F431835

General Info

Members Datasets Scaffolds Average Seq Length
390 236 313 323

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0100902|Ga0496119_0100902_56_1147
Length 363
Sequence MSTFRDDPSQDAVLHHQRLVHRAHIPRCSEHSQLMDASMRAALYSAFGDPATVLAIADVALPEPGPGEVRIRTTLASIHNHDLLTVRGLYGYKPTLPAVGGSEALGVVDALGEGVEGLQVGQRVAAASVHATWAEAFIAPARMVIPMPDAIADETAAQLIAMPLSALMLLEFLKAEAGQWIVQNTANGAVGKSLAMLARARGVNVANLVRNAKAVAQLQALGIEHVFDTSQDGWKDRVRAATGEAQAAAAVDSIGGEASADLVDLLGLHGTLVSFGVMSGEAMRIPASGLIYKEATVKGFWGSKVSQAMAVEDKRRLVGELLQRAASGELTLPVDGIFALDDIKAAATASAQSGRGGKVLLRV

Samples

Sample ID Description Type Environment
1 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
2 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
5 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
6 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
7 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
8 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
9 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
10 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
11 2643221609 Acidovorax sp. Root217 Isolate Unclassified
12 2643221611 Acidovorax sp. Root219 Isolate Unclassified
13 2643221616 Leifsonia sp. Root227 Isolate Unclassified
14 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
15 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
16 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
17 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
18 2738543012 Acidovorax sp. CF301 Isolate Unclassified
19 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
20 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
21 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
22 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
23 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
24 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
25 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
26 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
27 2816332133 Acidovorax radicis 2721A Isolate Unclassified
28 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
29 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
30 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
31 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
32 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
33 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
34 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
35 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
36 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
37 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
38 2849560528 Caulobacter zeae 410 Isolate Unclassified
39 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
40 2851153111 Caulobacter radicis 736 Isolate Unclassified
41 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
42 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
43 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
44 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
45 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
46 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
47 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
48 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
49 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
50 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
51 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
52 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
53 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
54 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
55 2937967321 Serratia sp. YC16 Isolate Unclassified
56 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
57 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
58 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
59 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
60 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
61 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
62 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
63 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
64 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
65 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
66 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
67 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
68 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
69 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
70 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
71 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
72 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
73 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
74 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
75 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
76 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
77 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
78 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
79 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
80 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
81 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
82 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
83 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
84 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
85 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
86 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
87 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
88 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
89 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
90 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
91 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
92 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
93 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
94 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
95 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
96 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
97 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
98 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
99 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
128 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
160 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
161 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
173 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
174 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
178 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
194 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
195 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
228 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 640753048 Serratia proteamaculans 568 Isolate Endosphere
231 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
232 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
233 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
234 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
235 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
236 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.74
Metatranscriptomes 0.51
Isolates 19.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 21.28
Nodule 2.56
Rhizoplane 1.54
Rhizosphere 37.69
Stem 0
Stem Tuber 0.26
Unclassified 36.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002371 3300001979 Bacteria 8560
2 JGI24735J21928_10001264 3300002067 Bacteria 8977
3 JGI25155J39150_1000015 3300002704 Bacteria 178839
4 JGI25156J39149_1000007 3300002705 Bacteria 252108
5 JGI25162J39368_1000285 3300002737 Bacteria 47453
6 JGI25162J39368_1000352 3300002737 Bacteria 39535
7 JGI25154J39366_1000051 3300002738 Bacteria 123608
8 JGI25157J39369_1000012 3300002741 Bacteria 205167
9 JGI25164J39214_1001642 3300002772 Bacteria 4635
10 JGI25165J46597_1000044 3300003214 Bacteria 263289
11 JGI25165J46597_1000102 3300003214 Bacteria 155002
12 JGI25165J46597_1000198 3300003214 Bacteria 88888
13 JGI25165J46597_1009718 3300003214 Bacteria 1433
14 rootH2_10005095 3300003320 Bacteria 3047
15 rootH2_10006074 3300003320 Bacteria 25873
16 rootH2_10018251 3300003320 Bacteria 5352
17 rootL2_10016804 3300003322 Bacteria 37660
18 rootL2_10040301 3300003322 Bacteria 1549
19 rootH1_10035954 3300003323 Bacteria 3757
20 rootH1_10161001 3300003323 Bacteria 3733
21 Ga0006562J51391_1155457 3300003578 Bacteria 7338
22 Ga0006562J51391_1155458 3300003578 Bacteria 7340
23 Ga0055539_1000006 3300003752 Bacteria 580055
24 Ga0055532_1008773 3300003758 Bacteria 1248
25 Ga0055526_1000469 3300003771 Bacteria 32059
26 Ga0055537_1000413 3300003773 Bacteria 28000
27 Ga0055524_1015567 3300003775 Bacteria 2765
28 Ga0055524_1019393 3300003775 Bacteria 2326
29 Ga0055536_1000170 3300003781 Bacteria 54556
30 Ga0055536_1000250 3300003781 Bacteria 42542
31 Ga0055536_1004521 3300003781 Bacteria 7076
32 Ga0055534_1000115 3300003784 Bacteria 59000
33 Ga0055528_1000446 3300003790 Bacteria 33063
34 Ga0055528_1000625 3300003790 Bacteria 26244
35 Ga0055530_10000021 3300003791 Bacteria 139383
36 Ga0055530_10000071 3300003791 Bacteria 86290
37 Ga0055531_10000372 3300003794 Bacteria 43252
38 Ga0055531_10000495 3300003794 Bacteria 36044
39 Ga0055531_10014868 3300003794 Bacteria 3476
40 Ga0058692_1000007 3300003856 Bacteria 366313
41 Ga0058692_1000009 3300003856 Bacteria 349545
42 Ga0065165_1013635 3300005262 Bacteria 3216
43 Ga0065703_1000060 3300005272 Bacteria 38853
44 Ga0065703_1018760 3300005272 Bacteria 11110
45 Ga0070668_100034855 3300005347 Bacteria 3836
46 Ga0070669_100003016 3300005353 Bacteria 12124
47 Ga0070673_100023498 3300005364 Bacteria 4504
48 Ga0070665_100045003 3300005548 Bacteria 4431
49 Ga0070665_100313360 3300005548 Bacteria 1573
50 Ga0068858_100032697 3300005842 Bacteria 4830
51 Ga0075365_10051114 3300006038 Bacteria 2728
52 Ga0075363_100014814 3300006048 Bacteria 3821
53 Ga0075364_10000197 3300006051 Bacteria 27872
54 Ga0075364_10036430 3300006051 Bacteria 3180
55 Ga0075364_10065814 3300006051 Bacteria 2380
56 Ga0075364_10145534 3300006051 Bacteria 1595
57 Ga0075364_10273898 3300006051 Bacteria 1148
58 Ga0075362_10008046 3300006177 Bacteria 4017
59 Ga0075367_10004204 3300006178 Bacteria 6986
60 Ga0075369_10021871 3300006186 Bacteria 2633
61 Ga0075366_10001737 3300006195 Bacteria 10962
62 Ga0075366_10011715 3300006195 Bacteria 4956
63 Ga0075370_10048000 3300006353 Bacteria 2418
64 Ga0105251_10099625 3300009011 Bacteria 1329
65 Ga0105244_10013113 3300009036 Bacteria 4859
66 Ga0105240_10000216 3300009093 Bacteria 115800
67 Ga0105240_10005540 3300009093 Bacteria 18802
68 Ga0105240_10017970 3300009093 Bacteria 9513
69 Ga0105247_10005826 3300009101 Bacteria 7706
70 Ga0105247_10076153 3300009101 Bacteria 2106
71 Ga0105243_10001096 3300009148 Bacteria 24683
72 Ga0105243_10302348 3300009148 Bacteria 1450
73 Ga0105237_10018015 3300009545 Bacteria 7316
74 Ga0105239_10061979 3300010375 Bacteria 4105
75 Ga0105239_10200307 3300010375 Bacteria 2236
76 Ga0105246_10083592 3300011119 Bacteria 2282
77 Ga0157373_10069951 3300013100 Bacteria 2480
78 Ga0157373_10130301 3300013100 Bacteria 1769
79 Ga0157371_10000022 3300013102 Bacteria 295029
80 Ga0157371_10138359 3300013102 Bacteria 1734
81 Ga0157371_10175037 3300013102 Bacteria 1534
82 Ga0157370_10000183 3300013104 Bacteria 78649
83 Ga0157370_10056548 3300013104 Bacteria 3734
84 Ga0157369_10140589 3300013105 Bacteria 2554
85 Ga0182008_10000013 3300014497 Bacteria 286492
86 Ga0182008_10008528 3300014497 Bacteria 5596
87 Ga0182006_1028566 3300015261 Bacteria 2267
88 Ga0182006_1037548 3300015261 Bacteria 1919
89 Ga0182006_1052093 3300015261 Bacteria 1573
90 Ga0182007_10000004 3300015262 Bacteria 485875
91 Ga0182007_10001098 3300015262 Bacteria 14707
92 Ga0182005_1000296 3300015265 Bacteria 30742
93 Ga0182005_1001151 3300015265 Bacteria 10966
94 Ga0163161_10062663 3300017792 Bacteria 2709
95 Ga0163161_10115250 3300017792 Bacteria 2014
96 Ga0163161_10181689 3300017792 Bacteria 1613
97 Ga0209435_100006 3300025206 Bacteria 542459
98 Ga0209147_101287 3300025229 Bacteria 9744
99 Ga0207427_100126 3300025231 Bacteria 95170
100 Ga0209437_100042 3300025233 Bacteria 444095
101 Ga0209437_100062 3300025233 Bacteria 336900
102 Ga0209646_1000015 3300025246 Bacteria 542459
103 Ga0209026_1000046 3300025250 Bacteria 262031
104 Ga0209759_1000005 3300025256 Bacteria 542459
105 Ga0209233_1000014 3300025261 Bacteria 996641
106 Ga0209233_1000082 3300025261 Bacteria 336320
107 Ga0209233_1000103 3300025261 Bacteria 284123
108 Ga0209233_1000428 3300025261 Bacteria 30724
109 Ga0209565_1000024 3300025263 Bacteria 379907
110 Ga0209673_1000696 3300025273 Bacteria 47831
111 Ga0209130_1009148 3300025284 Bacteria 2853
112 Ga0209675_1000039 3300025291 Bacteria 247966
113 Ga0209676_1000011 3300025292 Bacteria 860463
114 Ga0209676_1000075 3300025292 Bacteria 303609
115 Ga0209676_1000536 3300025292 Bacteria 58911
116 Ga0209025_1067440 3300025294 Bacteria 1293
117 Ga0209564_1000188 3300025295 Bacteria 144251
118 Ga0209050_1000032 3300025298 Bacteria 456335
119 Ga0209050_1000069 3300025298 Bacteria 297615
120 Ga0209050_1011164 3300025298 Bacteria 4302
121 Ga0209050_1024473 3300025298 Bacteria 2087
122 Ga0209256_1008274 3300025299 Bacteria 4863
123 Ga0209051_1000593 3300025303 Bacteria 42781
124 Ga0209257_1000014 3300025304 Bacteria 946850
125 Ga0209257_1000571 3300025304 Bacteria 61995
126 Ga0209257_1000832 3300025304 Bacteria 44544
127 Ga0207655_1000479 3300025728 Bacteria 51538
128 Ga0207655_1002382 3300025728 Bacteria 15324
129 Ga0207655_1003870 3300025728 Bacteria 10893
130 Ga0207655_1044042 3300025728 Bacteria 1879
131 Ga0207713_1020223 3300025735 Bacteria 3232
132 Ga0207713_1026938 3300025735 Bacteria 2620
133 Ga0207713_1077404 3300025735 Bacteria 1208
134 Ga0207710_10000018 3300025900 Bacteria 346727
135 Ga0207710_10041815 3300025900 Bacteria 2033
136 Ga0207695_10000319 3300025913 Bacteria 116116
137 Ga0207695_10025926 3300025913 Bacteria 6551
138 Ga0207695_10048016 3300025913 Bacteria 4511
139 Ga0207671_10000078 3300025914 Bacteria 150705
140 Ga0207681_10005302 3300025923 Bacteria 7922
141 Ga0207664_10107089 3300025929 Bacteria 2319
142 Ga0207709_10000016 3300025935 Bacteria 478406
143 Ga0207651_10089997 3300025960 Bacteria 2242
144 Ga0207668_10071175 3300025972 Bacteria 2483
145 Ga0209371_1000023 3300027312 Bacteria 519553
146 Ga0209371_1000024 3300027312 Bacteria 477286
147 Ga0209371_1012344 3300027312 Bacteria 2479
148 Ga0268266_10055799 3300028379 Bacteria 3397
149 Ga0268266_10419573 3300028379 Bacteria 1268
150 Ga0307515_10000085 3300028794 Bacteria 220502
151 Ga0268256_1000023 3300030500 Bacteria 519631
152 Ga0268256_1000026 3300030500 Bacteria 477260
153 Ga0268256_1005042 3300030500 Bacteria 5292
154 Ga0316183_1106108 3300030742 Bacteria 2361
155 Ga0316181_1162508 3300030744 Bacteria 4541
156 Ga0307513_10033285 3300031456 Bacteria 5794
157 Ga0307508_10210076 3300031616 Bacteria 1547
158 Ga0307413_10022004 3300031824 Bacteria 3426
159 Ga0307412_10004441 3300031911 Bacteria 7812
160 Ga0307414_10005121 3300032004 Bacteria 7189
161 Ga0307414_10010573 3300032004 Bacteria 5365
162 Ga0307414_10126996 3300032004 Bacteria 1972
163 Ga0395900_0001829 3300037418 Bacteria 24258
164 Ga0395898_0000100 3300037466 Bacteria 226446
165 Ga0436360_1330529 3300039438 Bacteria 5949
166 Ga0436361_0504037 3300039447 Unclassified 2975
167 Ga0436362_0510554 3300039453 Bacteria 5485
168 Ga0439466_0004516 3300041411 Bacteria 5349
169 Ga0439432_003735 3300042006 Bacteria 5625
170 Ga0450911_003052 3300042115 Bacteria 3057
171 Ga0451577_0019533 3300042876 Bacteria 6230
172 Ga0466969_0020244 3300044656 Bacteria 3447
173 Ga0466972_0037751 3300044658 Bacteria 2361
174 Ga0466989_0089731 3300044663 Bacteria 1891
175 Ga0466965_0010777 3300044683 Bacteria 4276
176 Ga0466966_0033554 3300044684 Bacteria 3323
177 Ga0466966_0052721 3300044684 Bacteria 2583
178 Ga0466961_0032560 3300044693 Bacteria 3350
179 Ga0466961_0102778 3300044693 Bacteria 1799
180 Ga0466963_0008854 3300044694 Bacteria 6040
181 Ga0466971_0014757 3300044719 Bacteria 3438
182 Ga0466968_0082648 3300044735 Bacteria 1414
183 Ga0466970_0000711 3300044765 Bacteria 16299
184 Ga0466957_0009751 3300044842 Bacteria 5486
185 Ga0466958_0018744 3300045836 Bacteria 4021
186 Ga0466958_0250481 3300045836 Bacteria 1133
187 Ga0466967_0400562 3300045976 Bacteria 1335
188 Ga0495627_001258 3300046453 Bacteria 15653
189 Ga0495638_0000655 3300046460 Bacteria 37852
190 Ga0495580_0005082 3300046472 Bacteria 10960
191 Ga0495607_0038743 3300046501 Bacteria 2853
192 Ga0495610_0025655 3300046512 Bacteria 3158
193 Ga0495631_0000277 3300046518 Bacteria 35860
194 Ga0495632_0046972 3300046519 Bacteria 2143
195 Ga0495643_0003828 3300046522 Bacteria 10852
196 Ga0495663_0001017 3300046525 Bacteria 9265
197 Ga0495663_0002442 3300046525 Bacteria 5589
198 Ga0495663_0008262 3300046525 Bacteria 2882
199 Ga0495663_0010799 3300046525 Bacteria 2541
200 Ga0495652_0186275 3300046529 Bacteria 1588
201 Ga0495597_0000234 3300046542 Bacteria 50098
202 Ga0495633_0000866 3300046558 Bacteria 26260
203 Ga0495633_0000903 3300046558 Bacteria 25324
204 Ga0495633_0113372 3300046558 Bacteria 1257
205 Ga0495588_0001520 3300046674 Bacteria 9932
206 Ga0495660_0018442 3300046810 Bacteria 4012
207 Ga0495672_0000006 3300047320 Bacteria 589807
208 Ga0495686_0003185 3300047472 Bacteria 14453
209 Ga0496100_0003185 3300048903 Bacteria 8522
210 Ga0496102_0012542 3300048905 Bacteria 7338
211 Ga0496103_0015068 3300048906 Bacteria 4595
212 Ga0496105_0033781 3300048908 Bacteria 4203
213 Ga0496116_0003054 3300048919 Bacteria 16909
214 Ga0496116_0003524 3300048919 Bacteria 15408
215 Ga0496116_0005023 3300048919 Bacteria 12459
216 Ga0496116_0014694 3300048919 Bacteria 6237
217 Ga0496117_0000065 3300048920 Bacteria 254215
218 Ga0496117_0000594 3300048920 Bacteria 59522
219 Ga0496117_0004214 3300048920 Bacteria 16059
220 Ga0496117_0010304 3300048920 Bacteria 8546
221 Ga0496117_0011211 3300048920 Bacteria 8048
222 Ga0496117_0023569 3300048920 Bacteria 4899
223 Ga0496118_0000033 3300048921 Bacteria 326357
224 Ga0496118_0000056 3300048921 Bacteria 228660
225 Ga0496118_0000844 3300048921 Bacteria 48654
226 Ga0496118_0003583 3300048921 Bacteria 19336
227 Ga0496118_0012796 3300048921 Bacteria 8008
228 Ga0496118_0047582 3300048921 Bacteria 3322
229 Ga0496118_0080055 3300048921 Bacteria 2301
230 Ga0496118_0080475 3300048921 Bacteria 2293
231 Ga0496118_0172573 3300048921 Bacteria 1319
232 Ga0496119_0000358 3300048922 Bacteria 64104
233 Ga0496119_0005065 3300048922 Bacteria 12805
234 Ga0496119_0005626 3300048922 Bacteria 11914
235 Ga0496119_0100902 3300048922 Bacteria 1620
236 Ga0496120_0000041 3300048923 Bacteria 200518
237 Ga0496120_0003021 3300048923 Bacteria 15931
238 Ga0496120_0035515 3300048923 Bacteria 2976
239 Ga0496121_0005308 3300048924 Bacteria 16576
240 Ga0496121_0006713 3300048924 Bacteria 14137
241 Ga0496121_0033534 3300048924 Bacteria 4644
242 Ga0496121_0054857 3300048924 Bacteria 3326
243 Ga0496121_0064115 3300048924 Bacteria 2998
244 Ga0496121_0137352 3300048924 Bacteria 1819
245 Ga0496122_0002939 3300048925 Bacteria 23250
246 Ga0496122_0005156 3300048925 Bacteria 15745
247 Ga0496122_0005255 3300048925 Bacteria 15519
248 Ga0496122_0005305 3300048925 Bacteria 15418
249 Ga0496122_0008119 3300048925 Bacteria 11439
250 Ga0496122_0014623 3300048925 Bacteria 7574
251 Ga0496122_0036356 3300048925 Bacteria 3983
252 Ga0496122_0056625 3300048925 Bacteria 2921
253 Ga0496122_0098140 3300048925 Bacteria 1968
254 Ga0496122_0101162 3300048925 Bacteria 1926
255 Ga0496123_0000666 3300048926 Bacteria 56742
256 Ga0496123_0002336 3300048926 Bacteria 23798
257 Ga0496123_0002560 3300048926 Bacteria 22138
258 Ga0496123_0003788 3300048926 Bacteria 16560
259 Ga0496123_0008062 3300048926 Bacteria 9747
260 Ga0496123_0009341 3300048926 Bacteria 8845
261 Ga0496123_0055730 3300048926 Bacteria 2590
262 Ga0496123_0099475 3300048926 Bacteria 1697
263 Ga0496123_0138973 3300048926 Bacteria 1331
264 Ga0496124_0000056 3300048927 Bacteria 250907
265 Ga0496124_0001611 3300048927 Bacteria 32324
266 Ga0496124_0002201 3300048927 Bacteria 26004
267 Ga0496124_0002843 3300048927 Bacteria 21875
268 Ga0496124_0008631 3300048927 Bacteria 10619
269 Ga0496124_0026305 3300048927 Bacteria 5249
270 Ga0496124_0028525 3300048927 Bacteria 4991
271 Ga0496124_0038865 3300048927 Bacteria 4128
272 Ga0496124_0050869 3300048927 Bacteria 3527
273 Ga0496124_0056220 3300048927 Bacteria 3319
274 Ga0496124_0100493 3300048927 Bacteria 2344
275 Ga0496124_0301868 3300048927 Bacteria 1156
276 Ga0496125_0000132 3300048928 Bacteria 162176
277 Ga0496125_0000174 3300048928 Bacteria 144548
278 Ga0496125_0000414 3300048928 Bacteria 79745
279 Ga0496125_0001259 3300048928 Bacteria 37772
280 Ga0496125_0001782 3300048928 Bacteria 29748
281 Ga0496125_0003868 3300048928 Bacteria 17714
282 Ga0496125_0007928 3300048928 Bacteria 11213
283 Ga0496125_0028604 3300048928 Bacteria 5029
284 Ga0496125_0079862 3300048928 Bacteria 2506
285 Ga0496125_0083650 3300048928 Bacteria 2426
286 Ga0496125_0091256 3300048928 Bacteria 2283
287 Ga0496125_0221334 3300048928 Bacteria 1219
288 Ga0496125_0263893 3300048928 Bacteria 1077
289 Ga0496126_0000331 3300048929 Bacteria 100914
290 Ga0496126_0001140 3300048929 Bacteria 44190
291 Ga0496126_0011789 3300048929 Bacteria 8998
292 Ga0496126_0109982 3300048929 Bacteria 2401
293 Ga0496126_0117384 3300048929 Bacteria 2311
294 Ga0496126_0120970 3300048929 Bacteria 2270
295 nmdc:mga03683_20249_c1 3300050489 Bacteria 2551
296 nmdc:mga03n38_157357_c1 3300050490 Bacteria 1148
297 nmdc:mga00v17_162594_c1 3300050491 Bacteria 1438
298 nmdc:mga00v17_186_c2 3300050491 Bacteria 35842
299 nmdc:mga00v17_228311_c1 3300050491 Bacteria 1206
300 nmdc:mga00v17_35154_c1 3300050491 Bacteria 2980
301 nmdc:mga00v17_6690_c1 3300050491 Bacteria 6124
302 nmdc:mga0yw44_76159_c1 3300050492 Bacteria 2093
303 nmdc:mga0k408_13775_c1 3300050493 Bacteria 4442
304 nmdc:mga0k408_3444_c1 3300050493 Bacteria 8380
305 nmdc:mga0k408_46684_c1 3300050493 Bacteria 2502
306 nmdc:mga0k408_9077_c1 3300050493 Bacteria 5352
307 nmdc:mga06z11_120992_c1 3300050494 Bacteria 1460
308 nmdc:mga06z11_35015_c1 3300050494 Bacteria 2468
309 nmdc:mga07m45_10578_c1 3300050496 Bacteria 4824
310 Ga0500618_003249 3300053125 Bacteria 5659
311 Ga0500618_020932 3300053125 Bacteria 1599
312 Ga0500626_084500 3300053128 Bacteria 1399
313 Ga0466962_0011707 3300061719 Bacteria 4223

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006051 Ga0075364_10000197 Ga0075364_1000019717 282
2 3300050491 nmdc:mga00v17_186_c2 nmdc:mga00v17_186_c2_11597_12694 282
3 3300046501 Ga0495607_0038743 Ga0495607_0038743_1556_2428 290
4 3300053125 Ga0500618_020932 Ga0500618_020932_375_1247 290
5 3300048924 Ga0496121_0137352 Ga0496121_0137352_10_921 303
6 3300041411 Ga0439466_0004516 Ga0439466_0004516_11_928 305
7 3300046519 Ga0495632_0046972 Ga0495632_0046972_10_927 305
8 3300013105 Ga0157369_10140589 Ga0157369_101405892 306
9 3300005262 Ga0065165_1013635 Ga0065165_10136352 307
10 3300048927 Ga0496124_0301868 Ga0496124_0301868_50_1033 307
11 3300039438 Ga0436360_1330529 Ga0436360_1330529_3784_4755 308
12 3300039447 Ga0436361_0504037 Ga0436361_0504037_632_1603 308
13 3300050490 nmdc:mga03n38_157357_c1 nmdc:mga03n38_157357_c1_152_1129 308
14 3300003320 rootH2_10005095 rootH2_100050953 309
15 3300005347 Ga0070668_100034855 Ga0070668_1000348552 309
16 3300013100 Ga0157373_10130301 Ga0157373_101303011 309
17 3300013102 Ga0157371_10175037 Ga0157371_101750372 309
18 3300025728 Ga0207655_1044042 Ga0207655_10440421 309
19 3300025972 Ga0207668_10071175 Ga0207668_100711752 309
20 3300031911 Ga0307412_10004441 Ga0307412_100044412 309
21 3300032004 Ga0307414_10005121 Ga0307414_100051212 309
22 3300042115 Ga0450911_003052 Ga0450911_003052_878_1855 309
23 3300048919 Ga0496116_0003054 Ga0496116_0003054_3954_4931 309
24 3300048921 Ga0496118_0080055 Ga0496118_0080055_552_1529 309
25 3300048925 Ga0496122_0101162 Ga0496122_0101162_450_1427 309
26 3300048926 Ga0496123_0138973 Ga0496123_0138973_293_1270 309
27 3300048928 Ga0496125_0083650 Ga0496125_0083650_493_1470 309
28 3300048929 Ga0496126_0120970 Ga0496126_0120970_1215_2192 309
29 3300006051 Ga0075364_10145534 Ga0075364_101455341 310
30 3300028794 Ga0307515_10000085 Ga0307515_10000085128 310
31 3300031824 Ga0307413_10022004 Ga0307413_100220043 310
32 3300044656 Ga0466969_0020244 Ga0466969_0020244_120_1097 310
33 3300044663 Ga0466989_0089731 Ga0466989_0089731_822_1799 310
34 3300044693 Ga0466961_0032560 Ga0466961_0032560_2298_3275 310
35 3300045836 Ga0466958_0250481 Ga0466958_0250481_84_1061 310
36 3300046674 Ga0495588_0001520 Ga0495588_0001520_5980_6957 310
37 3300048924 Ga0496121_0054857 Ga0496121_0054857_1852_2871 310
38 3300050491 nmdc:mga00v17_228311_c1 nmdc:mga00v17_228311_c1_25_1002 310
39 3300061719 Ga0466962_0011707 Ga0466962_0011707_3141_4118 310
40 3300032004 Ga0307414_10010573 Ga0307414_100105732 311
41 3300046558 Ga0495633_0000903 Ga0495633_0000903_15629_16606 311
42 3300006195 Ga0075366_10001737 Ga0075366_100017372 312
43 3300025929 Ga0207664_10107089 Ga0207664_101070893 312
44 3300031616 Ga0307508_10210076 Ga0307508_102100762 312
45 3300044658 Ga0466972_0037751 Ga0466972_0037751_1311_2288 312
46 3300044683 Ga0466965_0010777 Ga0466965_0010777_757_1734 312
47 3300044684 Ga0466966_0033554 Ga0466966_0033554_1070_2047 312
48 3300044693 Ga0466961_0102778 Ga0466961_0102778_158_1135 312
49 3300044719 Ga0466971_0014757 Ga0466971_0014757_756_1733 312
50 3300050491 nmdc:mga00v17_6690_c1 nmdc:mga00v17_6690_c1_2237_3214 312
51 3300003752 Ga0055539_1000006 Ga0055539_1000006400 313
52 3300006195 Ga0075366_10011715 Ga0075366_100117152 313
53 3300009093 Ga0105240_10017970 Ga0105240_100179706 313
54 3300025913 Ga0207695_10025926 Ga0207695_100259263 313
55 3300048927 Ga0496124_0000056 Ga0496124_0000056_158090_159085 313
56 3300050493 nmdc:mga0k408_13775_c1 nmdc:mga0k408_13775_c1_1595_2575 313
57 3300050493 nmdc:mga0k408_9077_c1 nmdc:mga0k408_9077_c1_984_1997 313
58 3300032004 Ga0307414_10126996 Ga0307414_101269963 314
59 3300048928 Ga0496125_0000174 Ga0496125_0000174_5423_6400 314
60 3300050493 nmdc:mga0k408_3444_c1 nmdc:mga0k408_3444_c1_7194_8174 314
61 3300039453 Ga0436362_0510554 Ga0436362_0510554_1621_2592 315
62 3300025294 Ga0209025_1067440 Ga0209025_10674402 316
63 3300053128 Ga0500626_084500 Ga0500626_084500_296_1330 317
64 iso_pu_bacteria 2772190666 2772439024 319
65 iso_pu_bacteria 2937967321 2937967641 319
66 iso_pu_bacteria 2974294766 2974295967 319
67 iso_pu_bacteria 2974324384 2974327768 319
68 iso_pu_bacteria 640753048 640936694 319
69 iso_pu_bacteria 2600254933 2600373642 320
70 iso_pu_bacteria 2818991461 2819686423 320
71 iso_pu_bacteria 2854896431 2854900228 320
72 iso_pu_bacteria 2939589442 2939591770 320
73 iso_pu_bacteria 2974307012 2974308698 320
74 iso_pu_bacteria 2977247770 2977249438 320
75 iso_pu_bacteria 2984514374 2984516094 320
76 iso_pu_bacteria 8056875544 8056876167 320
77 3300046810 Ga0495660_0018442 Ga0495660_0018442_559_1524 321
78 iso_pu_bacteria 2547132130 2547501894 321
79 iso_pu_bacteria 2551306352 2552748486 321
80 iso_pu_bacteria 2576861471 2578458229 321
81 iso_pu_bacteria 2582581315 2585329240 321
82 iso_pu_bacteria 2582581316 2585332415 321
83 iso_pu_bacteria 2585427527 2585535634 321
84 iso_pu_bacteria 2615840698 2616551998 321
85 iso_pu_bacteria 2617270742 2617382926 321
86 iso_pu_bacteria 2639762793 2640736082 321
87 iso_pu_bacteria 2643221609 2644061177 321
88 iso_pu_bacteria 2643221611 2644071888 321
89 iso_pu_bacteria 2675903507 2678229318 321
90 iso_pu_bacteria 2687453129 2687579869 321
91 iso_pu_bacteria 2738543012 2739243520 321
92 iso_pu_bacteria 2747842428 2747948510 321
93 iso_pu_bacteria 2765235840 2765579345 321
94 iso_pu_bacteria 2773857761 2774390153 321
95 iso_pu_bacteria 2773857770 2774437996 321
96 iso_pu_bacteria 2775507266 2778175199 321
97 iso_pu_bacteria 2791355048 2792459868 321
98 iso_pu_bacteria 2816332133 2816475690 321
99 iso_pu_bacteria 2816332141 2816517456 321
100 iso_pu_bacteria 2842391507 2842391591 321
101 iso_pu_bacteria 2842482326 2842486926 321
102 iso_pu_bacteria 2842757796 2842758111 321
103 iso_pu_bacteria 2843744320 2843744540 321
104 iso_pu_bacteria 2849560528 2849565128 321
105 iso_pu_bacteria 2849573788 2849575622 321
106 iso_pu_bacteria 2851153111 2851156021 321
107 iso_pu_bacteria 2852649853 2852650623 321
108 iso_pu_bacteria 2857442823 2857443302 321
109 iso_pu_bacteria 2874220319 2874222034 321
110 iso_pu_bacteria 2898329390 2898331685 321
111 iso_pu_bacteria 2919089067 2919093197 321
112 iso_pu_bacteria 2919134579 2919135682 321
113 iso_pu_bacteria 2919182534 2919184488 321
114 iso_pu_bacteria 2919506607 2919507771 321
115 iso_pu_bacteria 2928496128 2928500351 321
116 iso_pu_bacteria 2931380184 2931380378 321
117 iso_pu_bacteria 2937610967 2937612869 321
118 iso_pu_bacteria 2939622612 2939626463 321
119 iso_pu_bacteria 2939626828 2939626944 321
120 iso_pu_bacteria 2941475908 2941476010 321
121 iso_pu_bacteria 2961047084 2961048801 321
122 iso_pu_bacteria 2961064222 2961067703 321
123 iso_pu_bacteria 2987605356 2987606577 321
124 iso_pu_bacteria 3005594810 3005600616 321
125 iso_pu_bacteria 8005314921 8005321317 321
126 iso_pu_bacteria 8033232454 8033235056 321
127 iso_pu_bacteria 2667528174 2671114490 322
128 iso_pu_bacteria 2747842501 2748017830 322
129 iso_pu_bacteria 2838029111 2838032114 322
130 iso_pu_bacteria 2842475841 2842478846 322
131 iso_pu_bacteria 2842502639 2842505835 322
132 iso_pu_bacteria 2919408235 2919413213 322
133 iso_pu_bacteria 2939669807 2939671619 322
134 iso_pu_bacteria 8005682033 8005684443 322
135 3300005272 Ga0065703_1018760 Ga0065703_101876010 323
136 3300003771 Ga0055526_1000469 Ga0055526_100046910 324
137 3300003773 Ga0055537_1000413 Ga0055537_100041320 324
138 3300003775 Ga0055524_1015567 Ga0055524_10155672 324
139 3300003784 Ga0055534_1000115 Ga0055534_100011526 324
140 3300003790 Ga0055528_1000446 Ga0055528_100044626 324
141 3300003790 Ga0055528_1000625 Ga0055528_100062515 324
142 3300003794 Ga0055531_10014868 Ga0055531_100148682 324
143 3300006051 Ga0075364_10036430 Ga0075364_100364303 324
144 3300013100 Ga0157373_10069951 Ga0157373_100699512 324
145 3300014497 Ga0182008_10008528 Ga0182008_100085285 324
146 3300015261 Ga0182006_1037548 Ga0182006_10375482 324
147 3300017792 Ga0163161_10062663 Ga0163161_100626632 324
148 3300025263 Ga0209565_1000024 Ga0209565_1000024246 324
149 3300025273 Ga0209673_1000696 Ga0209673_10006965 324
150 3300025291 Ga0209675_1000039 Ga0209675_1000039201 324
151 3300025295 Ga0209564_1000188 Ga0209564_1000188136 324
152 3300025298 Ga0209050_1024473 Ga0209050_10244733 324
153 3300025304 Ga0209257_1000832 Ga0209257_100083238 324
154 3300030742 Ga0316183_1106108 Ga0316183_11061083 324
155 3300042006 Ga0439432_003735 Ga0439432_003735_306_1280 324
156 3300044735 Ga0466968_0082648 Ga0466968_0082648_404_1378 324
157 3300046522 Ga0495643_0003828 Ga0495643_0003828_771_1745 324
158 3300047320 Ga0495672_0000006 Ga0495672_0000006_127228_128202 324
159 3300047472 Ga0495686_0003185 Ga0495686_0003185_4640_5614 324
160 3300048920 Ga0496117_0004214 Ga0496117_0004214_12984_13958 324
161 3300048921 Ga0496118_0003583 Ga0496118_0003583_4550_5524 324
162 3300048925 Ga0496122_0056625 Ga0496122_0056625_683_1657 324
163 3300048926 Ga0496123_0009341 Ga0496123_0009341_3613_4587 324
164 3300048927 Ga0496124_0050869 Ga0496124_0050869_2104_3078 324
165 3300048927 Ga0496124_0100493 Ga0496124_0100493_499_1473 324
166 3300048928 Ga0496125_0079862 Ga0496125_0079862_132_1106 324
167 3300050491 nmdc:mga00v17_35154_c1 nmdc:mga00v17_35154_c1_1645_2619 324
168 3300050494 nmdc:mga06z11_35015_c1 nmdc:mga06z11_35015_c1_1008_1982 324
169 3300002067 JGI24735J21928_10001264 JGI24735J21928_100012645 325
170 3300002704 JGI25155J39150_1000015 JGI25155J39150_1000015118 325
171 3300002705 JGI25156J39149_1000007 JGI25156J39149_1000007118 325
172 3300002737 JGI25162J39368_1000352 JGI25162J39368_10003525 325
173 3300002738 JGI25154J39366_1000051 JGI25154J39366_100005154 325
174 3300002741 JGI25157J39369_1000012 JGI25157J39369_100001282 325
175 3300002772 JGI25164J39214_1001642 JGI25164J39214_10016421 325
176 3300003214 JGI25165J46597_1000044 JGI25165J46597_10000447 325
177 3300003214 JGI25165J46597_1000198 JGI25165J46597_100019857 325
178 3300003214 JGI25165J46597_1009718 JGI25165J46597_10097182 325
179 3300003320 rootH2_10006074 rootH2_100060746 325
180 3300003320 rootH2_10018251 rootH2_100182512 325
181 3300003322 rootL2_10016804 rootL2_1001680428 325
182 3300003322 rootL2_10040301 rootL2_100403011 325
183 3300003323 rootH1_10035954 rootH1_100359543 325
184 3300003323 rootH1_10161001 rootH1_101610011 325
185 3300003578 Ga0006562J51391_1155457 Ga0006562J51391_11554577 325
186 3300003578 Ga0006562J51391_1155458 Ga0006562J51391_11554584 325
187 3300003758 Ga0055532_1008773 Ga0055532_10087731 325
188 3300003775 Ga0055524_1019393 Ga0055524_10193932 325
189 3300003781 Ga0055536_1000170 Ga0055536_100017013 325
190 3300003781 Ga0055536_1000250 Ga0055536_100025037 325
191 3300003781 Ga0055536_1004521 Ga0055536_10045211 325
192 3300003791 Ga0055530_10000021 Ga0055530_1000002180 325
193 3300003791 Ga0055530_10000071 Ga0055530_100000719 325
194 3300003794 Ga0055531_10000372 Ga0055531_100003724 325
195 3300003794 Ga0055531_10000495 Ga0055531_100004953 325
196 3300003856 Ga0058692_1000007 Ga0058692_1000007181 325
197 3300003856 Ga0058692_1000009 Ga0058692_100000977 325
198 3300005272 Ga0065703_1000060 Ga0065703_10000609 325
199 3300005353 Ga0070669_100003016 Ga0070669_1000030168 325
200 3300005364 Ga0070673_100023498 Ga0070673_1000234983 325
201 3300005548 Ga0070665_100045003 Ga0070665_1000450034 325
202 3300005548 Ga0070665_100313360 Ga0070665_1003133602 325
203 3300005842 Ga0068858_100032697 Ga0068858_1000326972 325
204 3300006038 Ga0075365_10051114 Ga0075365_100511142 325
205 3300006051 Ga0075364_10065814 Ga0075364_100658142 325
206 3300006051 Ga0075364_10273898 Ga0075364_102738982 325
207 3300009011 Ga0105251_10099625 Ga0105251_100996252 325
208 3300009036 Ga0105244_10013113 Ga0105244_100131132 325
209 3300009093 Ga0105240_10000216 Ga0105240_100002168 325
210 3300009093 Ga0105240_10005540 Ga0105240_1000554010 325
211 3300009101 Ga0105247_10005826 Ga0105247_100058261 325
212 3300009101 Ga0105247_10076153 Ga0105247_100761533 325
213 3300009148 Ga0105243_10001096 Ga0105243_100010968 325
214 3300009148 Ga0105243_10302348 Ga0105243_103023482 325
215 3300009545 Ga0105237_10018015 Ga0105237_100180152 325
216 3300010375 Ga0105239_10061979 Ga0105239_100619791 325
217 3300010375 Ga0105239_10200307 Ga0105239_102003072 325
218 3300011119 Ga0105246_10083592 Ga0105246_100835922 325
219 3300013102 Ga0157371_10000022 Ga0157371_1000002258 325
220 3300013102 Ga0157371_10138359 Ga0157371_101383592 325
221 3300013104 Ga0157370_10000183 Ga0157370_100001832 325
222 3300013104 Ga0157370_10056548 Ga0157370_100565483 325
223 3300014497 Ga0182008_10000013 Ga0182008_10000013134 325
224 3300015261 Ga0182006_1052093 Ga0182006_10520932 325
225 3300015262 Ga0182007_10000004 Ga0182007_10000004146 325
226 3300015262 Ga0182007_10001098 Ga0182007_100010983 325
227 3300015265 Ga0182005_1000296 Ga0182005_100029623 325
228 3300015265 Ga0182005_1001151 Ga0182005_10011515 325
229 3300017792 Ga0163161_10115250 Ga0163161_101152502 325
230 3300017792 Ga0163161_10181689 Ga0163161_101816891 325
231 3300025206 Ga0209435_100006 Ga0209435_100006406 325
232 3300025229 Ga0209147_101287 Ga0209147_1012875 325
233 3300025231 Ga0207427_100126 Ga0207427_10012691 325
234 3300025233 Ga0209437_100042 Ga0209437_100042199 325
235 3300025246 Ga0209646_1000015 Ga0209646_1000015128 325
236 3300025250 Ga0209026_1000046 Ga0209026_1000046128 325
237 3300025256 Ga0209759_1000005 Ga0209759_1000005406 325
238 3300025261 Ga0209233_1000014 Ga0209233_10000147 325
239 3300025261 Ga0209233_1000103 Ga0209233_1000103199 325
240 3300025261 Ga0209233_1000428 Ga0209233_10004285 325
241 3300025284 Ga0209130_1009148 Ga0209130_10091482 325
242 3300025292 Ga0209676_1000011 Ga0209676_1000011221 325
243 3300025292 Ga0209676_1000075 Ga0209676_1000075198 325
244 3300025292 Ga0209676_1000536 Ga0209676_100053642 325
245 3300025298 Ga0209050_1000032 Ga0209050_1000032100 325
246 3300025298 Ga0209050_1000069 Ga0209050_100006997 325
247 3300025298 Ga0209050_1011164 Ga0209050_10111642 325
248 3300025299 Ga0209256_1008274 Ga0209256_10082744 325
249 3300025303 Ga0209051_1000593 Ga0209051_100059316 325
250 3300025304 Ga0209257_1000014 Ga0209257_1000014280 325
251 3300025304 Ga0209257_1000571 Ga0209257_100057117 325
252 3300025728 Ga0207655_1000479 Ga0207655_100047936 325
253 3300025728 Ga0207655_1002382 Ga0207655_10023828 325
254 3300025728 Ga0207655_1003870 Ga0207655_10038704 325
255 3300025735 Ga0207713_1020223 Ga0207713_10202232 325
256 3300025735 Ga0207713_1026938 Ga0207713_10269382 325
257 3300025735 Ga0207713_1077404 Ga0207713_10774042 325
258 3300025900 Ga0207710_10000018 Ga0207710_10000018157 325
259 3300025900 Ga0207710_10041815 Ga0207710_100418151 325
260 3300025913 Ga0207695_10000319 Ga0207695_1000031995 325
261 3300025913 Ga0207695_10048016 Ga0207695_100480163 325
262 3300025914 Ga0207671_10000078 Ga0207671_1000007895 325
263 3300025923 Ga0207681_10005302 Ga0207681_100053028 325
264 3300025935 Ga0207709_10000016 Ga0207709_10000016307 325
265 3300025960 Ga0207651_10089997 Ga0207651_100899972 325
266 3300027312 Ga0209371_1000023 Ga0209371_1000023365 325
267 3300027312 Ga0209371_1000024 Ga0209371_1000024175 325
268 3300028379 Ga0268266_10055799 Ga0268266_100557993 325
269 3300028379 Ga0268266_10419573 Ga0268266_104195732 325
270 3300030500 Ga0268256_1000023 Ga0268256_100002375 325
271 3300030500 Ga0268256_1000026 Ga0268256_1000026175 325
272 3300030744 Ga0316181_1162508 Ga0316181_11625083 325
273 3300037418 Ga0395900_0001829 Ga0395900_0001829_17216_18193 325
274 3300037466 Ga0395898_0000100 Ga0395898_0000100_111535_112512 325
275 3300046453 Ga0495627_001258 Ga0495627_001258_13750_14790 325
276 3300046460 Ga0495638_0000655 Ga0495638_0000655_19059_20093 325
277 3300046472 Ga0495580_0005082 Ga0495580_0005082_5360_6337 325
278 3300046512 Ga0495610_0025655 Ga0495610_0025655_1173_2150 325
279 3300046518 Ga0495631_0000277 Ga0495631_0000277_30298_31275 325
280 3300046525 Ga0495663_0001017 Ga0495663_0001017_8164_9198 325
281 3300046525 Ga0495663_0002442 Ga0495663_0002442_3962_4939 325
282 3300046525 Ga0495663_0008262 Ga0495663_0008262_742_1719 325
283 3300046525 Ga0495663_0010799 Ga0495663_0010799_1295_2272 325
284 3300046529 Ga0495652_0186275 Ga0495652_0186275_420_1430 325
285 3300046542 Ga0495597_0000234 Ga0495597_0000234_12066_13043 325
286 3300046558 Ga0495633_0000866 Ga0495633_0000866_21056_22033 325
287 3300046558 Ga0495633_0113372 Ga0495633_0113372_249_1226 325
288 3300048903 Ga0496100_0003185 Ga0496100_0003185_2778_3755 325
289 3300048905 Ga0496102_0012542 Ga0496102_0012542_3801_4778 325
290 3300048906 Ga0496103_0015068 Ga0496103_0015068_2751_3728 325
291 3300048908 Ga0496105_0033781 Ga0496105_0033781_1066_2043 325
292 3300048919 Ga0496116_0003524 Ga0496116_0003524_11036_12013 325
293 3300048919 Ga0496116_0005023 Ga0496116_0005023_5400_6377 325
294 3300048919 Ga0496116_0014694 Ga0496116_0014694_5201_6178 325
295 3300048920 Ga0496117_0000065 Ga0496117_0000065_195488_196465 325
296 3300048920 Ga0496117_0000594 Ga0496117_0000594_49997_50974 325
297 3300048920 Ga0496117_0010304 Ga0496117_0010304_915_1892 325
298 3300048920 Ga0496117_0011211 Ga0496117_0011211_442_1482 325
299 3300048921 Ga0496118_0000033 Ga0496118_0000033_129893_130870 325
300 3300048921 Ga0496118_0000056 Ga0496118_0000056_137848_138825 325
301 3300048921 Ga0496118_0000844 Ga0496118_0000844_6655_7632 325
302 3300048921 Ga0496118_0012796 Ga0496118_0012796_336_1376 325
303 3300048921 Ga0496118_0047582 Ga0496118_0047582_687_1664 325
304 3300048921 Ga0496118_0080475 Ga0496118_0080475_421_1455 325
305 3300048921 Ga0496118_0172573 Ga0496118_0172573_323_1300 325
306 3300048922 Ga0496119_0000358 Ga0496119_0000358_10341_11318 325
307 3300048922 Ga0496119_0005065 Ga0496119_0005065_10339_11316 325
308 3300048922 Ga0496119_0100902 Ga0496119_0100902_56_1147 325
309 3300048923 Ga0496120_0000041 Ga0496120_0000041_116531_117508 325
310 3300048923 Ga0496120_0003021 Ga0496120_0003021_11164_12141 325
311 3300048924 Ga0496121_0005308 Ga0496121_0005308_2200_3177 325
312 3300048924 Ga0496121_0006713 Ga0496121_0006713_8991_9968 325
313 3300048924 Ga0496121_0033534 Ga0496121_0033534_1582_2559 325
314 3300048924 Ga0496121_0064115 Ga0496121_0064115_165_1142 325
315 3300048925 Ga0496122_0002939 Ga0496122_0002939_4421_5398 325
316 3300048925 Ga0496122_0005156 Ga0496122_0005156_5336_6313 325
317 3300048925 Ga0496122_0005255 Ga0496122_0005255_11108_12085 325
318 3300048925 Ga0496122_0005305 Ga0496122_0005305_1630_2607 325
319 3300048925 Ga0496122_0008119 Ga0496122_0008119_4035_5012 325
320 3300048925 Ga0496122_0036356 Ga0496122_0036356_649_1626 325
321 3300048925 Ga0496122_0098140 Ga0496122_0098140_846_1844 325
322 3300048926 Ga0496123_0000666 Ga0496123_0000666_37909_38886 325
323 3300048926 Ga0496123_0002336 Ga0496123_0002336_13949_14926 325
324 3300048926 Ga0496123_0002560 Ga0496123_0002560_14979_15956 325
325 3300048926 Ga0496123_0003788 Ga0496123_0003788_15525_16502 325
326 3300048926 Ga0496123_0008062 Ga0496123_0008062_4190_5167 325
327 3300048926 Ga0496123_0055730 Ga0496123_0055730_90_1067 325
328 3300048927 Ga0496124_0001611 Ga0496124_0001611_7400_8377 325
329 3300048927 Ga0496124_0002201 Ga0496124_0002201_6838_7815 325
330 3300048927 Ga0496124_0002843 Ga0496124_0002843_12752_13729 325
331 3300048927 Ga0496124_0008631 Ga0496124_0008631_6731_7747 325
332 3300048927 Ga0496124_0028525 Ga0496124_0028525_2119_3096 325
333 3300048927 Ga0496124_0038865 Ga0496124_0038865_2345_3322 325
334 3300048927 Ga0496124_0056220 Ga0496124_0056220_1649_2626 325
335 3300048928 Ga0496125_0000132 Ga0496125_0000132_5291_6268 325
336 3300048928 Ga0496125_0000414 Ga0496125_0000414_42896_43873 325
337 3300048928 Ga0496125_0001259 Ga0496125_0001259_6165_7142 325
338 3300048928 Ga0496125_0001782 Ga0496125_0001782_3801_4778 325
339 3300048928 Ga0496125_0003868 Ga0496125_0003868_7580_8557 325
340 3300048928 Ga0496125_0007928 Ga0496125_0007928_4268_5245 325
341 3300048928 Ga0496125_0028604 Ga0496125_0028604_2350_3327 325
342 3300048928 Ga0496125_0221334 Ga0496125_0221334_48_1025 325
343 3300048928 Ga0496125_0263893 Ga0496125_0263893_59_1036 325
344 3300048929 Ga0496126_0000331 Ga0496126_0000331_7105_8082 325
345 3300048929 Ga0496126_0001140 Ga0496126_0001140_26535_27512 325
346 3300048929 Ga0496126_0011789 Ga0496126_0011789_3435_4412 325
347 3300048929 Ga0496126_0109982 Ga0496126_0109982_381_1421 325
348 3300048929 Ga0496126_0117384 Ga0496126_0117384_1074_2051 325
349 3300050491 nmdc:mga00v17_162594_c1 nmdc:mga00v17_162594_c1_195_1172 325
350 3300050492 nmdc:mga0yw44_76159_c1 nmdc:mga0yw44_76159_c1_376_1353 325
351 3300053125 Ga0500618_003249 Ga0500618_003249_3629_4651 325
352 iso_pu_bacteria 2643221616 2644095206 325
353 iso_pu_bacteria 2721755702 2723640755 325
354 iso_pu_bacteria 2818991448 2819607625 325
355 iso_pu_bacteria 2884763398 2884764586 325
356 iso_pu_bacteria 3005416602 3005422036 325
357 iso_pu_bacteria 8005484373 8005489922 325
358 iso_pu_bacteria 8005645114 8005650806 325
359 3300001979 JGI24740J21852_10002371 JGI24740J21852_100023712 326
360 3300002737 JGI25162J39368_1000285 JGI25162J39368_100028535 326
361 3300003214 JGI25165J46597_1000102 JGI25165J46597_100010282 326
362 3300006048 Ga0075363_100014814 Ga0075363_1000148141 326
363 3300006177 Ga0075362_10008046 Ga0075362_100080462 326
364 3300006178 Ga0075367_10004204 Ga0075367_100042043 326
365 3300006186 Ga0075369_10021871 Ga0075369_100218713 326
366 3300006353 Ga0075370_10048000 Ga0075370_100480003 326
367 3300015261 Ga0182006_1028566 Ga0182006_10285662 326
368 3300025233 Ga0209437_100062 Ga0209437_100062187 326
369 3300025261 Ga0209233_1000082 Ga0209233_1000082187 326
370 3300027312 Ga0209371_1012344 Ga0209371_10123442 326
371 3300030500 Ga0268256_1005042 Ga0268256_10050422 326
372 3300031456 Ga0307513_10033285 Ga0307513_100332855 326
373 3300042876 Ga0451577_0019533 Ga0451577_0019533_1168_2148 326
374 3300044684 Ga0466966_0052721 Ga0466966_0052721_725_1705 326
375 3300044694 Ga0466963_0008854 Ga0466963_0008854_3186_4166 326
376 3300044765 Ga0466970_0000711 Ga0466970_0000711_5105_6085 326
377 3300044842 Ga0466957_0009751 Ga0466957_0009751_4297_5277 326
378 3300045836 Ga0466958_0018744 Ga0466958_0018744_149_1129 326
379 3300045976 Ga0466967_0400562 Ga0466967_0400562_12_992 326
380 3300048920 Ga0496117_0023569 Ga0496117_0023569_2856_3860 326
381 3300048922 Ga0496119_0005626 Ga0496119_0005626_2857_3861 326
382 3300048923 Ga0496120_0035515 Ga0496120_0035515_1095_2099 326
383 3300048925 Ga0496122_0014623 Ga0496122_0014623_3292_4272 326
384 3300048926 Ga0496123_0099475 Ga0496123_0099475_195_1175 326
385 3300048927 Ga0496124_0026305 Ga0496124_0026305_804_1784 326
386 3300048928 Ga0496125_0091256 Ga0496125_0091256_929_1933 326
387 3300050489 nmdc:mga03683_20249_c1 nmdc:mga03683_20249_c1_943_1953 326
388 3300050493 nmdc:mga0k408_46684_c1 nmdc:mga0k408_46684_c1_1164_2174 326
389 3300050494 nmdc:mga06z11_120992_c1 nmdc:mga06z11_120992_c1_202_1212 326
390 3300050496 nmdc:mga07m45_10578_c1 nmdc:mga07m45_10578_c1_2085_3095 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

189

317

0.93

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

221

361

0.93

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

65

149

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rvs-assembly1.cif.gz_B the native structure of mycobacterial quinone oxidoreductase rv154c. 0.899 1 324
3gms-assembly1.cif.gz_A crystal structure of putative nadph:quinone reductase from bacillus thuringiensis 0.8963 2 326
3gms-assembly1.cif.gz_A crystal structure of putative nadph:quinone reductase from bacillus thuringiensis 0.8912 2 326
4rvs-assembly1.cif.gz_B the native structure of mycobacterial quinone oxidoreductase rv154c. 0.8912 1 324
1zsy-assembly1.cif.gz_A the structure of human mitochondrial 2-enoyl thioester reductase (cgi-63) 0.8801 2 325
ID Description Score Start End Superfamily
af_O45496_9_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9551 1 120 3.90.180.10
af_Q3UNZ8_26_154_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9514 2 129 3.90.180.10
af_B0BNC9_25_138_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9419 2 114 3.90.180.10
af_M0R3N4_1_117_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9399 1 115 3.90.180.10
af_O45496_9_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9395 1 120 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A3D0GJB6-F1-model_v4 deleted 0.9892 91 324
AF-A0A3D0GJB6-F1-model_v4 deleted 0.9808 91 324
AF-Q8NL73-F1-model_v4 enoyl-[acyl-carrier-protein] reductase (EC 1.3.1.104) 0.9741 1 325 GO:0006631
GO:0016491
AF-Q8NL73-F1-model_v4 enoyl-[acyl-carrier-protein] reductase (EC 1.3.1.104) 0.9683 1 325 GO:0006631
GO:0016491
AF-A0A7X5WVL9-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9491 22 114 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.14 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map