F431856

General Info

Members Datasets Scaffolds Average Seq Length
390 265 780 204

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0512443|Ga0501074_0512443_97_822
Length 241
Sequence VVLAVYKKGSGTPQVALMAARRAIPGLWMNMSAGAVAIPIGPAGGATMAAGYLDRAAQEALVAALRIVIAAAPLYAPRMPRTGSPFSVRMTNCGPLGWVSDEAGYRYQPHHPLTGKSWPPMPAMVLEAWRELTGYPALPQACLINWYGPQARMGLHQDRDEEDVDAPVLSLSLGDTALFRIGGTARKDPTRSFRLASGDALILGGADRMAFHGVDRILPGTSTLLPEGGRINLTLRRVRTL

Samples

Sample ID Description Type Environment
1 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
171 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
192 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
207 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
218 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
259 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
260 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
264 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
265 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 0.26
Isolates 0.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.9
Nodule 0
Rhizoplane 7.44
Rhizosphere 84.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501074_0512443 3300049590 Bacteria 850
2 JGI24034J26672_10001450 3300002239 Bacteria 3150
3 JGI24742J22300_10003012 3300002244 Bacteria 2726
4 JGI24751J29686_10031079 3300002459 Bacteria 1107
5 JGI25406J46586_10013497 3300003203 Bacteria 3506
6 Ga0070676_10019465 3300005328 Bacteria 3777
7 Ga0070670_100002853 3300005331 Bacteria 14288
8 Ga0070670_100081488 3300005331 Bacteria 2780
9 Ga0070670_100100925 3300005331 Bacteria 2485
10 Ga0070680_101000493 3300005336 Bacteria 722
11 Ga0068868_100112284 3300005338 Bacteria 2215
12 Ga0070689_100021364 3300005340 Bacteria 4818
13 Ga0070687_100006296 3300005343 Bacteria 4860
14 Ga0070661_100035590 3300005344 Bacteria 3616
15 Ga0070668_100063245 3300005347 Bacteria 2868
16 Ga0070669_100320410 3300005353 Bacteria 1251
17 Ga0070675_100012297 3300005354 Bacteria 6708
18 Ga0070671_100257611 3300005355 Bacteria 1482
19 Ga0070674_100023528 3300005356 Bacteria 3989
20 Ga0070673_100022561 3300005364 Bacteria 4584
21 Ga0070688_100060529 3300005365 Bacteria 2391
22 Ga0070659_100300261 3300005366 Bacteria 1339
23 Ga0070667_100076927 3300005367 Bacteria 2849
24 Ga0070709_10011428 3300005434 Bacteria 4949
25 Ga0070714_100045930 3300005435 Bacteria 3703
26 Ga0070714_100144360 3300005435 Bacteria 2139
27 Ga0070713_100063180 3300005436 Bacteria 3103
28 Ga0070713_100160594 3300005436 Bacteria 2006
29 Ga0070713_100384771 3300005436 Bacteria 1308
30 Ga0070710_10007221 3300005437 Bacteria 5368
31 Ga0070710_10039947 3300005437 Bacteria 2584
32 Ga0070711_100005882 3300005439 Bacteria 7364
33 Ga0070711_100228989 3300005439 Bacteria 1448
34 Ga0070705_100183155 3300005440 Bacteria 1420
35 Ga0070700_100029428 3300005441 Bacteria 3274
36 Ga0070694_100079053 3300005444 Bacteria 2283
37 Ga0070708_100156003 3300005445 Bacteria 2125
38 Ga0070663_100117743 3300005455 Bacteria 2003
39 Ga0070662_100022697 3300005457 Bacteria 4299
40 Ga0070685_10023181 3300005466 Bacteria 3397
41 Ga0070706_100636149 3300005467 Bacteria 990
42 Ga0070698_100300488 3300005471 Bacteria 1536
43 Ga0070698_100537729 3300005471 Bacteria 1107
44 Ga0070699_100005520 3300005518 Bacteria 11079
45 Ga0070679_100664178 3300005530 Bacteria 985
46 Ga0070684_100048822 3300005535 Bacteria 3672
47 Ga0070697_100471517 3300005536 Bacteria 1095
48 Ga0068853_100411960 3300005539 Bacteria 1266
49 Ga0070672_100414916 3300005543 Bacteria 1155
50 Ga0070686_100024642 3300005544 Bacteria 3608
51 Ga0070665_100010892 3300005548 Bacteria 9198
52 Ga0070704_100045717 3300005549 Bacteria 3048
53 Ga0068855_100060533 3300005563 Bacteria 4428
54 Ga0070664_100009952 3300005564 Bacteria 7708
55 Ga0070664_100354981 3300005564 Bacteria 1334
56 Ga0068857_100019106 3300005577 Bacteria 6015
57 Ga0068857_100172067 3300005577 Bacteria 1969
58 Ga0068854_100008792 3300005578 Bacteria 6499
59 Ga0068854_100322830 3300005578 Bacteria 1255
60 Ga0068856_100350671 3300005614 Bacteria 1494
61 Ga0070702_100005999 3300005615 Bacteria 5717
62 Ga0068859_100059082 3300005617 Bacteria 3863
63 Ga0068859_100318789 3300005617 Bacteria 1648
64 Ga0068864_100001766 3300005618 Bacteria 17763
65 Ga0068864_100019179 3300005618 Bacteria 5717
66 Ga0068866_10003097 3300005718 Bacteria 6856
67 Ga0068866_10003845 3300005718 Bacteria 6164
68 Ga0068861_100009246 3300005719 Bacteria 6799
69 Ga0068861_100271636 3300005719 Bacteria 1456
70 Ga0068851_10042290 3300005834 Bacteria 2293
71 Ga0068870_10004572 3300005840 Bacteria 5962
72 Ga0068863_100013628 3300005841 Bacteria 7841
73 Ga0068863_100022280 3300005841 Bacteria 6048
74 Ga0068858_100478728 3300005842 Bacteria 1201
75 Ga0068860_100026926 3300005843 Bacteria 5540
76 Ga0068860_100034149 3300005843 Bacteria 4878
77 Ga0068862_100004757 3300005844 Bacteria 11430
78 Ga0068862_100043864 3300005844 Bacteria 3813
79 Ga0081455_10004222 3300005937 Bacteria 16198
80 Ga0081538_10189200 3300005981 Bacteria 867
81 Ga0081540_1000055 3300005983 Bacteria 122642
82 Ga0081540_1029573 3300005983 Bacteria 3049
83 Ga0070717_10022618 3300006028 Bacteria 4970
84 Ga0070717_10586520 3300006028 Bacteria 1011
85 Ga0075365_10042524 3300006038 Bacteria 2971
86 Ga0075365_10237357 3300006038 Bacteria 1280
87 Ga0075365_10245777 3300006038 Bacteria 1257
88 Ga0075365_10311296 3300006038 Bacteria 1108
89 Ga0075368_10083570 3300006042 Bacteria 1301
90 Ga0075363_100289719 3300006048 Bacteria 949
91 Ga0075363_100324885 3300006048 Bacteria 895
92 Ga0075364_10156989 3300006051 Bacteria 1535
93 Ga0070715_10000203 3300006163 Bacteria 14026
94 Ga0070715_10002247 3300006163 Bacteria 5865
95 Ga0070715_10310093 3300006163 Bacteria 847
96 Ga0070716_100006051 3300006173 Bacteria 5896
97 Ga0070712_100005078 3300006175 Bacteria 8150
98 Ga0070712_100035729 3300006175 Bacteria 3374
99 Ga0070712_100066255 3300006175 Bacteria 2566
100 Ga0075362_10037364 3300006177 Bacteria 2129
101 Ga0075366_10112871 3300006195 Bacteria 1636
102 Ga0097621_100006692 3300006237 Bacteria 8191
103 Ga0097621_100016992 3300006237 Bacteria 5516
104 Ga0068871_100039712 3300006358 Bacteria 3767
105 Ga0075428_100017242 3300006844 Bacteria 7980
106 Ga0075428_100020400 3300006844 Bacteria 7337
107 Ga0075430_100104284 3300006846 Bacteria 2367
108 Ga0075431_100080982 3300006847 Bacteria 3352
109 Ga0075433_10079928 3300006852 Bacteria 2881
110 Ga0075433_10114381 3300006852 Bacteria 2394
111 Ga0075433_10710862 3300006852 Bacteria 880
112 Ga0075434_100112550 3300006871 Bacteria 2733
113 Ga0075434_100252522 3300006871 Bacteria 1783
114 Ga0075434_100259292 3300006871 Bacteria 1757
115 Ga0075434_100322431 3300006871 Bacteria 1565
116 Ga0075434_101020909 3300006871 Bacteria 841
117 Ga0075429_100210257 3300006880 Bacteria 1705
118 Ga0075429_100283937 3300006880 Bacteria 1450
119 Ga0068865_100011327 3300006881 Bacteria 5577
120 Ga0068865_100017749 3300006881 Bacteria 4581
121 Ga0075436_100002344 3300006914 Bacteria 13073
122 Ga0097620_100059082 3300006931 Bacteria 3863
123 Ga0097620_100318782 3300006931 Bacteria 1648
124 Ga0075435_100012672 3300007076 Bacteria 6248
125 Ga0075435_100095670 3300007076 Bacteria 2456
126 Ga0075435_100278880 3300007076 Bacteria 1426
127 Ga0075435_100310463 3300007076 Bacteria 1349
128 Ga0099794_10003283 3300007265 Bacteria 6142
129 Ga0111539_10064458 3300009094 Bacteria 4334
130 Ga0111539_10067749 3300009094 Bacteria 4215
131 Ga0111539_10452251 3300009094 Bacteria 1495
132 Ga0111539_11309026 3300009094 Bacteria 841
133 Ga0114129_10008754 3300009147 Bacteria 14432
134 Ga0114129_10068107 3300009147 Bacteria 4964
135 Ga0114129_10159677 3300009147 Bacteria 3081
136 Ga0114129_10606690 3300009147 Bacteria 1417
137 Ga0105242_10229713 3300009176 Bacteria 1662
138 Ga0105248_10036199 3300009177 Bacteria 5520
139 Ga0105248_10629003 3300009177 Bacteria 1211
140 Ga0105237_10135894 3300009545 Bacteria 2453
141 Ga0105249_10115886 3300009553 Bacteria 2539
142 Ga0099796_10003927 3300010159 Bacteria 3525
143 Ga0105239_10042154 3300010375 Bacteria 5001
144 Ga0105246_10036956 3300011119 Bacteria 3275
145 Ga0157374_10021435 3300013296 Bacteria 5750
146 Ga0163162_10246893 3300013306 Bacteria 1916
147 Ga0157375_10095158 3300013308 Bacteria 3048
148 Ga0163163_10466079 3300014325 Bacteria 1324
149 Ga0157377_10040950 3300014745 Bacteria 2567
150 Ga0157379_10050742 3300014968 Bacteria 3704
151 Ga0157379_10523613 3300014968 Bacteria 1101
152 Ga0163161_10002983 3300017792 Bacteria 11972
153 Ga0163161_10025619 3300017792 Bacteria 4175
154 Ga0213872_10035266 3300021361 Bacteria 2288
155 Ga0213871_10001852 3300021441 Bacteria 3715
156 Ga0207697_10046577 3300025315 Bacteria 1786
157 Ga0207656_10034755 3300025321 Bacteria 2106
158 Ga0207696_1043757 3300025711 Bacteria 1301
159 Ga0207713_1038766 3300025735 Bacteria 2018
160 Ga0207653_10005500 3300025885 Bacteria 3957
161 Ga0207682_10038733 3300025893 Bacteria 1935
162 Ga0207692_10006862 3300025898 Bacteria 4637
163 Ga0207692_10063618 3300025898 Bacteria 1918
164 Ga0207642_10072212 3300025899 Bacteria 1646
165 Ga0207710_10001202 3300025900 Bacteria 13135
166 Ga0207710_10017123 3300025900 Bacteria 3072
167 Ga0207688_10001345 3300025901 Bacteria 12776
168 Ga0207688_10002752 3300025901 Bacteria 9525
169 Ga0207647_10017543 3300025904 Bacteria 4865
170 Ga0207647_10040187 3300025904 Bacteria 2947
171 Ga0207685_10004753 3300025905 Bacteria 3496
172 Ga0207685_10012870 3300025905 Bacteria 2569
173 Ga0207699_10001557 3300025906 Bacteria 10863
174 Ga0207699_10030419 3300025906 Bacteria 3021
175 Ga0207645_10004435 3300025907 Bacteria 10391
176 Ga0207645_10023479 3300025907 Bacteria 4008
177 Ga0207643_10000750 3300025908 Bacteria 19910
178 Ga0207705_10217105 3300025909 Bacteria 1451
179 Ga0207684_10008184 3300025910 Bacteria 9315
180 Ga0207654_10119506 3300025911 Bacteria 1652
181 Ga0207654_10151745 3300025911 Bacteria 1488
182 Ga0207695_10068534 3300025913 Bacteria 3635
183 Ga0207671_10108564 3300025914 Bacteria 2109
184 Ga0207693_10005223 3300025915 Bacteria 10868
185 Ga0207693_10095823 3300025915 Bacteria 2326
186 Ga0207693_10097939 3300025915 Bacteria 2300
187 Ga0207663_10003498 3300025916 Bacteria 7693
188 Ga0207663_10006389 3300025916 Bacteria 6027
189 Ga0207663_10070082 3300025916 Bacteria 2258
190 Ga0207660_10046989 3300025917 Bacteria 3049
191 Ga0207660_10232464 3300025917 Bacteria 1450
192 Ga0207662_10002418 3300025918 Bacteria 9366
193 Ga0207662_10023034 3300025918 Bacteria 3575
194 Ga0207657_10003835 3300025919 Bacteria 15968
195 Ga0207657_10094452 3300025919 Bacteria 2490
196 Ga0207649_10003152 3300025920 Bacteria 9048
197 Ga0207649_10139802 3300025920 Bacteria 1655
198 Ga0207652_10027493 3300025921 Bacteria 4740
199 Ga0207646_10757844 3300025922 Bacteria 866
200 Ga0207681_10108110 3300025923 Bacteria 2018
201 Ga0207694_10058406 3300025924 Bacteria 3000
202 Ga0207650_10012576 3300025925 Bacteria 5840
203 Ga0207650_10138989 3300025925 Bacteria 1908
204 Ga0207659_10020443 3300025926 Bacteria 4377
205 Ga0207659_10046810 3300025926 Bacteria 3057
206 Ga0207687_10020214 3300025927 Bacteria 4416
207 Ga0207700_10013858 3300025928 Bacteria 5264
208 Ga0207700_10741984 3300025928 Bacteria 877
209 Ga0207664_10145669 3300025929 Bacteria 2008
210 Ga0207664_10470312 3300025929 Bacteria 1124
211 Ga0207644_10037120 3300025931 Bacteria 3425
212 Ga0207690_10009054 3300025932 Bacteria 5910
213 Ga0207690_10145115 3300025932 Bacteria 1754
214 Ga0207706_10001078 3300025933 Bacteria 27712
215 Ga0207706_10002911 3300025933 Bacteria 16546
216 Ga0207686_10015957 3300025934 Bacteria 4209
217 Ga0207686_10168240 3300025934 Bacteria 1543
218 Ga0207709_10009042 3300025935 Bacteria 5494
219 Ga0207670_10007663 3300025936 Bacteria 6044
220 Ga0207670_10009362 3300025936 Bacteria 5589
221 Ga0207669_10001552 3300025937 Bacteria 9798
222 Ga0207669_10021451 3300025937 Bacteria 3411
223 Ga0207704_10009372 3300025938 Bacteria 4722
224 Ga0207665_10001180 3300025939 Bacteria 17576
225 Ga0207665_10001996 3300025939 Bacteria 13762
226 Ga0207691_10004872 3300025940 Bacteria 12977
227 Ga0207689_10037017 3300025942 Bacteria 4049
228 Ga0207689_10058165 3300025942 Bacteria 3180
229 Ga0207661_10022637 3300025944 Bacteria 4737
230 Ga0207679_10089686 3300025945 Bacteria 2374
231 Ga0207651_10002394 3300025960 Bacteria 8962
232 Ga0207651_10108148 3300025960 Bacteria 2080
233 Ga0207668_10002032 3300025972 Bacteria 11805
234 Ga0207668_10237210 3300025972 Bacteria 1473
235 Ga0207640_10023509 3300025981 Bacteria 3704
236 Ga0207658_10027526 3300025986 Bacteria 3994
237 Ga0207677_10042377 3300026023 Bacteria 3017
238 Ga0207703_10015897 3300026035 Bacteria 5870
239 Ga0207703_10048696 3300026035 Bacteria 3422
240 Ga0207639_10020231 3300026041 Bacteria 4760
241 Ga0207678_10015782 3300026067 Bacteria 6639
242 Ga0207708_10001622 3300026075 Bacteria 16749
243 Ga0207708_10009969 3300026075 Bacteria 7056
244 Ga0207702_10066360 3300026078 Bacteria 3093
245 Ga0207641_10054003 3300026088 Bacteria 3407
246 Ga0207641_10088186 3300026088 Bacteria 2708
247 Ga0207648_10033651 3300026089 Bacteria 4520
248 Ga0207648_10044775 3300026089 Bacteria 3883
249 Ga0207674_10008742 3300026116 Bacteria 11660
250 Ga0207674_10121416 3300026116 Bacteria 2580
251 Ga0207675_100001067 3300026118 Bacteria 27209
252 Ga0207683_10002117 3300026121 Bacteria 17453
253 Ga0209179_1000404 3300027512 Bacteria 4278
254 Ga0209588_1014639 3300027671 Bacteria 2404
255 Ga0209813_10050145 3300027866 Bacteria 1301
256 Ga0265357_1002324 3300028023 Bacteria 1540
257 Ga0268265_10105201 3300028380 Bacteria 2289
258 Ga0268264_10016748 3300028381 Bacteria 5999
259 Ga0268264_10207998 3300028381 Bacteria 1794
260 Ga0265760_10086216 3300031090 Bacteria 978
261 Ga0307513_10038687 3300031456 Bacteria 5295
262 Ga0307513_10048268 3300031456 Bacteria 4622
263 Ga0373949_0158380 3300035090 Bacteria 659
264 Ga0373946_0078645 3300035171 Bacteria 1439
265 Ga0373961_0050827 3300035241 Bacteria 1229
266 Ga0373931_0072971 3300035691 Bacteria 1878
267 Ga0373933_0207759 3300035724 Bacteria 1254
268 Ga0373947_0038993 3300035725 Bacteria 2825
269 Ga0373937_0016077 3300036401 Bacteria 6638
270 Ga0373925_0069024 3300037068 Bacteria 2669
271 Ga0373925_0204463 3300037068 Bacteria 1571
272 Ga0395900_0102645 3300037418 Bacteria 2938
273 Ga0395905_0218966 3300037471 Bacteria 1782
274 Ga0395905_0746085 3300037471 Bacteria 881
275 Ga0395901_0042447 3300038443 Bacteria 4715
276 Ga0436360_0146478 3300039438 Bacteria 7456
277 Ga0436360_0305642 3300039438 Bacteria 1382
278 Ga0436360_0615984 3300039438 Bacteria 1235
279 Ga0436361_0245609 3300039447 Bacteria 3488
280 Ga0436361_0700410 3300039447 Bacteria 3018
281 Ga0451800_0940567 3300041459 Bacteria 1310
282 Ga0439460_0113990 3300042461 Bacteria 879
283 Ga0495590_0140217 3300046457 Bacteria 872
284 Ga0495591_073099 3300046458 Bacteria 887
285 Ga0495638_0003334 3300046460 Bacteria 12666
286 Ga0495638_0138946 3300046460 Bacteria 1420
287 Ga0495641_0017453 3300046461 Bacteria 3740
288 Ga0495580_0204949 3300046472 Bacteria 1358
289 Ga0495580_0322466 3300046472 Bacteria 1050
290 Ga0495582_0022939 3300046473 Bacteria 3414
291 Ga0495639_0024401 3300046475 Bacteria 2662
292 Ga0495662_0237072 3300046476 Bacteria 899
293 Ga0495584_0029126 3300046491 Bacteria 2798
294 Ga0495596_0033286 3300046500 Bacteria 2051
295 Ga0495618_0060286 3300046514 Bacteria 2406
296 Ga0495630_0582571 3300046517 Bacteria 858
297 Ga0495637_0106665 3300046520 Bacteria 1090
298 Ga0495652_0179587 3300046529 Bacteria 1626
299 Ga0495652_0525637 3300046529 Bacteria 817
300 Ga0495656_0217187 3300046615 Bacteria 955
301 Ga0495611_0072597 3300046648 Bacteria 1575
302 Ga0495661_0198572 3300046665 Bacteria 1052
303 Ga0495588_0016679 3300046674 Bacteria 3553
304 Ga0495658_0119589 3300046683 Bacteria 1592
305 Ga0495658_0177198 3300046683 Bacteria 1321
306 Ga0495669_0027907 3300046684 Bacteria 2470
307 Ga0495613_0155331 3300046689 Bacteria 1630
308 Ga0495624_0010104 3300046690 Bacteria 6507
309 Ga0495674_0432763 3300047319 Bacteria 1059
310 Ga0495676_0201141 3300047321 Bacteria 1384
311 Ga0495684_0066670 3300047471 Bacteria 2737
312 Ga0495602_0101834 3300048088 Bacteria 2355
313 Ga0495614_0214238 3300048089 Bacteria 874
314 Ga0495615_0015777 3300048090 Bacteria 1619
315 Ga0496100_0561973 3300048903 Bacteria 883
316 Ga0496101_0280746 3300048904 Bacteria 1302
317 Ga0496101_0356940 3300048904 Bacteria 1149
318 Ga0496102_0018562 3300048905 Bacteria 6114
319 Ga0496102_0293913 3300048905 Bacteria 1531
320 Ga0496103_0013665 3300048906 Bacteria 4816
321 Ga0496103_0072207 3300048906 Bacteria 2161
322 Ga0496104_0041346 3300048907 Bacteria 4322
323 Ga0496104_0042572 3300048907 Bacteria 4262
324 Ga0496105_0055925 3300048908 Bacteria 3257
325 Ga0496105_0700864 3300048908 Bacteria 777
326 Ga0496106_0007868 3300048909 Bacteria 7883
327 Ga0496107_0463736 3300048910 Bacteria 940
328 Ga0496108_0004957 3300048911 Bacteria 10756
329 Ga0496108_0020229 3300048911 Bacteria 5469
330 Ga0496109_0022417 3300048912 Bacteria 5592
331 Ga0496109_0039123 3300048912 Bacteria 4291
332 Ga0496110_0008792 3300048913 Bacteria 8138
333 Ga0496110_0080248 3300048913 Bacteria 2907
334 Ga0496110_0276979 3300048913 Bacteria 1527
335 Ga0496111_0008035 3300048914 Bacteria 6959
336 Ga0496111_0015465 3300048914 Bacteria 5240
337 Ga0496112_0056412 3300048915 Bacteria 3865
338 Ga0496112_0293522 3300048915 Bacteria 1571
339 Ga0496113_0004566 3300048916 Bacteria 8529
340 Ga0496113_0203095 3300048916 Bacteria 1575
341 Ga0496115_0028387 3300048918 Bacteria 4385
342 Ga0496115_0069615 3300048918 Bacteria 2850
343 Ga0496118_0187005 3300048921 Bacteria 1244
344 Ga0496119_0000996 3300048922 Bacteria 36307
345 Ga0496126_0225801 3300048929 Bacteria 1571
346 Ga0501034_0384995 3300049571 Bacteria 1327
347 Ga0501034_0625052 3300049571 Bacteria 981
348 Ga0501038_0195305 3300049574 Bacteria 1627
349 Ga0501048_0728174 3300049582 Bacteria 712
350 Ga0501075_0388937 3300049591 Bacteria 1063
351 Ga0501076_0110962 3300049592 Bacteria 2217
352 Ga0501079_0686703 3300049741 Bacteria 806
353 Ga0501081_0386710 3300049743 Bacteria 1034
354 Ga0501083_0087963 3300049744 Bacteria 2054
355 nmdc:mga03n38_195144_c1 3300050490 Bacteria 1045
356 nmdc:mga03n38_406004_c1 3300050490 Bacteria 751
357 nmdc:mga00v17_124048_c1 3300050491 Bacteria 1647
358 nmdc:mga0yw44_254802_c1 3300050492 Bacteria 1169
359 nmdc:mga0yw44_61102_c1 3300050492 Bacteria 2310
360 nmdc:mga0yw44_63903_c1 3300050492 Bacteria 2264
361 nmdc:mga0yw44_96855_c1 3300050492 Bacteria 1874
362 nmdc:mga04h51_173239_c1 3300050495 Bacteria 836
363 nmdc:mga04h51_59957_c1 3300050495 Bacteria 1301
364 nmdc:mga05p37_102460_c1 3300050507 Bacteria 3525
365 nmdc:mga05p37_11064_c1 3300050507 Bacteria 10720
366 nmdc:mga05p37_217860_c1 3300050507 Bacteria 2305
367 nmdc:mga05p37_8484_c1 3300050507 Bacteria 12148
368 nmdc:mga09592_153044_c1 3300050508 Bacteria 1990
369 nmdc:mga09592_52896_c1 3300050508 Bacteria 3427
370 nmdc:mga0qj67_54807_c1 3300050509 Bacteria 3157
371 nmdc:mga06r32_19103_c1 3300050510 Bacteria 6286
372 nmdc:mga06r32_895525_c1 3300050510 Bacteria 844
373 nmdc:mga08y16_327647_c1 3300050511 Bacteria 1576
374 nmdc:mga0n895_393901_c1 3300050512 Bacteria 1401
375 nmdc:mga0n895_530096_c1 3300050512 Bacteria 1185
376 nmdc:mga0n895_612633_c1 3300050512 Bacteria 1090
377 nmdc:mga0n895_824653_c1 3300050512 Bacteria 917
378 nmdc:mga0rr50_271163_c1 3300050513 Bacteria 1414
379 nmdc:mga0rr50_70339_c1 3300050513 Bacteria 2666
380 Ga0495601_0124736 3300053077 Bacteria 1675
381 Ga0495619_0003120 3300053085 Bacteria 10750
382 Ga0495619_0295875 3300053085 Bacteria 1121
383 Ga0500578_0355517 3300053086 Bacteria 855
384 Ga0500556_0000017 3300053104 Bacteria 192495
385 Ga0500577_0097712 3300053142 Bacteria 1196
386 Ga0501084_0578530 3300054114 Bacteria 949
387 Ga0501082_0321938 3300060353 Bacteria 1347
388 2828306734 2828305725 Bacteria 4916900
389 2919452821 2919450847 Bacteria 5631160
390 8001846825 8001845381 Bacteria 5804942
391 Ga0501074_0512443
392 JGI24034J26672_10001450
393 JGI24742J22300_10003012
394 JGI24751J29686_10031079
395 JGI25406J46586_10013497
396 Ga0070676_10019465
397 Ga0070670_100002853
398 Ga0070670_100081488
399 Ga0070670_100100925
400 Ga0070680_101000493
401 Ga0068868_100112284
402 Ga0070689_100021364
403 Ga0070687_100006296
404 Ga0070661_100035590
405 Ga0070668_100063245
406 Ga0070669_100320410
407 Ga0070675_100012297
408 Ga0070671_100257611
409 Ga0070674_100023528
410 Ga0070673_100022561
411 Ga0070688_100060529
412 Ga0070659_100300261
413 Ga0070667_100076927
414 Ga0070709_10011428
415 Ga0070714_100045930
416 Ga0070714_100144360
417 Ga0070713_100063180
418 Ga0070713_100160594
419 Ga0070713_100384771
420 Ga0070710_10007221
421 Ga0070710_10039947
422 Ga0070711_100005882
423 Ga0070711_100228989
424 Ga0070705_100183155
425 Ga0070700_100029428
426 Ga0070694_100079053
427 Ga0070708_100156003
428 Ga0070663_100117743
429 Ga0070662_100022697
430 Ga0070685_10023181
431 Ga0070706_100636149
432 Ga0070698_100300488
433 Ga0070698_100537729
434 Ga0070699_100005520
435 Ga0070679_100664178
436 Ga0070684_100048822
437 Ga0070697_100471517
438 Ga0068853_100411960
439 Ga0070672_100414916
440 Ga0070686_100024642
441 Ga0070665_100010892
442 Ga0070704_100045717
443 Ga0068855_100060533
444 Ga0070664_100009952
445 Ga0070664_100354981
446 Ga0068857_100019106
447 Ga0068857_100172067
448 Ga0068854_100008792
449 Ga0068854_100322830
450 Ga0068856_100350671
451 Ga0070702_100005999
452 Ga0068859_100059082
453 Ga0068859_100318789
454 Ga0068864_100001766
455 Ga0068864_100019179
456 Ga0068866_10003097
457 Ga0068866_10003845
458 Ga0068861_100009246
459 Ga0068861_100271636
460 Ga0068851_10042290
461 Ga0068870_10004572
462 Ga0068863_100013628
463 Ga0068863_100022280
464 Ga0068858_100478728
465 Ga0068860_100026926
466 Ga0068860_100034149
467 Ga0068862_100004757
468 Ga0068862_100043864
469 Ga0081455_10004222
470 Ga0081538_10189200
471 Ga0081540_1000055
472 Ga0081540_1029573
473 Ga0070717_10022618
474 Ga0070717_10586520
475 Ga0075365_10042524
476 Ga0075365_10237357
477 Ga0075365_10245777
478 Ga0075365_10311296
479 Ga0075368_10083570
480 Ga0075363_100289719
481 Ga0075363_100324885
482 Ga0075364_10156989
483 Ga0070715_10000203
484 Ga0070715_10002247
485 Ga0070715_10310093
486 Ga0070716_100006051
487 Ga0070712_100005078
488 Ga0070712_100035729
489 Ga0070712_100066255
490 Ga0075362_10037364
491 Ga0075366_10112871
492 Ga0097621_100006692
493 Ga0097621_100016992
494 Ga0068871_100039712
495 Ga0075428_100017242
496 Ga0075428_100020400
497 Ga0075430_100104284
498 Ga0075431_100080982
499 Ga0075433_10079928
500 Ga0075433_10114381
501 Ga0075433_10710862
502 Ga0075434_100112550
503 Ga0075434_100252522
504 Ga0075434_100259292
505 Ga0075434_100322431
506 Ga0075434_101020909
507 Ga0075429_100210257
508 Ga0075429_100283937
509 Ga0068865_100011327
510 Ga0068865_100017749
511 Ga0075436_100002344
512 Ga0097620_100059082
513 Ga0097620_100318782
514 Ga0075435_100012672
515 Ga0075435_100095670
516 Ga0075435_100278880
517 Ga0075435_100310463
518 Ga0099794_10003283
519 Ga0111539_10064458
520 Ga0111539_10067749
521 Ga0111539_10452251
522 Ga0111539_11309026
523 Ga0114129_10008754
524 Ga0114129_10068107
525 Ga0114129_10159677
526 Ga0114129_10606690
527 Ga0105242_10229713
528 Ga0105248_10036199
529 Ga0105248_10629003
530 Ga0105237_10135894
531 Ga0105249_10115886
532 Ga0099796_10003927
533 Ga0105239_10042154
534 Ga0105246_10036956
535 Ga0157374_10021435
536 Ga0163162_10246893
537 Ga0157375_10095158
538 Ga0163163_10466079
539 Ga0157377_10040950
540 Ga0157379_10050742
541 Ga0157379_10523613
542 Ga0163161_10002983
543 Ga0163161_10025619
544 Ga0213872_10035266
545 Ga0213871_10001852
546 Ga0207697_10046577
547 Ga0207656_10034755
548 Ga0207696_1043757
549 Ga0207713_1038766
550 Ga0207653_10005500
551 Ga0207682_10038733
552 Ga0207692_10006862
553 Ga0207692_10063618
554 Ga0207642_10072212
555 Ga0207710_10001202
556 Ga0207710_10017123
557 Ga0207688_10001345
558 Ga0207688_10002752
559 Ga0207647_10017543
560 Ga0207647_10040187
561 Ga0207685_10004753
562 Ga0207685_10012870
563 Ga0207699_10001557
564 Ga0207699_10030419
565 Ga0207645_10004435
566 Ga0207645_10023479
567 Ga0207643_10000750
568 Ga0207705_10217105
569 Ga0207684_10008184
570 Ga0207654_10119506
571 Ga0207654_10151745
572 Ga0207695_10068534
573 Ga0207671_10108564
574 Ga0207693_10005223
575 Ga0207693_10095823
576 Ga0207693_10097939
577 Ga0207663_10003498
578 Ga0207663_10006389
579 Ga0207663_10070082
580 Ga0207660_10046989
581 Ga0207660_10232464
582 Ga0207662_10002418
583 Ga0207662_10023034
584 Ga0207657_10003835
585 Ga0207657_10094452
586 Ga0207649_10003152
587 Ga0207649_10139802
588 Ga0207652_10027493
589 Ga0207646_10757844
590 Ga0207681_10108110
591 Ga0207694_10058406
592 Ga0207650_10012576
593 Ga0207650_10138989
594 Ga0207659_10020443
595 Ga0207659_10046810
596 Ga0207687_10020214
597 Ga0207700_10013858
598 Ga0207700_10741984
599 Ga0207664_10145669
600 Ga0207664_10470312
601 Ga0207644_10037120
602 Ga0207690_10009054
603 Ga0207690_10145115
604 Ga0207706_10001078
605 Ga0207706_10002911
606 Ga0207686_10015957
607 Ga0207686_10168240
608 Ga0207709_10009042
609 Ga0207670_10007663
610 Ga0207670_10009362
611 Ga0207669_10001552
612 Ga0207669_10021451
613 Ga0207704_10009372
614 Ga0207665_10001180
615 Ga0207665_10001996
616 Ga0207691_10004872
617 Ga0207689_10037017
618 Ga0207689_10058165
619 Ga0207661_10022637
620 Ga0207679_10089686
621 Ga0207651_10002394
622 Ga0207651_10108148
623 Ga0207668_10002032
624 Ga0207668_10237210
625 Ga0207640_10023509
626 Ga0207658_10027526
627 Ga0207677_10042377
628 Ga0207703_10015897
629 Ga0207703_10048696
630 Ga0207639_10020231
631 Ga0207678_10015782
632 Ga0207708_10001622
633 Ga0207708_10009969
634 Ga0207702_10066360
635 Ga0207641_10054003
636 Ga0207641_10088186
637 Ga0207648_10033651
638 Ga0207648_10044775
639 Ga0207674_10008742
640 Ga0207674_10121416
641 Ga0207675_100001067
642 Ga0207683_10002117
643 Ga0209179_1000404
644 Ga0209588_1014639
645 Ga0209813_10050145
646 Ga0265357_1002324
647 Ga0268265_10105201
648 Ga0268264_10016748
649 Ga0268264_10207998
650 Ga0265760_10086216
651 Ga0307513_10038687
652 Ga0307513_10048268
653 Ga0373949_0158380
654 Ga0373946_0078645
655 Ga0373961_0050827
656 Ga0373931_0072971
657 Ga0373933_0207759
658 Ga0373947_0038993
659 Ga0373937_0016077
660 Ga0373925_0069024
661 Ga0373925_0204463
662 Ga0395900_0102645
663 Ga0395905_0218966
664 Ga0395905_0746085
665 Ga0395901_0042447
666 Ga0436360_0146478
667 Ga0436360_0305642
668 Ga0436360_0615984
669 Ga0436361_0245609
670 Ga0436361_0700410
671 Ga0451800_0940567
672 Ga0439460_0113990
673 Ga0495590_0140217
674 Ga0495591_073099
675 Ga0495638_0003334
676 Ga0495638_0138946
677 Ga0495641_0017453
678 Ga0495580_0204949
679 Ga0495580_0322466
680 Ga0495582_0022939
681 Ga0495639_0024401
682 Ga0495662_0237072
683 Ga0495584_0029126
684 Ga0495596_0033286
685 Ga0495618_0060286
686 Ga0495630_0582571
687 Ga0495637_0106665
688 Ga0495652_0179587
689 Ga0495652_0525637
690 Ga0495656_0217187
691 Ga0495611_0072597
692 Ga0495661_0198572
693 Ga0495588_0016679
694 Ga0495658_0119589
695 Ga0495658_0177198
696 Ga0495669_0027907
697 Ga0495613_0155331
698 Ga0495624_0010104
699 Ga0495674_0432763
700 Ga0495676_0201141
701 Ga0495684_0066670
702 Ga0495602_0101834
703 Ga0495614_0214238
704 Ga0495615_0015777
705 Ga0496100_0561973
706 Ga0496101_0280746
707 Ga0496101_0356940
708 Ga0496102_0018562
709 Ga0496102_0293913
710 Ga0496103_0013665
711 Ga0496103_0072207
712 Ga0496104_0041346
713 Ga0496104_0042572
714 Ga0496105_0055925
715 Ga0496105_0700864
716 Ga0496106_0007868
717 Ga0496107_0463736
718 Ga0496108_0004957
719 Ga0496108_0020229
720 Ga0496109_0022417
721 Ga0496109_0039123
722 Ga0496110_0008792
723 Ga0496110_0080248
724 Ga0496110_0276979
725 Ga0496111_0008035
726 Ga0496111_0015465
727 Ga0496112_0056412
728 Ga0496112_0293522
729 Ga0496113_0004566
730 Ga0496113_0203095
731 Ga0496115_0028387
732 Ga0496115_0069615
733 Ga0496118_0187005
734 Ga0496119_0000996
735 Ga0496126_0225801
736 Ga0501034_0384995
737 Ga0501034_0625052
738 Ga0501038_0195305
739 Ga0501048_0728174
740 Ga0501075_0388937
741 Ga0501076_0110962
742 Ga0501079_0686703
743 Ga0501081_0386710
744 Ga0501083_0087963
745 nmdc:mga03n38_195144_c1
746 nmdc:mga03n38_406004_c1
747 nmdc:mga00v17_124048_c1
748 nmdc:mga0yw44_254802_c1
749 nmdc:mga0yw44_61102_c1
750 nmdc:mga0yw44_63903_c1
751 nmdc:mga0yw44_96855_c1
752 nmdc:mga04h51_173239_c1
753 nmdc:mga04h51_59957_c1
754 nmdc:mga05p37_102460_c1
755 nmdc:mga05p37_11064_c1
756 nmdc:mga05p37_217860_c1
757 nmdc:mga05p37_8484_c1
758 nmdc:mga09592_153044_c1
759 nmdc:mga09592_52896_c1
760 nmdc:mga0qj67_54807_c1
761 nmdc:mga06r32_19103_c1
762 nmdc:mga06r32_895525_c1
763 nmdc:mga08y16_327647_c1
764 nmdc:mga0n895_393901_c1
765 nmdc:mga0n895_530096_c1
766 nmdc:mga0n895_612633_c1
767 nmdc:mga0n895_824653_c1
768 nmdc:mga0rr50_271163_c1
769 nmdc:mga0rr50_70339_c1
770 Ga0495601_0124736
771 Ga0495619_0003120
772 Ga0495619_0295875
773 Ga0500578_0355517
774 Ga0500556_0000017
775 Ga0500577_0097712
776 Ga0501084_0578530
777 Ga0501082_0321938
778 2828306734
779 2919452821
780 8001846825

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13532

2OG-FeII_Oxy_2

2OG-Fe(II) oxygenase superfamily

45

236

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o1p-assembly1.cif.gz_A iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase 0.9275 7 204
4zhn-assembly1.cif.gz_A crystal structure of alkb t208a mutant protein in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t 0.9243 6 204
3bkz-assembly1.cif.gz_A x-ray structure of e coli alkb crosslinked to dsdna in the active site 0.9192 7 204
2fdf-assembly1.cif.gz_A crystal structure of alkb in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t 0.919 6 202
3khc-assembly1.cif.gz_B crystal structure of escherichia coli alkb in complex with ssdna containing a 1-methylguanine lesion 0.9177 6 205
ID Description Score Start End Superfamily
af_Q13686_178_346_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9168 102 202 2.60.120.590
4niiA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8985 4 202 2.60.120.590
4niiA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8814 4 202 2.60.120.590
af_C6TKW1_99_311_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8691 9 201 2.60.120.590
af_A0A1Q0YC58_8_168_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8454 72 202 2.60.120.590
ID Description Score Start End GO Terms
AF-A0A857D9C6-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB-like domain-containing protein 1.002 17 84
AF-A0A526TB59-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 1 103 185 GO:0005737
GO:0006281
GO:0008198
GO:0035513
GO:0035515
GO:0035516
AF-B9JG61-F1-model_v4 Alkylated DNA repair protein AlkB 0.9981 26 204 GO:0005737
GO:0006281
GO:0008198
GO:0035513
GO:0035515
GO:0035516
AF-A0A528G153-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9978 90 182 GO:0005737
GO:0006281
GO:0008198
GO:0035513
GO:0035515
GO:0035516
AF-A0A537QCU7-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9971 49 205 GO:0005737
GO:0006281
GO:0008198
GO:0035513
GO:0035515
GO:0035516

Map