F431782

General Info

Members Datasets Scaffolds Average Seq Length
390 263 390 94

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_1230155|Ga0395900_1230155_112_459
Length 115
Sequence VDRRRSIVQRALAARACLKETRMKATWNGVTLAESDDTVLVEGNHYFPASALKREYVSFSNTHTVCPWKGTASYYSLHVKGELNPDAVWYYPDPKPEAEMVRDRVAFWKGVKVEP

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
149 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
150 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
151 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
154 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
155 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
156 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
157 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
228 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
239 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
240 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
241 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
242 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
243 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
244 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
245 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
246 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
247 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
248 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
249 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
250 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
251 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
252 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
253 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
254 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
255 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
256 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
259 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
260 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
261 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
262 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
263 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.95
Metatranscriptomes 2.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.08
Nodule 0
Rhizoplane 1.54
Rhizosphere 57.95
Stem 0
Stem Tuber 0
Unclassified 7.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013261 3300001979 Bacteria 3082
2 JGI24740J21852_10161463 3300001979 Bacteria 556
3 JGI24739J22299_10194687 3300001989 Bacteria 595
4 JGI25158J39367_1015512 3300002739 Bacteria 973
5 JGI25152J39213_1008319 3300002773 Bacteria 2584
6 JGI25152J39213_1020543 3300002773 Bacteria 1177
7 JGI25150J39212_1001117 3300002774 Bacteria 8078
8 JGI25150J39212_1018497 3300002774 Bacteria 1107
9 JGI25159J45721_1009413 3300002987 Bacteria 2580
10 JGI25159J45721_1016460 3300002987 Bacteria 1574
11 JGI25151J46595_10005072 3300003187 Bacteria 6848
12 JGI25151J46595_10022902 3300003187 Bacteria 2584
13 JGI25151J46595_10080164 3300003187 Bacteria 949
14 JGI25153J46596_10005995 3300003215 Bacteria 6248
15 rootH1_10007508 3300003316 Bacteria 2675
16 rootH2_10096492 3300003320 Bacteria 1927
17 rootL2_10059075 3300003322 Bacteria 1598
18 rootL2_10105431 3300003322 Bacteria 1611
19 rootH1_10074780 3300003323 Bacteria 1841
20 JGI25160J50197_1014848 3300003354 Bacteria 2584
21 JGI25160J50197_1020274 3300003354 Bacteria 2011
22 JGI25161J50226_1005030 3300003374 Bacteria 2652
23 JGI25161J50226_1010083 3300003374 Bacteria 1289
24 Ga0006562J51391_1111152 3300003578 Bacteria 930
25 Ga0055535_1001087 3300003761 Bacteria 16601
26 Ga0055542_1000268 3300003762 Bacteria 58408
27 Ga0055526_1018600 3300003771 Bacteria 2584
28 Ga0055526_1033061 3300003771 Bacteria 1444
29 Ga0055537_1002199 3300003773 Bacteria 6785
30 Ga0055537_1024004 3300003773 Bacteria 863
31 Ga0055524_1002044 3300003775 Bacteria 10731
32 Ga0055524_1016981 3300003775 Bacteria 2584
33 Ga0055536_1029696 3300003781 Bacteria 1463
34 Ga0055536_1034878 3300003781 Bacteria 1264
35 Ga0055534_1000470 3300003784 Bacteria 22861
36 Ga0055534_1001529 3300003784 Bacteria 9037
37 Ga0055528_1004413 3300003790 Bacteria 6785
38 Ga0055528_1049537 3300003790 Bacteria 860
39 Ga0055530_10028781 3300003791 Bacteria 1495
40 Ga0055530_10041423 3300003791 Bacteria 1124
41 Ga0055540_1008782 3300003792 Bacteria 3585
42 Ga0055540_1025935 3300003792 Bacteria 1426
43 Ga0055540_1040250 3300003792 Bacteria 1013
44 Ga0055531_10020771 3300003794 Bacteria 2581
45 Ga0055531_10038245 3300003794 Bacteria 1443
46 Ga0055543_1001564 3300004625 Bacteria 8855
47 Ga0055543_1014384 3300004625 Bacteria 1543
48 Ga0065165_1004228 3300005262 Bacteria 9128
49 Ga0065165_1101683 3300005262 Bacteria 718
50 Ga0065704_10343024 3300005289 Bacteria 820
51 Ga0070658_10409644 3300005327 Bacteria 1165
52 Ga0070670_101405784 3300005331 Bacteria 640
53 Ga0070677_10235046 3300005333 Bacteria 902
54 Ga0068869_101144934 3300005334 Bacteria 682
55 Ga0068869_101756576 3300005334 Bacteria 554
56 Ga0070666_10417888 3300005335 Bacteria 966
57 Ga0068868_101292985 3300005338 Bacteria 677
58 Ga0070660_101382142 3300005339 Bacteria 598
59 Ga0070674_101088347 3300005356 Bacteria 705
60 Ga0070714_100000080 3300005435 Bacteria 82851
61 Ga0070678_100049226 3300005456 Bacteria 3040
62 Ga0070681_11050354 3300005458 Bacteria 735
63 Ga0068867_100662106 3300005459 Bacteria 917
64 Ga0068853_100305141 3300005539 Bacteria 1472
65 Ga0068853_100740788 3300005539 Bacteria 939
66 Ga0068853_101191740 3300005539 Bacteria 735
67 Ga0070665_100705313 3300005548 Bacteria 1022
68 Ga0068855_100272449 3300005563 Bacteria 1882
69 Ga0068855_100437413 3300005563 Bacteria 1429
70 Ga0068854_100342969 3300005578 Bacteria 1220
71 Ga0068854_100350510 3300005578 Bacteria 1208
72 Ga0068856_100219675 3300005614 Bacteria 1916
73 Ga0068856_101979587 3300005614 Bacteria 593
74 Ga0068852_102152855 3300005616 Bacteria 579
75 Ga0068859_101465958 3300005617 Bacteria 753
76 Ga0068861_100354444 3300005719 Bacteria 1288
77 Ga0068851_10055973 3300005834 Bacteria 2010
78 Ga0068851_10298051 3300005834 Bacteria 926
79 Ga0068863_100890307 3300005841 Bacteria 890
80 Ga0068858_100000521 3300005842 Bacteria 40362
81 Ga0068862_100135186 3300005844 Bacteria 2185
82 Ga0070717_10007432 3300006028 Bacteria 8139
83 Ga0075365_10312270 3300006038 Bacteria 1107
84 Ga0075365_11108328 3300006038 Bacteria 557
85 Ga0075368_10090832 3300006042 Bacteria 1249
86 Ga0075363_100075213 3300006048 Bacteria 1840
87 Ga0075363_100255476 3300006048 Bacteria 1010
88 Ga0075364_10068852 3300006051 Bacteria 2328
89 Ga0075366_10046622 3300006195 Bacteria 2568
90 Ga0097621_100836995 3300006237 Bacteria 854
91 Ga0097621_101425465 3300006237 Bacteria 656
92 Ga0075370_10106411 3300006353 Bacteria 1626
93 Ga0075370_10277433 3300006353 Bacteria 995
94 Ga0075370_10538679 3300006353 Bacteria 706
95 Ga0075431_101004654 3300006847 Bacteria 801
96 Ga0097620_101466186 3300006931 Bacteria 753
97 Ga0105240_10238713 3300009093 Bacteria 2108
98 Ga0105240_10522977 3300009093 Bacteria 1316
99 Ga0114129_12093739 3300009147 Bacteria 683
100 Ga0105248_10046295 3300009177 Bacteria 4875
101 Ga0105239_12320982 3300010375 Bacteria 624
102 Ga0157347_1012429 3300012502 Bacteria 918
103 Ga0157371_10027032 3300013102 Bacteria 4165
104 Ga0157370_10363275 3300013104 Bacteria 1334
105 Ga0157369_11727978 3300013105 Bacteria 636
106 Ga0163162_10143124 3300013306 Bacteria 2505
107 Ga0163162_11508291 3300013306 Bacteria 766
108 Ga0163162_11742149 3300013306 Bacteria 712
109 Ga0157372_10118029 3300013307 Bacteria 3043
110 Ga0163163_11668885 3300014325 Bacteria 698
111 Ga0157380_11861924 3300014326 Bacteria 662
112 Ga0182008_10072956 3300014497 Bacteria 1689
113 Ga0182008_10920271 3300014497 Bacteria 516
114 Ga0157376_11267506 3300014969 Bacteria 766
115 Ga0157376_12832798 3300014969 Bacteria 525
116 Ga0182007_10262881 3300015262 Bacteria 622
117 Ga0183362_10001 3300015683 Bacteria 2046624
118 Ga0163161_10090606 3300017792 Bacteria 2263
119 Ga0163161_10096972 3300017792 Bacteria 2190
120 Ga0213872_10000118 3300021361 Bacteria 73787
121 Ga0209436_108961 3300025208 Bacteria 1943
122 Ga0209436_120492 3300025208 Bacteria 891
123 Ga0209672_101202 3300025228 Bacteria 10505
124 Ga0209147_103999 3300025229 Bacteria 2607
125 Ga0209437_111209 3300025233 Bacteria 1346
126 Ga0209258_100009 3300025242 Bacteria 996276
127 Ga0207425_1002575 3300025245 Bacteria 6300
128 Ga0207425_1018990 3300025245 Bacteria 1486
129 Ga0209148_1000007 3300025254 Bacteria 1592273
130 Ga0209129_1000013 3300025258 Bacteria 524874
131 Ga0209129_1002746 3300025258 Bacteria 8233
132 Ga0209129_1010658 3300025258 Bacteria 2272
133 Ga0209233_1000065 3300025261 Bacteria 387195
134 Ga0209565_1000228 3300025263 Bacteria 61687
135 Ga0209565_1019815 3300025263 Bacteria 1430
136 Ga0209565_1022927 3300025263 Bacteria 1287
137 Ga0209673_1000309 3300025273 Bacteria 90058
138 Ga0209673_1000329 3300025273 Bacteria 87170
139 Ga0209673_1042127 3300025273 Bacteria 1287
140 Ga0209130_1000284 3300025284 Bacteria 62277
141 Ga0209130_1000489 3300025284 Bacteria 40639
142 Ga0209130_1001759 3300025284 Bacteria 12848
143 Ga0209675_1000238 3300025291 Bacteria 54807
144 Ga0209675_1000573 3300025291 Bacteria 26547
145 Ga0209675_1002901 3300025291 Bacteria 8484
146 Ga0209676_1000004 3300025292 Bacteria 1138360
147 Ga0209676_1004841 3300025292 Bacteria 7301
148 Ga0209676_1035944 3300025292 Bacteria 1447
149 Ga0209025_1000168 3300025294 Bacteria 162386
150 Ga0209025_1000393 3300025294 Bacteria 90571
151 Ga0209025_1084659 3300025294 Bacteria 1061
152 Ga0209564_1000222 3300025295 Bacteria 129405
153 Ga0209564_1000287 3300025295 Bacteria 102328
154 Ga0209758_1000134 3300025297 Bacteria 178294
155 Ga0209758_1021018 3300025297 Bacteria 3060
156 Ga0209050_1000002 3300025298 Bacteria 1792849
157 Ga0209050_1013938 3300025298 Bacteria 3519
158 Ga0209050_1019909 3300025298 Bacteria 2525
159 Ga0209256_1000060 3300025299 Bacteria 262342
160 Ga0209256_1000472 3300025299 Bacteria 60473
161 Ga0207426_1000095 3300025302 Bacteria 274234
162 Ga0207426_1000100 3300025302 Bacteria 262342
163 Ga0209051_1000002 3300025303 Bacteria 1631846
164 Ga0209051_1012524 3300025303 Bacteria 4097
165 Ga0209051_1145310 3300025303 Bacteria 564
166 Ga0209257_1000002 3300025304 Bacteria 1767052
167 Ga0209257_1000286 3300025304 Bacteria 111738
168 Ga0209257_1005826 3300025304 Bacteria 8358
169 Ga0207656_10003062 3300025321 Bacteria 5715
170 Ga0207688_10819701 3300025901 Bacteria 589
171 Ga0207705_10362720 3300025909 Bacteria 1117
172 Ga0207705_11034454 3300025909 Bacteria 634
173 Ga0207695_10645404 3300025913 Bacteria 939
174 Ga0207660_11284121 3300025917 Bacteria 595
175 Ga0207657_10356243 3300025919 Bacteria 1154
176 Ga0207694_10007753 3300025924 Bacteria 8130
177 Ga0207664_10000011 3300025929 Bacteria 279264
178 Ga0207709_10055131 3300025935 Bacteria 2454
179 Ga0207669_11542384 3300025937 Bacteria 567
180 Ga0207691_11293810 3300025940 Bacteria 602
181 Ga0207711_10049111 3300025941 Bacteria 3612
182 Ga0207689_10195913 3300025942 Bacteria 1667
183 Ga0207668_10434741 3300025972 Bacteria 1117
184 Ga0207640_10344010 3300025981 Bacteria 1196
185 Ga0207658_11022965 3300025986 Bacteria 754
186 Ga0207658_11781018 3300025986 Bacteria 562
187 Ga0207703_10000123 3300026035 Bacteria 92590
188 Ga0207703_10008653 3300026035 Bacteria 8030
189 Ga0207639_10047179 3300026041 Bacteria 3254
190 Ga0207639_10672919 3300026041 Bacteria 959
191 Ga0207639_10917815 3300026041 Bacteria 819
192 Ga0207639_11485749 3300026041 Bacteria 636
193 Ga0207702_10194079 3300026078 Bacteria 1878
194 Ga0207648_10115296 3300026089 Bacteria 2361
195 Ga0207676_10000971 3300026095 Bacteria 22156
196 Ga0207675_100365026 3300026118 Bacteria 1417
197 Ga0207683_10046895 3300026121 Bacteria 3783
198 Ga0207698_11805577 3300026142 Bacteria 627
199 Ga0209968_1061312 3300027526 Bacteria 663
200 Ga0209974_10091315 3300027876 Bacteria 1056
201 Ga0268266_10558157 3300028379 Bacteria 1098
202 Ga0268265_10009258 3300028380 Bacteria 6657
203 Ga0265327_10007341 3300031251 Bacteria 8537
204 Ga0307408_100562704 3300031548 Bacteria 1008
205 Ga0307408_100721734 3300031548 Bacteria 898
206 Ga0307508_10001175 3300031616 Bacteria 30125
207 Ga0307413_11021081 3300031824 Bacteria 710
208 Ga0307413_11035218 3300031824 Bacteria 706
209 Ga0307406_11288329 3300031901 Bacteria 637
210 Ga0307412_10728329 3300031911 Bacteria 854
211 Ga0307416_101985799 3300032002 Bacteria 684
212 Ga0307411_10173118 3300032005 Bacteria 1630
213 Ga0307411_11446565 3300032005 Bacteria 630
214 Ga0395899_0008411 3300037312 Bacteria 7945
215 Ga0395899_0082069 3300037312 Bacteria 2345
216 Ga0395900_0057803 3300037418 Bacteria 3993
217 Ga0395900_0142769 3300037418 Bacteria 2451
218 Ga0395900_0802662 3300037418 Bacteria 869
219 Ga0395900_1230155 3300037418 Bacteria 664
220 Ga0395900_1695293 3300037418 Bacteria 543
221 Ga0395898_0043400 3300037466 Bacteria 4431
222 Ga0395898_0094356 3300037466 Bacteria 2875
223 Ga0395898_0144382 3300037466 Bacteria 2278
224 Ga0395905_0000065 3300037471 Bacteria 184928
225 Ga0395905_0001008 3300037471 Bacteria 35984
226 Ga0395905_0009516 3300037471 Bacteria 9492
227 Ga0395905_0082710 3300037471 Bacteria 3008
228 Ga0395905_0091973 3300037471 Bacteria 2844
229 Ga0395905_0149423 3300037471 Bacteria 2198
230 Ga0395905_0204868 3300037471 Bacteria 1849
231 Ga0395905_0255859 3300037471 Bacteria 1635
232 Ga0395905_0372828 3300037471 Bacteria 1321
233 Ga0395905_0652267 3300037471 Bacteria 954
234 Ga0395905_0680345 3300037471 Bacteria 931
235 Ga0395905_0855325 3300037471 Bacteria 812
236 Ga0395905_1333315 3300037471 Bacteria 621
237 Ga0395905_1489709 3300037471 Bacteria 581
238 Ga0395901_0023399 3300038443 Bacteria 6333
239 Ga0395901_0063081 3300038443 Bacteria 3856
240 Ga0395901_0183818 3300038443 Bacteria 2192
241 Ga0395901_0729897 3300038443 Bacteria 985
242 Ga0395901_1205213 3300038443 Bacteria 723
243 Ga0395901_1473376 3300038443 Bacteria 637
244 Ga0436365_0312260 3300039437 Bacteria 685
245 Ga0436361_0453555 3300039447 Bacteria 1897
246 Ga0436361_1058946 3300039447 Bacteria 12525
247 Ga0436363_0580023 3300039450 Bacteria 502
248 Ga0451793_0883705 3300041452 Bacteria 666
249 Ga0451795_0792335 3300041456 Bacteria 599
250 Ga0451802_2132343 3300041460 Bacteria 641
251 Ga0451804_0295140 3300041463 Bacteria 692
252 Ga0451807_0897026 3300041486 Bacteria 505
253 Ga0451835_1176097 3300041492 Bacteria 1039
254 Ga0451839_1329149 3300041496 Bacteria 606
255 Ga0451841_1121429 3300041498 Bacteria 571
256 Ga0451849_0869603 3300041505 Bacteria 692
257 Ga0451843_1193035 3300041509 Bacteria 844
258 Ga0451853_1664355 3300041512 Bacteria 1075
259 Ga0451577_0003669 3300042876 Bacteria 16820
260 Ga0451577_1680785 3300042876 Bacteria 559
261 Ga0466969_0008444 3300044656 Bacteria 5464
262 Ga0466969_0084279 3300044656 Bacteria 1513
263 Ga0466972_0034691 3300044658 Bacteria 2470
264 Ga0466972_0229555 3300044658 Bacteria 868
265 Ga0453683_0209652 3300044673 Bacteria 1238
266 Ga0466965_0006466 3300044683 Bacteria 5325
267 Ga0466965_0077698 3300044683 Bacteria 1676
268 Ga0466965_0128348 3300044683 Bacteria 1313
269 Ga0466966_0001925 3300044684 Bacteria 13442
270 Ga0466966_0578804 3300044684 Bacteria 676
271 Ga0466966_0595816 3300044684 Bacteria 665
272 Ga0466961_0004360 3300044693 Bacteria 8865
273 Ga0466961_0206967 3300044693 Bacteria 1212
274 Ga0453684_0355865 3300044712 Bacteria 1650
275 Ga0453684_0408865 3300044712 Bacteria 1518
276 Ga0466968_0350227 3300044735 Bacteria 717
277 Ga0466970_0029580 3300044765 Bacteria 2885
278 Ga0466957_0823331 3300044842 Bacteria 660
279 Ga0466960_0085234 3300044901 Bacteria 1600
280 Ga0466960_0299950 3300044901 Bacteria 905
281 Ga0466959_0003021 3300045049 Bacteria 10871
282 Ga0451576_0821287 3300045051 Bacteria 976
283 Ga0466958_0231149 3300045836 Bacteria 1181
284 Ga0466958_0408766 3300045836 Bacteria 877
285 Ga0466958_0929994 3300045836 Bacteria 567
286 Ga0466967_1355116 3300045976 Bacteria 709
287 Ga0466967_1431540 3300045976 Bacteria 688
288 Ga0495627_068045 3300046453 Bacteria 1044
289 Ga0495638_0015385 3300046460 Bacteria 5139
290 Ga0495651_0257041 3300046462 Bacteria 1190
291 Ga0495605_0383531 3300046474 Bacteria 586
292 Ga0495616_0009599 3300046513 Bacteria 5647
293 Ga0495618_0245051 3300046514 Bacteria 1126
294 Ga0495620_0253720 3300046515 Bacteria 670
295 Ga0495628_0672685 3300046516 Bacteria 733
296 Ga0495631_0000468 3300046518 Bacteria 27243
297 Ga0495637_0010848 3300046520 Bacteria 4392
298 Ga0495643_0385760 3300046522 Bacteria 621
299 Ga0495663_0080863 3300046525 Bacteria 1046
300 Ga0495621_0001103 3300046539 Bacteria 6946
301 Ga0495656_0000559 3300046615 Bacteria 12163
302 Ga0495668_0065366 3300046616 Bacteria 2002
303 Ga0495668_0113640 3300046616 Bacteria 1481
304 Ga0495611_0478056 3300046648 Bacteria 567
305 Ga0495635_0275947 3300046663 Bacteria 1130
306 Ga0495588_0103562 3300046674 Bacteria 1496
307 Ga0495599_0402483 3300046678 Bacteria 815
308 Ga0495646_0290542 3300046680 Bacteria 867
309 Ga0495658_0670027 3300046683 Bacteria 664
310 Ga0495670_0063800 3300046691 Bacteria 1855
311 Ga0495670_0086816 3300046691 Bacteria 1598
312 Ga0495676_0004371 3300047321 Bacteria 12916
313 Ga0495677_0207194 3300047445 Bacteria 763
314 Ga0495593_0004618 3300047673 Bacteria 8187
315 Ga0495602_0968702 3300048088 Bacteria 563
316 Ga0495614_0002560 3300048089 Bacteria 8088
317 Ga0496106_0619720 3300048909 Bacteria 866
318 Ga0496116_0012823 3300048919 Bacteria 6811
319 Ga0496117_0040774 3300048920 Bacteria 3410
320 Ga0496117_0079913 3300048920 Bacteria 2152
321 Ga0496118_0013990 3300048921 Bacteria 7537
322 Ga0496118_0351212 3300048921 Bacteria 786
323 Ga0496121_0055781 3300048924 Bacteria 3288
324 Ga0496122_0155186 3300048925 Bacteria 1406
325 Ga0496122_0277217 3300048925 Bacteria 919
326 Ga0496122_0335434 3300048925 Bacteria 797
327 Ga0496123_0021056 3300048926 Bacteria 5081
328 Ga0496123_0053056 3300048926 Bacteria 2683
329 Ga0496124_0233185 3300048927 Bacteria 1374
330 Ga0496125_0016796 3300048928 Bacteria 7014
331 Ga0496125_0585036 3300048928 Bacteria 612
332 Ga0501308_004974 3300049128 Bacteria 1305
333 Ga0501308_013577 3300049128 Bacteria 943
334 Ga0501304_007010 3300049160 Bacteria 920
335 Ga0501311_064317 3300049527 Bacteria 598
336 Ga0501312_015375 3300049528 Bacteria 1085
337 Ga0501320_022787 3300049536 Bacteria 736
338 Ga0501321_015338 3300049537 Bacteria 901
339 Ga0501032_0567933 3300049569 Bacteria 723
340 Ga0501034_0079268 3300049571 Bacteria 3288
341 Ga0501036_0213304 3300049572 Bacteria 1622
342 Ga0501038_0678219 3300049574 Bacteria 774
343 Ga0501038_1046361 3300049574 Bacteria 598
344 Ga0501043_1078350 3300049579 Bacteria 568
345 Ga0501046_0384642 3300049580 Bacteria 1015
346 Ga0501047_0124678 3300049581 Bacteria 2456
347 Ga0501068_0737578 3300049584 Bacteria 645
348 Ga0501073_0436665 3300049589 Bacteria 905
349 Ga0501074_1317407 3300049590 Bacteria 506
350 Ga0501243_056503 3300049675 Bacteria 719
351 Ga0501249_025244 3300049679 Bacteria 1311
352 Ga0501249_223213 3300049679 Bacteria 503
353 Ga0501083_0823432 3300049744 Bacteria 604
354 Ga0501035_0024159 3300049822 Bacteria 5576
355 Ga0501044_0038221 3300049823 Bacteria 5013
356 nmdc:mga00v17_73943_c1 3300050491 Bacteria 2117
357 nmdc:mga07m45_464583_c1 3300050496 Bacteria 734
358 nmdc:mga07m45_556144_c1 3300050496 Bacteria 663
359 nmdc:mga05p37_2226527_c1 3300050507 Bacteria 508
360 nmdc:mga09592_1080264_c1 3300050508 Bacteria 668
361 nmdc:mga06r32_1016059_c1 3300050510 Bacteria 781
362 Ga0495612_0418309 3300053078 Bacteria 610
363 Ga0500610_0111191 3300053079 Bacteria 1408
364 Ga0500643_042735 3300053087 Bacteria 1324
365 Ga0500651_0000408 3300053093 Bacteria 23280
366 Ga0500560_166999 3300053107 Bacteria 726
367 Ga0500571_000164 3300053110 Bacteria 23351
368 Ga0500572_032422 3300053111 Bacteria 1467
369 Ga0500592_002978 3300053116 Bacteria 2710
370 Ga0500594_0004795 3300053118 Bacteria 2989
371 Ga0500597_163238 3300053120 Bacteria 952
372 Ga0500607_018054 3300053121 Bacteria 4011
373 Ga0500608_015289 3300053122 Bacteria 3445
374 Ga0500626_027895 3300053128 Bacteria 2546
375 Ga0500655_000368 3300053133 Bacteria 9755
376 Ga0500659_0297535 3300053135 Bacteria 727
377 Ga0500559_0015095 3300053136 Bacteria 3264
378 Ga0500559_0018223 3300053136 Bacteria 2967
379 Ga0500561_0311342 3300053137 Bacteria 502
380 Ga0500564_045606 3300053138 Bacteria 2011
381 Ga0500573_0371496 3300053140 Bacteria 687
382 Ga0500573_0503024 3300053140 Bacteria 547
383 Ga0500574_000232 3300053141 Bacteria 6624
384 Ga0500616_0268817 3300053153 Bacteria 720
385 Ga0500624_043325 3300053157 Bacteria 816
386 Ga0500634_0152151 3300053161 Bacteria 1080
387 Ga0500638_080648 3300053162 Bacteria 1545
388 Ga0500636_0002852 3300053177 Bacteria 9653
389 Ga0500625_230474 3300053729 Bacteria 578
390 Ga0500565_048137 3300053734 Bacteria 616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10096492 rootH2_100964923 92
2 3300005334 Ga0068869_101144934 Ga0068869_1011449341 92
3 3300005356 Ga0070674_101088347 Ga0070674_1010883471 92
4 3300005435 Ga0070714_100000080 Ga0070714_10000008072 92
5 3300005459 Ga0068867_100662106 Ga0068867_1006621063 92
6 3300005539 Ga0068853_100740788 Ga0068853_1007407881 92
7 3300005578 Ga0068854_100350510 Ga0068854_1003505102 92
8 3300005616 Ga0068852_102152855 Ga0068852_1021528552 92
9 3300005719 Ga0068861_100354444 Ga0068861_1003544441 92
10 3300005834 Ga0068851_10298051 Ga0068851_102980513 92
11 3300005842 Ga0068858_100000521 Ga0068858_10000052110 92
12 3300006028 Ga0070717_10007432 Ga0070717_100074329 92
13 3300006237 Ga0097621_100836995 Ga0097621_1008369952 92
14 3300009177 Ga0105248_10046295 Ga0105248_100462955 92
15 3300013306 Ga0163162_10143124 Ga0163162_101431243 92
16 3300013306 Ga0163162_11508291 Ga0163162_115082912 92
17 3300014325 Ga0163163_11668885 Ga0163163_116688852 92
18 3300025233 Ga0209437_111209 Ga0209437_1112091 92
19 3300025261 Ga0209233_1000065 Ga0209233_1000065317 92
20 3300025909 Ga0207705_10362720 Ga0207705_103627203 92
21 3300025924 Ga0207694_10007753 Ga0207694_1000775310 92
22 3300025929 Ga0207664_10000011 Ga0207664_10000011210 92
23 3300025937 Ga0207669_11542384 Ga0207669_115423841 92
24 3300025941 Ga0207711_10049111 Ga0207711_100491115 92
25 3300025981 Ga0207640_10344010 Ga0207640_103440103 92
26 3300025986 Ga0207658_11781018 Ga0207658_117810182 92
27 3300026035 Ga0207703_10000123 Ga0207703_1000012331 92
28 3300026035 Ga0207703_10008653 Ga0207703_100086538 92
29 3300026041 Ga0207639_10047179 Ga0207639_100471795 92
30 3300026041 Ga0207639_10672919 Ga0207639_106729193 92
31 3300026089 Ga0207648_10115296 Ga0207648_101152963 92
32 3300026095 Ga0207676_10000971 Ga0207676_100009715 92
33 3300026118 Ga0207675_100365026 Ga0207675_1003650263 92
34 3300026142 Ga0207698_11805577 Ga0207698_118055771 92
35 3300031548 Ga0307408_100562704 Ga0307408_1005627042 92
36 3300031616 Ga0307508_10001175 Ga0307508_1000117513 92
37 3300031824 Ga0307413_11021081 Ga0307413_110210811 92
38 3300032002 Ga0307416_101985799 Ga0307416_1019857992 92
39 3300032005 Ga0307411_11446565 Ga0307411_114465651 92
40 3300041463 Ga0451804_0295140 Ga0451804_0295140_29_310 92
41 3300044656 Ga0466969_0084279 Ga0466969_0084279_558_836 92
42 3300044693 Ga0466961_0206967 Ga0466961_0206967_300_578 92
43 3300044842 Ga0466957_0823331 Ga0466957_0823331_234_512 92
44 3300045976 Ga0466967_1355116 Ga0466967_1355116_92_370 92
45 3300045976 Ga0466967_1431540 Ga0466967_1431540_49_327 92
46 3300046616 Ga0495668_0113640 Ga0495668_0113640_1118_1399 92
47 3300049128 Ga0501308_013577 Ga0501308_013577_483_761 92
48 3300049160 Ga0501304_007010 Ga0501304_007010_168_446 92
49 3300049527 Ga0501311_064317 Ga0501311_064317_47_325 92
50 3300049528 Ga0501312_015375 Ga0501312_015375_325_603 92
51 3300049537 Ga0501321_015338 Ga0501321_015338_440_718 92
52 3300053136 Ga0500559_0018223 Ga0500559_0018223_541_822 92
53 3300053140 Ga0500573_0371496 Ga0500573_0371496_67_348 92
54 3300002773 JGI25152J39213_1020543 JGI25152J39213_10205431 93
55 3300002987 JGI25159J45721_1016460 JGI25159J45721_10164602 93
56 3300003187 JGI25151J46595_10005072 JGI25151J46595_100050724 93
57 3300003322 rootL2_10059075 rootL2_100590753 93
58 3300003784 Ga0055534_1000470 Ga0055534_100047015 93
59 3300003792 Ga0055540_1040250 Ga0055540_10402502 93
60 3300005289 Ga0065704_10343024 Ga0065704_103430241 93
61 3300005327 Ga0070658_10409644 Ga0070658_104096442 93
62 3300005331 Ga0070670_101405784 Ga0070670_1014057841 93
63 3300005333 Ga0070677_10235046 Ga0070677_102350462 93
64 3300005334 Ga0068869_101756576 Ga0068869_1017565762 93
65 3300005338 Ga0068868_101292985 Ga0068868_1012929852 93
66 3300005339 Ga0070660_101382142 Ga0070660_1013821421 93
67 3300005456 Ga0070678_100049226 Ga0070678_1000492265 93
68 3300005458 Ga0070681_11050354 Ga0070681_110503542 93
69 3300005539 Ga0068853_101191740 Ga0068853_1011917402 93
70 3300005548 Ga0070665_100705313 Ga0070665_1007053132 93
71 3300005563 Ga0068855_100272449 Ga0068855_1002724493 93
72 3300005563 Ga0068855_100437413 Ga0068855_1004374132 93
73 3300005614 Ga0068856_100219675 Ga0068856_1002196752 93
74 3300005617 Ga0068859_101465958 Ga0068859_1014659582 93
75 3300005841 Ga0068863_100890307 Ga0068863_1008903072 93
76 3300005844 Ga0068862_100135186 Ga0068862_1001351863 93
77 3300006038 Ga0075365_10312270 Ga0075365_103122702 93
78 3300006038 Ga0075365_11108328 Ga0075365_111083282 93
79 3300006042 Ga0075368_10090832 Ga0075368_100908322 93
80 3300006048 Ga0075363_100075213 Ga0075363_1000752132 93
81 3300006048 Ga0075363_100255476 Ga0075363_1002554762 93
82 3300006051 Ga0075364_10068852 Ga0075364_100688523 93
83 3300006195 Ga0075366_10046622 Ga0075366_100466221 93
84 3300006237 Ga0097621_101425465 Ga0097621_1014254651 93
85 3300006353 Ga0075370_10106411 Ga0075370_101064112 93
86 3300006353 Ga0075370_10538679 Ga0075370_105386792 93
87 3300006931 Ga0097620_101466186 Ga0097620_1014661862 93
88 3300009093 Ga0105240_10522977 Ga0105240_105229772 93
89 3300013306 Ga0163162_11742149 Ga0163162_117421491 93
90 3300014326 Ga0157380_11861924 Ga0157380_118619242 93
91 3300014497 Ga0182008_10072956 Ga0182008_100729562 93
92 3300014497 Ga0182008_10920271 Ga0182008_109202712 93
93 3300014969 Ga0157376_11267506 Ga0157376_112675061 93
94 3300014969 Ga0157376_12832798 Ga0157376_128327982 93
95 3300015262 Ga0182007_10262881 Ga0182007_102628812 93
96 3300015683 Ga0183362_10001 Ga0183362_100011899 93
97 3300017792 Ga0163161_10090606 Ga0163161_100906062 93
98 3300025258 Ga0209129_1002746 Ga0209129_10027465 93
99 3300025284 Ga0209130_1001759 Ga0209130_10017599 93
100 3300025291 Ga0209675_1000573 Ga0209675_100057319 93
101 3300025292 Ga0209676_1004841 Ga0209676_10048414 93
102 3300025294 Ga0209025_1000168 Ga0209025_100016828 93
103 3300025298 Ga0209050_1013938 Ga0209050_10139384 93
104 3300025303 Ga0209051_1012524 Ga0209051_10125242 93
105 3300025304 Ga0209257_1005826 Ga0209257_10058265 93
106 3300025901 Ga0207688_10819701 Ga0207688_108197011 93
107 3300025909 Ga0207705_11034454 Ga0207705_110344542 93
108 3300025913 Ga0207695_10645404 Ga0207695_106454041 93
109 3300025917 Ga0207660_11284121 Ga0207660_112841211 93
110 3300025919 Ga0207657_10356243 Ga0207657_103562431 93
111 3300025935 Ga0207709_10055131 Ga0207709_100551312 93
112 3300025940 Ga0207691_11293810 Ga0207691_112938101 93
113 3300025942 Ga0207689_10195913 Ga0207689_101959132 93
114 3300025972 Ga0207668_10434741 Ga0207668_104347411 93
115 3300025986 Ga0207658_11022965 Ga0207658_110229652 93
116 3300026041 Ga0207639_10917815 Ga0207639_109178152 93
117 3300026078 Ga0207702_10194079 Ga0207702_101940792 93
118 3300026121 Ga0207683_10046895 Ga0207683_100468955 93
119 3300027526 Ga0209968_1061312 Ga0209968_10613121 93
120 3300027876 Ga0209974_10091315 Ga0209974_100913152 93
121 3300028379 Ga0268266_10558157 Ga0268266_105581572 93
122 3300028380 Ga0268265_10009258 Ga0268265_1000925812 93
123 3300031251 Ga0265327_10007341 Ga0265327_100073414 93
124 3300031548 Ga0307408_100721734 Ga0307408_1007217342 93
125 3300031824 Ga0307413_11035218 Ga0307413_110352181 93
126 3300031901 Ga0307406_11288329 Ga0307406_112883292 93
127 3300031911 Ga0307412_10728329 Ga0307412_107283292 93
128 3300032005 Ga0307411_10173118 Ga0307411_101731182 93
129 3300037312 Ga0395899_0008411 Ga0395899_0008411_4511_4792 93
130 3300037312 Ga0395899_0082069 Ga0395899_0082069_1758_2039 93
131 3300037418 Ga0395900_0057803 Ga0395900_0057803_149_430 93
132 3300037418 Ga0395900_0142769 Ga0395900_0142769_1460_1741 93
133 3300037418 Ga0395900_0802662 Ga0395900_0802662_332_616 93
134 3300037418 Ga0395900_1230155 Ga0395900_1230155_112_459 93
135 3300037418 Ga0395900_1695293 Ga0395900_1695293_141_422 93
136 3300037466 Ga0395898_0043400 Ga0395898_0043400_1371_1652 93
137 3300037466 Ga0395898_0094356 Ga0395898_0094356_117_398 93
138 3300037466 Ga0395898_0144382 Ga0395898_0144382_1059_1346 93
139 3300037471 Ga0395905_0000065 Ga0395905_0000065_10825_11166 93
140 3300037471 Ga0395905_0001008 Ga0395905_0001008_3808_4089 93
141 3300037471 Ga0395905_0009516 Ga0395905_0009516_1739_2020 93
142 3300037471 Ga0395905_0082710 Ga0395905_0082710_2141_2422 93
143 3300037471 Ga0395905_0091973 Ga0395905_0091973_1531_1815 93
144 3300037471 Ga0395905_0149423 Ga0395905_0149423_962_1243 93
145 3300037471 Ga0395905_0204868 Ga0395905_0204868_1498_1779 93
146 3300037471 Ga0395905_0255859 Ga0395905_0255859_170_451 93
147 3300037471 Ga0395905_0372828 Ga0395905_0372828_846_1127 93
148 3300037471 Ga0395905_0652267 Ga0395905_0652267_68_349 93
149 3300037471 Ga0395905_0680345 Ga0395905_0680345_191_472 93
150 3300037471 Ga0395905_0855325 Ga0395905_0855325_419_700 93
151 3300037471 Ga0395905_1333315 Ga0395905_1333315_31_312 93
152 3300037471 Ga0395905_1489709 Ga0395905_1489709_85_366 93
153 3300038443 Ga0395901_0023399 Ga0395901_0023399_3257_3538 93
154 3300038443 Ga0395901_0063081 Ga0395901_0063081_2830_3111 93
155 3300038443 Ga0395901_0183818 Ga0395901_0183818_1763_2044 93
156 3300038443 Ga0395901_0729897 Ga0395901_0729897_392_673 93
157 3300038443 Ga0395901_1205213 Ga0395901_1205213_208_489 93
158 3300038443 Ga0395901_1473376 Ga0395901_1473376_164_445 93
159 3300039437 Ga0436365_0312260 Ga0436365_0312260_226_507 93
160 3300039450 Ga0436363_0580023 Ga0436363_0580023_100_381 93
161 3300041452 Ga0451793_0883705 Ga0451793_0883705_114_395 93
162 3300041460 Ga0451802_2132343 Ga0451802_2132343_126_407 93
163 3300041486 Ga0451807_0897026 Ga0451807_0897026_151_432 93
164 3300041492 Ga0451835_1176097 Ga0451835_1176097_124_405 93
165 3300041505 Ga0451849_0869603 Ga0451849_0869603_262_543 93
166 3300041512 Ga0451853_1664355 Ga0451853_1664355_413_694 93
167 3300042876 Ga0451577_0003669 Ga0451577_0003669_3669_3950 93
168 3300042876 Ga0451577_1680785 Ga0451577_1680785_114_395 93
169 3300044656 Ga0466969_0008444 Ga0466969_0008444_4072_4353 93
170 3300044658 Ga0466972_0034691 Ga0466972_0034691_1983_2264 93
171 3300044658 Ga0466972_0229555 Ga0466972_0229555_297_578 93
172 3300044673 Ga0453683_0209652 Ga0453683_0209652_302_583 93
173 3300044683 Ga0466965_0006466 Ga0466965_0006466_2710_2991 93
174 3300044683 Ga0466965_0077698 Ga0466965_0077698_485_769 93
175 3300044683 Ga0466965_0128348 Ga0466965_0128348_337_618 93
176 3300044684 Ga0466966_0001925 Ga0466966_0001925_1357_1638 93
177 3300044684 Ga0466966_0578804 Ga0466966_0578804_14_361 93
178 3300044684 Ga0466966_0595816 Ga0466966_0595816_39_320 93
179 3300044693 Ga0466961_0004360 Ga0466961_0004360_898_1179 93
180 3300044712 Ga0453684_0355865 Ga0453684_0355865_938_1219 93
181 3300044712 Ga0453684_0408865 Ga0453684_0408865_68_349 93
182 3300044735 Ga0466968_0350227 Ga0466968_0350227_279_560 93
183 3300044765 Ga0466970_0029580 Ga0466970_0029580_2248_2529 93
184 3300044901 Ga0466960_0085234 Ga0466960_0085234_758_1042 93
185 3300044901 Ga0466960_0299950 Ga0466960_0299950_152_433 93
186 3300045049 Ga0466959_0003021 Ga0466959_0003021_3903_4184 93
187 3300045051 Ga0451576_0821287 Ga0451576_0821287_566_847 93
188 3300045836 Ga0466958_0231149 Ga0466958_0231149_867_1148 93
189 3300045836 Ga0466958_0408766 Ga0466958_0408766_82_363 93
190 3300045836 Ga0466958_0929994 Ga0466958_0929994_121_402 93
191 3300046462 Ga0495651_0257041 Ga0495651_0257041_478_759 93
192 3300046514 Ga0495618_0245051 Ga0495618_0245051_416_697 93
193 3300046522 Ga0495643_0385760 Ga0495643_0385760_67_348 93
194 3300046525 Ga0495663_0080863 Ga0495663_0080863_175_456 93
195 3300046615 Ga0495656_0000559 Ga0495656_0000559_11248_11529 93
196 3300046678 Ga0495599_0402483 Ga0495599_0402483_469_750 93
197 3300046691 Ga0495670_0063800 Ga0495670_0063800_1069_1350 93
198 3300046691 Ga0495670_0086816 Ga0495670_0086816_806_1087 93
199 3300047445 Ga0495677_0207194 Ga0495677_0207194_422_703 93
200 3300048909 Ga0496106_0619720 Ga0496106_0619720_307_588 93
201 3300049128 Ga0501308_004974 Ga0501308_004974_846_1127 93
202 3300049536 Ga0501320_022787 Ga0501320_022787_417_698 93
203 3300049569 Ga0501032_0567933 Ga0501032_0567933_412_693 93
204 3300049571 Ga0501034_0079268 Ga0501034_0079268_1420_1701 93
205 3300049572 Ga0501036_0213304 Ga0501036_0213304_985_1266 93
206 3300049574 Ga0501038_0678219 Ga0501038_0678219_132_413 93
207 3300049574 Ga0501038_1046361 Ga0501038_1046361_96_377 93
208 3300049579 Ga0501043_1078350 Ga0501043_1078350_223_504 93
209 3300049580 Ga0501046_0384642 Ga0501046_0384642_419_700 93
210 3300049581 Ga0501047_0124678 Ga0501047_0124678_324_605 93
211 3300049584 Ga0501068_0737578 Ga0501068_0737578_342_623 93
212 3300049589 Ga0501073_0436665 Ga0501073_0436665_81_362 93
213 3300049590 Ga0501074_1317407 Ga0501074_1317407_205_486 93
214 3300049675 Ga0501243_056503 Ga0501243_056503_21_302 93
215 3300049679 Ga0501249_025244 Ga0501249_025244_858_1139 93
216 3300049679 Ga0501249_223213 Ga0501249_223213_21_302 93
217 3300049744 Ga0501083_0823432 Ga0501083_0823432_68_349 93
218 3300049822 Ga0501035_0024159 Ga0501035_0024159_603_884 93
219 3300049823 Ga0501044_0038221 Ga0501044_0038221_3855_4136 93
220 3300050491 nmdc:mga00v17_73943_c1 nmdc:mga00v17_73943_c1_1065_1346 93
221 3300050496 nmdc:mga07m45_556144_c1 nmdc:mga07m45_556144_c1_178_459 93
222 3300053079 Ga0500610_0111191 Ga0500610_0111191_995_1276 93
223 3300001979 JGI24740J21852_10013261 JGI24740J21852_100132615 94
224 3300001979 JGI24740J21852_10161463 JGI24740J21852_101614631 94
225 3300001989 JGI24739J22299_10194687 JGI24739J22299_101946872 94
226 3300002739 JGI25158J39367_1015512 JGI25158J39367_10155121 94
227 3300002773 JGI25152J39213_1008319 JGI25152J39213_10083192 94
228 3300002774 JGI25150J39212_1001117 JGI25150J39212_10011176 94
229 3300002774 JGI25150J39212_1018497 JGI25150J39212_10184971 94
230 3300002987 JGI25159J45721_1009413 JGI25159J45721_10094132 94
231 3300003187 JGI25151J46595_10022902 JGI25151J46595_100229022 94
232 3300003187 JGI25151J46595_10080164 JGI25151J46595_100801642 94
233 3300003215 JGI25153J46596_10005995 JGI25153J46596_100059956 94
234 3300003316 rootH1_10007508 rootH1_100075084 94
235 3300003322 rootL2_10105431 rootL2_101054313 94
236 3300003323 rootH1_10074780 rootH1_100747801 94
237 3300003354 JGI25160J50197_1014848 JGI25160J50197_10148482 94
238 3300003354 JGI25160J50197_1020274 JGI25160J50197_10202744 94
239 3300003374 JGI25161J50226_1005030 JGI25161J50226_10050302 94
240 3300003374 JGI25161J50226_1010083 JGI25161J50226_10100832 94
241 3300003578 Ga0006562J51391_1111152 Ga0006562J51391_11111522 94
242 3300003761 Ga0055535_1001087 Ga0055535_10010871 94
243 3300003762 Ga0055542_1000268 Ga0055542_100026865 94
244 3300003771 Ga0055526_1018600 Ga0055526_10186002 94
245 3300003771 Ga0055526_1033061 Ga0055526_10330612 94
246 3300003773 Ga0055537_1002199 Ga0055537_10021996 94
247 3300003773 Ga0055537_1024004 Ga0055537_10240042 94
248 3300003775 Ga0055524_1002044 Ga0055524_100204415 94
249 3300003775 Ga0055524_1016981 Ga0055524_10169812 94
250 3300003781 Ga0055536_1029696 Ga0055536_10296961 94
251 3300003781 Ga0055536_1034878 Ga0055536_10348782 94
252 3300003784 Ga0055534_1001529 Ga0055534_10015299 94
253 3300003790 Ga0055528_1004413 Ga0055528_10044136 94
254 3300003790 Ga0055528_1049537 Ga0055528_10495372 94
255 3300003791 Ga0055530_10028781 Ga0055530_100287811 94
256 3300003791 Ga0055530_10041423 Ga0055530_100414232 94
257 3300003792 Ga0055540_1008782 Ga0055540_10087822 94
258 3300003792 Ga0055540_1025935 Ga0055540_10259352 94
259 3300003794 Ga0055531_10020771 Ga0055531_100207712 94
260 3300003794 Ga0055531_10038245 Ga0055531_100382451 94
261 3300004625 Ga0055543_1001564 Ga0055543_10015642 94
262 3300004625 Ga0055543_1014384 Ga0055543_10143843 94
263 3300005262 Ga0065165_1004228 Ga0065165_10042282 94
264 3300005262 Ga0065165_1101683 Ga0065165_11016831 94
265 3300005335 Ga0070666_10417888 Ga0070666_104178881 94
266 3300005539 Ga0068853_100305141 Ga0068853_1003051411 94
267 3300005578 Ga0068854_100342969 Ga0068854_1003429692 94
268 3300005614 Ga0068856_101979587 Ga0068856_1019795871 94
269 3300005834 Ga0068851_10055973 Ga0068851_100559733 94
270 3300006353 Ga0075370_10277433 Ga0075370_102774332 94
271 3300006847 Ga0075431_101004654 Ga0075431_1010046542 94
272 3300009093 Ga0105240_10238713 Ga0105240_102387134 94
273 3300009147 Ga0114129_12093739 Ga0114129_120937392 94
274 3300010375 Ga0105239_12320982 Ga0105239_123209821 94
275 3300012502 Ga0157347_1012429 Ga0157347_10124291 94
276 3300013102 Ga0157371_10027032 Ga0157371_100270321 94
277 3300013104 Ga0157370_10363275 Ga0157370_103632751 94
278 3300013105 Ga0157369_11727978 Ga0157369_117279781 94
279 3300013307 Ga0157372_10118029 Ga0157372_101180295 94
280 3300017792 Ga0163161_10096972 Ga0163161_100969721 94
281 3300021361 Ga0213872_10000118 Ga0213872_1000011817 94
282 3300025208 Ga0209436_108961 Ga0209436_1089613 94
283 3300025208 Ga0209436_120492 Ga0209436_1204922 94
284 3300025228 Ga0209672_101202 Ga0209672_1012021 94
285 3300025229 Ga0209147_103999 Ga0209147_1039994 94
286 3300025242 Ga0209258_100009 Ga0209258_100009230 94
287 3300025245 Ga0207425_1002575 Ga0207425_10025756 94
288 3300025245 Ga0207425_1018990 Ga0207425_10189903 94
289 3300025254 Ga0209148_1000007 Ga0209148_1000007230 94
290 3300025258 Ga0209129_1000013 Ga0209129_1000013413 94
291 3300025258 Ga0209129_1010658 Ga0209129_10106583 94
292 3300025263 Ga0209565_1000228 Ga0209565_10002289 94
293 3300025263 Ga0209565_1019815 Ga0209565_10198152 94
294 3300025263 Ga0209565_1022927 Ga0209565_10229271 94
295 3300025273 Ga0209673_1000309 Ga0209673_100030940 94
296 3300025273 Ga0209673_1000329 Ga0209673_100032941 94
297 3300025273 Ga0209673_1042127 Ga0209673_10421271 94
298 3300025284 Ga0209130_1000284 Ga0209130_100028458 94
299 3300025284 Ga0209130_1000489 Ga0209130_10004895 94
300 3300025291 Ga0209675_1000238 Ga0209675_100023821 94
301 3300025291 Ga0209675_1002901 Ga0209675_10029011 94
302 3300025292 Ga0209676_1000004 Ga0209676_1000004271 94
303 3300025292 Ga0209676_1035944 Ga0209676_10359441 94
304 3300025294 Ga0209025_1000393 Ga0209025_100039361 94
305 3300025294 Ga0209025_1084659 Ga0209025_10846592 94
306 3300025295 Ga0209564_1000222 Ga0209564_100022281 94
307 3300025295 Ga0209564_1000287 Ga0209564_100028779 94
308 3300025297 Ga0209758_1000134 Ga0209758_1000134123 94
309 3300025297 Ga0209758_1021018 Ga0209758_10210185 94
310 3300025298 Ga0209050_1000002 Ga0209050_1000002781 94
311 3300025298 Ga0209050_1019909 Ga0209050_10199091 94
312 3300025299 Ga0209256_1000060 Ga0209256_1000060190 94
313 3300025299 Ga0209256_1000472 Ga0209256_100047211 94
314 3300025302 Ga0207426_1000095 Ga0207426_1000095118 94
315 3300025302 Ga0207426_1000100 Ga0207426_1000100190 94
316 3300025303 Ga0209051_1000002 Ga0209051_1000002549 94
317 3300025303 Ga0209051_1145310 Ga0209051_11453101 94
318 3300025304 Ga0209257_1000002 Ga0209257_1000002690 94
319 3300025304 Ga0209257_1000286 Ga0209257_100028668 94
320 3300025321 Ga0207656_10003062 Ga0207656_1000306210 94
321 3300026041 Ga0207639_11485749 Ga0207639_114857491 94
322 3300039447 Ga0436361_0453555 Ga0436361_0453555_315_599 94
323 3300039447 Ga0436361_1058946 Ga0436361_1058946_8517_8801 94
324 3300041456 Ga0451795_0792335 Ga0451795_0792335_110_394 94
325 3300041496 Ga0451839_1329149 Ga0451839_1329149_137_421 94
326 3300041498 Ga0451841_1121429 Ga0451841_1121429_267_551 94
327 3300041509 Ga0451843_1193035 Ga0451843_1193035_333_617 94
328 3300046453 Ga0495627_068045 Ga0495627_068045_307_591 94
329 3300046460 Ga0495638_0015385 Ga0495638_0015385_148_432 94
330 3300046474 Ga0495605_0383531 Ga0495605_0383531_177_461 94
331 3300046513 Ga0495616_0009599 Ga0495616_0009599_1909_2193 94
332 3300046515 Ga0495620_0253720 Ga0495620_0253720_97_381 94
333 3300046516 Ga0495628_0672685 Ga0495628_0672685_37_321 94
334 3300046518 Ga0495631_0000468 Ga0495631_0000468_479_763 94
335 3300046520 Ga0495637_0010848 Ga0495637_0010848_3934_4218 94
336 3300046539 Ga0495621_0001103 Ga0495621_0001103_223_507 94
337 3300046616 Ga0495668_0065366 Ga0495668_0065366_119_403 94
338 3300046648 Ga0495611_0478056 Ga0495611_0478056_49_333 94
339 3300046663 Ga0495635_0275947 Ga0495635_0275947_262_546 94
340 3300046674 Ga0495588_0103562 Ga0495588_0103562_356_640 94
341 3300046680 Ga0495646_0290542 Ga0495646_0290542_378_662 94
342 3300046683 Ga0495658_0670027 Ga0495658_0670027_264_548 94
343 3300047321 Ga0495676_0004371 Ga0495676_0004371_2078_2362 94
344 3300047673 Ga0495593_0004618 Ga0495593_0004618_7635_7919 94
345 3300048088 Ga0495602_0968702 Ga0495602_0968702_77_361 94
346 3300048089 Ga0495614_0002560 Ga0495614_0002560_7641_7925 94
347 3300048919 Ga0496116_0012823 Ga0496116_0012823_406_690 94
348 3300048920 Ga0496117_0040774 Ga0496117_0040774_364_648 94
349 3300048920 Ga0496117_0079913 Ga0496117_0079913_253_537 94
350 3300048921 Ga0496118_0013990 Ga0496118_0013990_6922_7206 94
351 3300048921 Ga0496118_0351212 Ga0496118_0351212_133_417 94
352 3300048924 Ga0496121_0055781 Ga0496121_0055781_290_574 94
353 3300048925 Ga0496122_0155186 Ga0496122_0155186_1059_1343 94
354 3300048925 Ga0496122_0277217 Ga0496122_0277217_288_572 94
355 3300048925 Ga0496122_0335434 Ga0496122_0335434_490_774 94
356 3300048926 Ga0496123_0021056 Ga0496123_0021056_2155_2439 94
357 3300048926 Ga0496123_0053056 Ga0496123_0053056_2349_2633 94
358 3300048927 Ga0496124_0233185 Ga0496124_0233185_213_497 94
359 3300048928 Ga0496125_0016796 Ga0496125_0016796_6522_6806 94
360 3300048928 Ga0496125_0585036 Ga0496125_0585036_286_570 94
361 3300050496 nmdc:mga07m45_464583_c1 nmdc:mga07m45_464583_c1_426_710 94
362 3300050507 nmdc:mga05p37_2226527_c1 nmdc:mga05p37_2226527_c1_168_461 94
363 3300050508 nmdc:mga09592_1080264_c1 nmdc:mga09592_1080264_c1_14_307 94
364 3300050510 nmdc:mga06r32_1016059_c1 nmdc:mga06r32_1016059_c1_321_614 94
365 3300053078 Ga0495612_0418309 Ga0495612_0418309_118_402 94
366 3300053087 Ga0500643_042735 Ga0500643_042735_405_689 94
367 3300053093 Ga0500651_0000408 Ga0500651_0000408_579_863 94
368 3300053107 Ga0500560_166999 Ga0500560_166999_270_554 94
369 3300053110 Ga0500571_000164 Ga0500571_000164_462_746 94
370 3300053111 Ga0500572_032422 Ga0500572_032422_588_872 94
371 3300053116 Ga0500592_002978 Ga0500592_002978_103_387 94
372 3300053118 Ga0500594_0004795 Ga0500594_0004795_213_497 94
373 3300053120 Ga0500597_163238 Ga0500597_163238_534_818 94
374 3300053121 Ga0500607_018054 Ga0500607_018054_676_960 94
375 3300053122 Ga0500608_015289 Ga0500608_015289_2886_3170 94
376 3300053128 Ga0500626_027895 Ga0500626_027895_1567_1851 94
377 3300053133 Ga0500655_000368 Ga0500655_000368_9158_9442 94
378 3300053135 Ga0500659_0297535 Ga0500659_0297535_424_708 94
379 3300053136 Ga0500559_0015095 Ga0500559_0015095_987_1271 94
380 3300053137 Ga0500561_0311342 Ga0500561_0311342_85_369 94
381 3300053138 Ga0500564_045606 Ga0500564_045606_244_528 94
382 3300053140 Ga0500573_0503024 Ga0500573_0503024_201_485 94
383 3300053141 Ga0500574_000232 Ga0500574_000232_84_368 94
384 3300053153 Ga0500616_0268817 Ga0500616_0268817_114_398 94
385 3300053157 Ga0500624_043325 Ga0500624_043325_270_554 94
386 3300053161 Ga0500634_0152151 Ga0500634_0152151_484_768 94
387 3300053162 Ga0500638_080648 Ga0500638_080648_329_613 94
388 3300053177 Ga0500636_0002852 Ga0500636_0002852_26_310 94
389 3300053729 Ga0500625_230474 Ga0500625_230474_182_466 94
390 3300053734 Ga0500565_048137 Ga0500565_048137_123_407 94

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04248

NTP_transf_9

Domain of unknown function (DUF427)

23

110

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3djm-assembly5.cif.gz_E crystal structure of a protein of unknown function from duf427 family (rsph17029_0682) from rhodobacter sphaeroides 2.4.1 at 2.51 a resolution 0.9228 2 89
3djm-assembly5.cif.gz_E crystal structure of a protein of unknown function from duf427 family (rsph17029_0682) from rhodobacter sphaeroides 2.4.1 at 2.51 a resolution 0.8579 2 89
7sfz-assembly2.cif.gz_C crystal structure of mis18a-yippee domain 0.7187 2 85
7sfz-assembly2.cif.gz_D crystal structure of mis18a-yippee domain 0.6963 1 85
7sfz-assembly4.cif.gz_G crystal structure of mis18a-yippee domain 0.6567 2 89
ID Description Score Start End Superfamily
af_O53917_1_97_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9952 2 93 2.170.150.40
af_O53917_1_97_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9639 2 93 2.170.150.40
af_O53404_128_241_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.913 2 91 2.170.150.40
af_P96817_9_123_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9066 2 91 2.170.150.40
3djmD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9036 2 89 2.170.150.40
ID Description Score Start End GO Terms
AF-W9G7T8-F1-model_v4 DUF427 domain-containing protein 1.005 1 93
AF-A0A7V9GX00-F1-model_v4 DUF427 domain-containing protein 1.005 1 94
AF-A0A7W1RPD8-F1-model_v4 Cysteine desulfurase-like protein 1.005 2 92
AF-A0A507EPZ4-F1-model_v4 DUF427 domain-containing protein 1.005 2 86
AF-A0A6M1QNQ3-F1-model_v4 deleted 1.004 2 94

Feature Viewer

pLDDT pTM Quality
96.44 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map