ga0068861_1001686112 389
66 3300009553 Ga0105249_10092754 Ga0105249_100927541 389
67 3300017792 Ga0163161_10226231 Ga0163161_102262311 389
68 3300025918 Ga0207662_10004441 Ga0207662_100044415 389
69 3300025940 Ga0207691_10012122 Ga0207691_100121229 389
70 3300033180 Ga0307510_10000058 Ga0307510_1000005840 389
71 3300044712 Ga0453684_0404719 Ga0453684_0404719_88_1335 389
72 3300042876 Ga0451577_0001383 Ga0451577_0001383_21433_22647 390
73 3300044712 Ga0453684_0000004 Ga0453684_0000004_640420_641634 390
74 3300049651 Ga0501201_000313 Ga0501201_000313_1426_2667 390
75 3300049652 Ga0501202_000409 Ga0501202_000409_2788_4029 390
76 3300049655 Ga0501208_002834 Ga0501208_002834_17_1258 390
77 3300049661 Ga0501217_001001 Ga0501217_001001_3558_4856 390
78 3300049661 Ga0501217_002104 Ga0501217_002104_2337_3578 390
79 3300049664 Ga0501224_000069 Ga0501224_000069_6516_7757 390
80 3300049669 Ga0501235_000555 Ga0501235_000555_3275_4516 390
81 3300049675 Ga0501243_005274 Ga0501243_005274_34_1332 390
82 3300049688 Ga0501259_000051 Ga0501259_000051_9253_10494 390
83 3300049705 Ga0501225_0000620 Ga0501225_0000620_1426_2667 390
84 3300049708 Ga0501245_001014 Ga0501245_001014_263_1504 390
85 3300049763 Ga0501266_002004 Ga0501266_002004_612_1910 390
86 iso_pu_bacteria 2593339131 2595089894 391
87 iso_pu_bacteria 2643221735 2644741340 391
88 iso_pu_bacteria 2684623153 2686997710 391
89 iso_pu_bacteria 2687453109 2687499101 391
90 iso_pu_bacteria 2738543017 2739270830 391
91 iso_pu_bacteria 2757320391 2757568217 391
92 iso_pu_bacteria 2775507177 2777760394 391
93 iso_pu_bacteria 2775507192 2777837143 391
94 iso_pu_bacteria 2811994870 2812316912 391
95 iso_pu_bacteria 2818991468 2819723976 391
96 iso_pu_bacteria 2823526263 2823528919 391
97 iso_pu_bacteria 2857586860 2857591206 391
98 iso_pu_bacteria 2908665501 2908667877 391
99 iso_pu_bacteria 2919093281 2919095666 391
100 iso_pu_bacteria 2919726948 2919728615 391
101 iso_pu_bacteria 2936340661 2936340782 391
102 iso_pu_bacteria 2954773129 2954773554 391
103 3300041404 Ga0439436_0021241 Ga0439436_0021241_116_1405 392
104 3300042014 Ga0439457_000577 Ga0439457_000577_8705_9994 392
105 3300003187 JGI25151J46595_10000060 JGI25151J46595_10000060100 393
106 3300003187 JGI25151J46595_10001917 JGI25151J46595_100019178 393
107 3300003187 JGI25151J46595_10009644 JGI25151J46595_100096442 393
108 3300003187 JGI25151J46595_10009711 JGI25151J46595_100097112 393
109 3300003578 Ga0006562J51391_1005834 Ga0006562J51391_10058344 393
110 3300003758 Ga0055532_1000078 Ga0055532_100007871 393
111 3300005329 Ga0070683_100013648 Ga0070683_1000136484 393
112 3300005563 Ga0068855_100002499 Ga0068855_10000249911 393
113 3300009093 Ga0105240_10020499 Ga0105240_100204993 393
114 3300013105 Ga0157369_10208610 Ga0157369_102086102 393
115 3300025229 Ga0209147_100114 Ga0209147_10011493 393
116 3300025292 Ga0209676_1004439 Ga0209676_10044396 393
117 3300025294 Ga0209025_1000001 Ga0209025_1000001291 393
118 3300025294 Ga0209025_1000219 Ga0209025_1000219121 393
119 3300025294 Ga0209025_1003637 Ga0209025_10036377 393
120 3300025294 Ga0209025_1003799 Ga0209025_10037995 393
121 3300025913 Ga0207695_10000073 Ga0207695_10000073214 393
122 3300025944 Ga0207661_10009701 Ga0207661_100097014 393
123 3300025949 Ga0207667_10000863 Ga0207667_1000086321 393
124 3300048905 Ga0496102_0234178 Ga0496102_0234178_116_1417 393
125 3300009545 Ga0105237_10000169 Ga0105237_1000016963 396
126 3300025914 Ga0207671_10001921 Ga0207671_1000192111 396
127 3300003320 rootH2_10039737 rootH2_1003973712 398
128 3300005355 Ga0070671_100113601 Ga0070671_1001136013 399
129 3300013308 Ga0157375_10258765 Ga0157375_102587652 399
130 3300025940 Ga0207691_10009845 Ga0207691_100098451 399
131 3300025981 Ga0207640_10146531 Ga0207640_101465311 399
132 3300026121 Ga0207683_10044695 Ga0207683_100446952 399
133 iso_pu_bacteria 2738541278 2738730395 400
134 iso_pu_bacteria 2958512119 2958513835 400
135 3300005327 Ga0070658_10035016 Ga0070658_100350165 403
136 3300005327 Ga0070658_10038171 Ga0070658_100381714 403
137 3300005329 Ga0070683_100180289 Ga0070683_1001802891 403
138 3300005334 Ga0068869_100112106 Ga0068869_1001121062 403
139 3300005339 Ga0070660_100114801 Ga0070660_1001148012 403
140 3300005353 Ga0070669_100133122 Ga0070669_1001331222 403
141 3300005366 Ga0070659_100002579 Ga0070659_1000025797 403
142 3300005458 Ga0070681_10106725 Ga0070681_101067251 403
143 3300005458 Ga0070681_10123007 Ga0070681_101230073 403
144 3300005530 Ga0070679_100005217 Ga0070679_1000052176 403
145 3300005530 Ga0070679_100066411 Ga0070679_1000664114 403
146 3300005535 Ga0070684_100268848 Ga0070684_1002688481 403
147 3300005539 Ga0068853_100029690 Ga0068853_1000296903 403
148 3300005563 Ga0068855_100037568 Ga0068855_1000375686 403
149 3300005578 Ga0068854_100027595 Ga0068854_1000275955 403
150 3300005614 Ga0068856_100014298 Ga0068856_1000142987 403
151 3300005616 Ga0068852_100027368 Ga0068852_1000273684 403
152 3300005617 Ga0068859_100032819 Ga0068859_1000328192 403
153 3300005618 Ga0068864_100059644 Ga0068864_1000596443 403
154 3300005843 Ga0068860_100003210 Ga0068860_10000321012 403
155 3300005844 Ga0068862_100015517 Ga0068862_1000155172 403
156 3300006931 Ga0097620_100032819 Ga0097620_1000328192 403
157 3300009174 Ga0105241_10007105 Ga0105241_100071052 403
158 3300009545 Ga0105237_10022929 Ga0105237_100229295 403
159 3300013100 Ga0157373_10002046 Ga0157373_100020469 403
160 3300013100 Ga0157373_10007142 Ga0157373_100071422 403
161 3300013100 Ga0157373_10151293 Ga0157373_101512932 403
162 3300013102 Ga0157371_10037567 Ga0157371_100375674 403
163 3300013102 Ga0157371_10098546 Ga0157371_100985462 403
164 3300013104 Ga0157370_10067642 Ga0157370_100676424 403
165 3300013105 Ga0157369_10021269 Ga0157369_100212695 403
166 3300013306 Ga0163162_10064868 Ga0163162_100648684 403
167 3300013307 Ga0157372_10018551 Ga0157372_100185515 403
168 3300013307 Ga0157372_10171876 Ga0157372_101718762 403
169 3300025909 Ga0207705_10197773 Ga0207705_101977731 403
170 3300025913 Ga0207695_10015953 Ga0207695_100159532 403
171 3300025917 Ga0207660_10174198 Ga0207660_101741982 403
172 3300025919 Ga0207657_10093211 Ga0207657_100932113 403
173 3300025921 Ga0207652_10000367 Ga0207652_1000036727 403
174 3300025921 Ga0207652_10018991 Ga0207652_100189916 403
175 3300025921 Ga0207652_10088827 Ga0207652_100888272 403
176 3300025942 Ga0207689_10181189 Ga0207689_101811892 403
177 3300025949 Ga0207667_10062464 Ga0207667_100624644 403
178 3300025981 Ga0207640_10141687 Ga0207640_101416872 403
179 3300026041 Ga0207639_10040555 Ga0207639_100405553 403
180 3300037471 Ga0395905_0152326 Ga0395905_0152326_487_1899 403
181 3300049571 Ga0501034_0039341 Ga0501034_0039341_1849_3141 403
182 3300049579 Ga0501043_0152122 Ga0501043_0152122_337_1629 403
183 3300003322 rootL2_10295692 rootL2_102956922 404
184 3300003323 rootH1_10060141 rootH1_100601418 404
185 3300005327 Ga0070658_10000095 Ga0070658_1000009534 404
186 3300005328 Ga0070676_10000252 Ga0070676_1000025220 404
187 3300005328 Ga0070676_10008980 Ga0070676_100089806 404
188 3300005331 Ga0070670_100074680 Ga0070670_1000746803 404
189 3300005334 Ga0068869_100011787 Ga0068869_1000117877 404
190 3300005334 Ga0068869_100016214 Ga0068869_1000162146 404
191 3300005334 Ga0068869_100045369 Ga0068869_1000453694 404
192 3300005335 Ga0070666_10000192 Ga0070666_1000019233 404
193 3300005335 Ga0070666_10000271 Ga0070666_1000027116 404
194 3300005335 Ga0070666_10125055 Ga0070666_101250551 404
195 3300005338 Ga0068868_100000091 Ga0068868_10000009134 404
196 3300005338 Ga0068868_100020590 Ga0068868_1000205905 404
197 3300005347 Ga0070668_100000043 Ga0070668_10000004369 404
198 3300005347 Ga0070668_100026920 Ga0070668_1000269204 404
199 3300005353 Ga0070669_100150429 Ga0070669_1001504292 404
200 3300005355 Ga0070671_100227232 Ga0070671_1002272321 404
201 3300005364 Ga0070673_100006626 Ga0070673_1000066263 404
202 3300005367 Ga0070667_100000086 Ga0070667_1000000869 404
203 3300005367 Ga0070667_100001632 Ga0070667_10000163214 404
204 3300005457 Ga0070662_100004021 Ga0070662_1000040216 404
205 3300005459 Ga0068867_100006741 Ga0068867_1000067413 404
206 3300005471 Ga0070698_100004171 Ga0070698_1000041719 404
207 3300005539 Ga0068853_100006204 Ga0068853_1000062043 404
208 3300005539 Ga0068853_100260243 Ga0068853_1002602431 404
209 3300005543 Ga0070672_100000160 Ga0070672_10000016029 404
210 3300005548 Ga0070665_100000350 Ga0070665_10000035037 404
211 3300005548 Ga0070665_100026916 Ga0070665_1000269167 404
212 3300005563 Ga0068855_100001013 Ga0068855_10000101313 404
213 3300005617 Ga0068859_100000041 Ga0068859_10000004186 404
214 3300005618 Ga0068864_100006586 Ga0068864_1000065863 404
215 3300005718 Ga0068866_10066176 Ga0068866_100661761 404
216 3300005719 Ga0068861_100025193 Ga0068861_1000251932 404
217 3300005834 Ga0068851_10000487 Ga0068851_1000048712 404
218 3300005834 Ga0068851_10018031 Ga0068851_100180312 404
219 3300005840 Ga0068870_10020460 Ga0068870_100204602 404
220 3300005841 Ga0068863_100002653 Ga0068863_1000026536 404
221 3300005841 Ga0068863_100079247 Ga0068863_1000792471 404
222 3300005841 Ga0068863_100130262 Ga0068863_1001302622 404
223 3300005842 Ga0068858_100000662 Ga0068858_10000066216 404
224 3300005842 Ga0068858_100031654 Ga0068858_1000316544 404
225 3300005843 Ga0068860_100007493 Ga0068860_1000074938 404
226 3300005843 Ga0068860_100020750 Ga0068860_1000207505 404
227 3300005843 Ga0068860_100125713 Ga0068860_1001257131 404
228 3300006195 Ga0075366_10093626 Ga0075366_100936262 404
229 3300006237 Ga0097621_100000390 Ga0097621_10000039022 404
230 3300006237 Ga0097621_100000695 Ga0097621_1000006952 404
231 3300006237 Ga0097621_100047871 Ga0097621_1000478714 404
232 3300006237 Ga0097621_100193593 Ga0097621_1001935932 404
233 3300006358 Ga0068871_100000091 Ga0068871_10000009146 404
234 3300006358 Ga0068871_100002236 Ga0068871_1000022363 404
235 3300006358 Ga0068871_100080691 Ga0068871_1000806913 404
236 3300006358 Ga0068871_100101930 Ga0068871_1001019302 404
237 3300006881 Ga0068865_100000552 Ga0068865_10000055222 404
238 3300006931 Ga0097620_100000041 Ga0097620_10000004178 404
239 3300009093 Ga0105240_10000358 Ga0105240_1000035821 404
240 3300009101 Ga0105247_10004128 Ga0105247_100041283 404
241 3300009147 Ga0114129_10003278 Ga0114129_1000327811 404
242 3300009148 Ga0105243_10206624 Ga0105243_102066242 404
243 3300009174 Ga0105241_10001122 Ga0105241_100011225 404
244 3300009176 Ga0105242_10149076 Ga0105242_101490762 404
245 3300009177 Ga0105248_10036462 Ga0105248_100364624 404
246 3300009545 Ga0105237_10004610 Ga0105237_1000461010 404
247 3300009545 Ga0105237_10036664 Ga0105237_100366643 404
248 3300009553 Ga0105249_10004235 Ga0105249_1000423510 404
249 3300009553 Ga0105249_10015628 Ga0105249_100156283 404
250 3300010375 Ga0105239_10113086 Ga0105239_101130864 404
251 3300011119 Ga0105246_10040342 Ga0105246_100403422 404
252 3300013104 Ga0157370_10000257 Ga0157370_1000025749 404
253 3300013296 Ga0157374_10000084 Ga0157374_1000008437 404
254 3300013296 Ga0157374_10360886 Ga0157374_103608861 404
255 3300013297 Ga0157378_10016309 Ga0157378_100163095 404
256 3300013297 Ga0157378_10019655 Ga0157378_100196552 404
257 3300013297 Ga0157378_10022685 Ga0157378_100226852 404
258 3300013297 Ga0157378_10032015 Ga0157378_100320152 404
259 3300013297 Ga0157378_10093448 Ga0157378_100934483 404
260 3300013306 Ga0163162_10000113 Ga0163162_1000011329 404
261 3300013306 Ga0163162_10000546 Ga0163162_1000054610 404
262 3300013306 Ga0163162_10003909 Ga0163162_1000390914 404
263 3300013306 Ga0163162_10384036 Ga0163162_103840362 404
264 3300013308 Ga0157375_10000118 Ga0157375_1000011858 404
265 3300013308 Ga0157375_10006522 Ga0157375_100065227 404
266 3300013308 Ga0157375_10025925 Ga0157375_100259256 404
267 3300013308 Ga0157375_10028532 Ga0157375_100285324 404
268 3300014325 Ga0163163_10000306 Ga0163163_1000030622 404
269 3300014745 Ga0157377_10017611 Ga0157377_100176112 404
270 3300014968 Ga0157379_10000245 Ga0157379_1000024536 404
271 3300014968 Ga0157379_10011641 Ga0157379_100116412 404
272 3300014968 Ga0157379_10043915 Ga0157379_100439152 404
273 3300014968 Ga0157379_10051103 Ga0157379_100511033 404
274 3300014969 Ga0157376_10000276 Ga0157376_1000027625 404
275 3300014969 Ga0157376_10003519 Ga0157376_1000351910 404
276 3300014969 Ga0157376_10136065 Ga0157376_101360651 404
277 3300017792 Ga0163161_10002287 Ga0163161_100022878 404
278 3300017792 Ga0163161_10003110 Ga0163161_100031105 404
279 3300017792 Ga0163161_10059700 Ga0163161_100597002 404
280 3300021384 Ga0213876_10003390 Ga0213876_100033909 404
281 3300025321 Ga0207656_10003536 Ga0207656_100035365 404
282 3300025900 Ga0207710_10012875 Ga0207710_100128754 404
283 3300025900 Ga0207710_10026380 Ga0207710_100263803 404
284 3300025901 Ga0207688_10053537 Ga0207688_100535371 404
285 3300025903 Ga0207680_10000029 Ga0207680_1000002923 404
286 3300025903 Ga0207680_10023505 Ga0207680_100235053 404
287 3300025907 Ga0207645_10002237 Ga0207645_1000223715 404
288 3300025909 Ga0207705_10003864 Ga0207705_100038648 404
289 3300025912 Ga0207707_10111702 Ga0207707_101117023 404
290 3300025914 Ga0207671_10033022 Ga0207671_100330223 404
291 3300025914 Ga0207671_10043455 Ga0207671_100434554 404
292 3300025925 Ga0207650_10064426 Ga0207650_100644261 404
293 3300025933 Ga0207706_10008752 Ga0207706_100087526 404
294 3300025938 Ga0207704_10032930 Ga0207704_100329302 404
295 3300025940 Ga0207691_10001704 Ga0207691_1000170410 404
296 3300025940 Ga0207691_10031008 Ga0207691_100310086 404
297 3300025941 Ga0207711_10044317 Ga0207711_100443172 404
298 3300025942 Ga0207689_10002539 Ga0207689_1000253914 404
299 3300025942 Ga0207689_10004419 Ga0207689_100044196 404
300 3300025942 Ga0207689_10081926 Ga0207689_100819261 404
301 3300025945 Ga0207679_10046073 Ga0207679_100460733 404
302 3300025949 Ga0207667_10040333 Ga0207667_100403332 404
303 3300025960 Ga0207651_10007629 Ga0207651_100076296 404
304 3300025961 Ga0207712_10059625 Ga0207712_100596252 404
305 3300025972 Ga0207668_10000520 Ga0207668_1000052019 404
306 3300025972 Ga0207668_10177426 Ga0207668_101774262 404
307 3300025986 Ga0207658_10000559 Ga0207658_100005599 404
308 3300025986 Ga0207658_10024983 Ga0207658_100249832 404
309 3300025986 Ga0207658_10046282 Ga0207658_100462823 404
310 3300025986 Ga0207658_10051604 Ga0207658_100516043 404
311 3300026023 Ga0207677_10002274 Ga0207677_100022745 404
312 3300026035 Ga0207703_10005041 Ga0207703_100050417 404
313 3300026035 Ga0207703_10006086 Ga0207703_100060861 404
314 3300026041 Ga0207639_10022682 Ga0207639_100226823 404
315 3300026078 Ga0207702_10148723 Ga0207702_101487232 404
316 3300026088 Ga0207641_10000044 Ga0207641_10000044130 404
317 3300026088 Ga0207641_10010315 Ga0207641_100103154 404
318 3300026088 Ga0207641_10025459 Ga0207641_100254592 404
319 3300026088 Ga0207641_10085996 Ga0207641_100859961 404
320 3300026089 Ga0207648_10015867 Ga0207648_100158674 404
321 3300026089 Ga0207648_10250106 Ga0207648_102501061 404
322 3300026118 Ga0207675_100136910 Ga0207675_1001369102 404
323 3300026121 Ga0207683_10128921 Ga0207683_101289212 404
324 3300026142 Ga0207698_10005229 Ga0207698_100052291 404
325 3300028379 Ga0268266_10010442 Ga0268266_100104426 404
326 3300028381 Ga0268264_10005303 Ga0268264_100053033 404
327 3300028381 Ga0268264_10006770 Ga0268264_100067706 404
328 3300028381 Ga0268264_10100801 Ga0268264_101008011 404
329 3300031456 Ga0307513_10291836 Ga0307513_102918361 404
330 3300031730 Ga0307516_10003021 Ga0307516_100030219 404
331 3300039437 Ga0436365_0103853 Ga0436365_0103853_2730_4019 404
332 3300044656 Ga0466969_0000033 Ga0466969_0000033_40941_42239 404
333 3300044658 Ga0466972_0000328 Ga0466972_0000328_936_2225 404
334 3300044842 Ga0466957_0013358 Ga0466957_0013358_580_1869 404
335 3300044842 Ga0466957_0019631 Ga0466957_0019631_1329_2618 404
336 3300045049 Ga0466959_0000048 Ga0466959_0000048_58021_59319 404
337 3300046501 Ga0495607_0002790 Ga0495607_0002790_4324_5568 404
338 3300046507 Ga0495606_0005512 Ga0495606_0005512_4459_5745 404
339 3300046507 Ga0495606_0023905 Ga0495606_0023905_214_1461 404
340 3300046513 Ga0495616_0018469 Ga0495616_0018469_211_1425 404
341 3300046522 Ga0495643_0000985 Ga0495643_0000985_11426_12640 404
342 3300046616 Ga0495668_0002071 Ga0495668_0002071_4624_5916 404
343 3300046660 Ga0495625_0002098 Ga0495625_0002098_4137_5351 404
344 3300048903 Ga0496100_0107247 Ga0496100_0107247_562_1881 404
345 3300048905 Ga0496102_0228412 Ga0496102_0228412_323_1642 404
346 3300049573 Ga0501037_0016590 Ga0501037_0016590_1625_2914 404
347 3300049573 Ga0501037_0016819 Ga0501037_0016819_2995_4332 404
348 3300049574 Ga0501038_0010021 Ga0501038_0010021_1245_2582 404
349 3300049574 Ga0501038_0020295 Ga0501038_0020295_1791_3080 404
350 3300049575 Ga0501039_0007942 Ga0501039_0007942_3090_4427 404
351 3300049579 Ga0501043_0010414 Ga0501043_0010414_429_1718 404
352 3300049579 Ga0501043_0142449 Ga0501043_0142449_355_1644 404
353 3300049580 Ga0501046_0011578 Ga0501046_0011578_3150_4487 404
354 3300049581 Ga0501047_0017200 Ga0501047_0017200_1031_2326 404
355 3300049582 Ga0501048_0114906 Ga0501048_0114906_46_1341 404
356 3300049586 Ga0501070_0015820 Ga0501070_0015820_1252_2589 404
357 3300049589 Ga0501073_0005702 Ga0501073_0005702_2965_4302 404
358 3300049590 Ga0501074_0003660 Ga0501074_0003660_5702_7039 404
359 3300049742 Ga0501080_0033145 Ga0501080_0033145_2368_3663 404
360 3300049822 Ga0501035_0005410 Ga0501035_0005410_14_1309 404
361 3300049822 Ga0501035_0072709 Ga0501035_0072709_1440_2729 404
362 3300049823 Ga0501044_0095006 Ga0501044_0095006_1008_2297 404
363 3300050507 nmdc:mga05p37_5326_c1 nmdc:mga05p37_5326_c1_9964_11253 404
364 3300053086 Ga0500578_0000097 Ga0500578_0000097_44445_45791 404
365 3300053096 Ga0500641_0000305 Ga0500641_0000305_17022_18236 404
366 3300053139 Ga0500568_0002028 Ga0500568_0002028_7913_9202 404
367 3300053727 Ga0500611_000075 Ga0500611_000075_29182_30477 404
368 3300005331 Ga0070670_100084902 Ga0070670_1000849022 405
369 3300005618 Ga0068864_100130466 Ga0068864_1001304662 405
370 3300005843 Ga0068860_100036681 Ga0068860_1000366813 405
371 3300006844 Ga0075428_100110826 Ga0075428_1001108264 405
372 3300006847 Ga0075431_100005955 Ga0075431_1000059558 405
373 3300009094 Ga0111539_10005606 Ga0111539_100056067 405
374 3300009147 Ga0114129_10093714 Ga0114129_100937143 405
375 3300013306 Ga0163162_10000798 Ga0163162_100007984 405
376 3300014325 Ga0163163_10000694 Ga0163163_1000069427 405
377 3300014969 Ga0157376_10190635 Ga0157376_101906352 405
378 3300025926 Ga0207659_10108345 Ga0207659_101083452 405
379 3300026095 Ga0207676_10118164 Ga0207676_101181642 405
380 3300028381 Ga0268264_10022574 Ga0268264_100225744 405
381 3300032004 Ga0307414_10005192 Ga0307414_100051923 405
382 3300050507 nmdc:mga05p37_76239_c1 nmdc:mga05p37_76239_c1_1560_2858 405
383 3300050508 nmdc:mga09592_10500_c1 nmdc:mga09592_10500_c1_2145_3443 405
384 3300050510 nmdc:mga06r32_16523_c1 nmdc:mga06r32_16523_c1_2712_4010 405
385 3300050511 nmdc:mga08y16_17682_c1 nmdc:mga08y16_17682_c1_1225_2523 405
386 2162886007 SwRhRL2b_contig_3344168 SwRhRL2b_0518.00003990 406
387 3300005289 Ga0065704_10076563 Ga0065704_100765632 406
388 3300013104 Ga0157370_10129748 Ga0157370_101297482 406
389 3300015261 Ga0182006_1009306 Ga0182006_10093063 406
390 3300031731 Ga0307405_10000005 Ga0307405_10000005322 406
391 3300031901 Ga0307406_10003950 Ga0307406_100039503 406

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02875

Mur_ligase_C

Mur ligase, glutamate ligase domain

326

444

0.93

PF08245

Mur_ligase_M

Mur ligase middle domain

74

296

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w7k-assembly1.cif.gz_A e.coli folc in complex with adp, without folate substrate 0.8966 2 405
1w78-assembly1.cif.gz_A e.coli folc in complex with dhpp and adp 0.8876 6 405
3qcz-assembly1.cif.gz_A crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase with mn, amppnp and l-glutamate bound 0.876 1 405
1w7k-assembly1.cif.gz_A e.coli folc in complex with adp, without folate substrate 0.871 2 405
1w78-assembly1.cif.gz_A e.coli folc in complex with dhpp and adp 0.8687 6 405
ID Description Score Start End Superfamily
af_Q12676_1_273_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9535 24 273 3.40.1190.10
af_Q9UTD0_1_272_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9395 25 272 3.40.1190.10
af_Q09509_39_317_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9289 28 263 3.40.1190.10
af_A0A0R0GP07_20_312_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9231 28 270 3.40.1190.10
af_Q2FXR9_1_294_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.921 1 270 3.40.1190.10
ID Description Score Start End GO Terms
AF-A0A7C2R485-F1-model_v4 Bifunctional folylpolyglutamate synthase/dihydrofolate synthase 0.9983 1 216 GO:0004326
GO:0005524
GO:0005737
GO:0008841
AF-K1TSW2-F1-model_v4 Tetrahydrofolate synthase 0.9983 85 222 GO:0004326
GO:0005524
GO:0005737
GO:0008841
AF-A0A432K2N0-F1-model_v4 Bifunctional folylpolyglutamate synthase/dihydrofolate synthase 0.9952 3 195 GO:0004326
GO:0005524
GO:0005737
GO:0008841
AF-A0A7C2R485-F1-model_v4 Bifunctional folylpolyglutamate synthase/dihydrofolate synthase 0.9891 1 216 GO:0004326
GO:0005524
GO:0005737
GO:0008841
AF-A0A7C7JXG9-F1-model_v4 tetrahydrofolate synthase (EC 6.3.2.17) (Tetrahydrofolylpolyglutamate synthase) 0.9888 41 404 GO:0004326
GO:0005524
GO:0005737
GO:0008841
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.87 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map