F431744

General Info

Members Datasets Scaffolds Average Seq Length
390 224 389 141

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10108081|Ga0207707_101080812
Length 143
Sequence MPTRKAHARWEGSIKEGRGKVDFGNGAVQAAYSFASRFEDGKGTNPEELLGAAHASCFAMALSLMLGKAGFKPDYIDATAHVTISPQGEGFKITKSRLVCEAGVPGIDPKTFMRHAESAKASCPVSQALAGTEITLEAGLAGG

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
105 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
116 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
117 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 2.82
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 4.36
Rhizosphere 93.85
Stem 0
Stem Tuber 0
Unclassified 1.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10007577 3300003911 Bacteria 2004
2 Ga0070676_10648727 3300005328 Bacteria 766
3 Ga0070666_10073861 3300005335 Bacteria 2323
4 Ga0070680_100674296 3300005336 Bacteria 889
5 Ga0070680_100971450 3300005336 Bacteria 733
6 Ga0070661_100068950 3300005344 Bacteria 2599
7 Ga0070668_100030792 3300005347 Bacteria 4082
8 Ga0070674_100549213 3300005356 Bacteria 969
9 Ga0070659_101454278 3300005366 Bacteria 610
10 Ga0070667_100344811 3300005367 Bacteria 1347
11 Ga0070714_100163439 3300005435 Bacteria 2016
12 Ga0070714_100566205 3300005435 Bacteria 1089
13 Ga0070713_100218337 3300005436 Bacteria 1729
14 Ga0070713_100826661 3300005436 Bacteria 889
15 Ga0070713_100883454 3300005436 Bacteria 859
16 Ga0070710_10054624 3300005437 Bacteria 2254
17 Ga0070711_100075838 3300005439 Bacteria 2382
18 Ga0070711_100170115 3300005439 Bacteria 1660
19 Ga0070711_100458120 3300005439 Bacteria 1045
20 Ga0070711_100688173 3300005439 Bacteria 860
21 Ga0070711_101661806 3300005439 Bacteria 559
22 Ga0070708_100308688 3300005445 Bacteria 1490
23 Ga0070663_100309054 3300005455 Bacteria 1268
24 Ga0070678_100051792 3300005456 Bacteria 2977
25 Ga0070681_10050253 3300005458 Bacteria 4161
26 Ga0070681_10086498 3300005458 Bacteria 3088
27 Ga0070706_100317442 3300005467 Unclassified 1453
28 Ga0070698_100507782 3300005471 Bacteria 1144
29 Ga0070679_100248518 3300005530 Bacteria 1735
30 Ga0070684_100531623 3300005535 Bacteria 1090
31 Ga0068853_101655233 3300005539 Bacteria 620
32 Ga0070695_100246279 3300005545 Bacteria 1299
33 Ga0068851_10513069 3300005834 Bacteria 720
34 Ga0068858_100430358 3300005842 Bacteria 1270
35 Ga0068860_100000139 3300005843 Bacteria 119188
36 Ga0081455_10004151 3300005937 Bacteria 16351
37 Ga0081455_10027910 3300005937 Bacteria 5165
38 Ga0081540_1036277 3300005983 Bacteria 2631
39 Ga0070717_10007659 3300006028 Bacteria 8028
40 Ga0075432_10000371 3300006058 Bacteria 12975
41 Ga0070715_10050994 3300006163 Bacteria 1778
42 Ga0070715_10150984 3300006163 Bacteria 1138
43 Ga0070715_10514780 3300006163 Unclassified 687
44 Ga0070716_100065461 3300006173 Bacteria 2117
45 Ga0070712_100003153 3300006175 Bacteria 10157
46 Ga0070712_100140727 3300006175 Bacteria 1841
47 Ga0070712_100293639 3300006175 Bacteria 1313
48 Ga0075367_10252565 3300006178 Bacteria 1106
49 Ga0075427_10000614 3300006194 Bacteria 4171
50 Ga0097621_100030060 3300006237 Bacteria 4297
51 Ga0097621_100117656 3300006237 Bacteria 2252
52 Ga0075428_100022068 3300006844 Bacteria 7048
53 Ga0075430_100005927 3300006846 Bacteria 10322
54 Ga0075431_100010592 3300006847 Bacteria 9273
55 Ga0075433_10000016 3300006852 Bacteria 67444
56 Ga0075433_10240372 3300006852 Bacteria 1607
57 Ga0075434_100022778 3300006871 Bacteria 6100
58 Ga0075434_100041713 3300006871 Bacteria 4546
59 Ga0075434_100123820 3300006871 Bacteria 2602
60 Ga0075429_100005305 3300006880 Bacteria 11093
61 Ga0075436_100063747 3300006914 Bacteria 2547
62 Ga0075436_100407015 3300006914 Bacteria 986
63 Ga0075435_100005033 3300007076 Bacteria 9181
64 Ga0075435_100571664 3300007076 Bacteria 979
65 Ga0099794_10311825 3300007265 Bacteria 815
66 Ga0099795_10001572 3300007788 Bacteria 5028
67 Ga0105240_10349445 3300009093 Bacteria 1678
68 Ga0111539_10013241 3300009094 Bacteria 10309
69 Ga0111539_10304609 3300009094 Bacteria 1854
70 Ga0105245_10032735 3300009098 Bacteria 4603
71 Ga0114129_10015047 3300009147 Bacteria 11012
72 Ga0114129_10076974 3300009147 Bacteria 4642
73 Ga0105241_11914394 3300009174 Bacteria 581
74 Ga0105242_10052807 3300009176 Bacteria 3318
75 Ga0105248_10036293 3300009177 Bacteria 5513
76 Ga0105248_10384043 3300009177 Bacteria 1581
77 Ga0105248_11887317 3300009177 Bacteria 678
78 Ga0105237_10042422 3300009545 Bacteria 4587
79 Ga0105238_10168504 3300009551 Bacteria 2166
80 Ga0105239_10419636 3300010375 Bacteria 1515
81 Ga0157374_10769422 3300013296 Bacteria 978
82 Ga0157378_11090060 3300013297 Bacteria 835
83 Ga0163162_10609504 3300013306 Bacteria 1217
84 Ga0157372_12942386 3300013307 Bacteria 545
85 Ga0157379_10546383 3300014968 Bacteria 1077
86 Ga0197907_10229620 3300020069 Bacteria 598
87 Ga0206351_10950140 3300020077 Bacteria 644
88 Ga0213876_10335826 3300021384 Bacteria 803
89 Ga0213871_10074452 3300021441 Bacteria 964
90 Ga0213871_10240097 3300021441 Bacteria 573
91 Ga0224712_10215573 3300022467 Bacteria 877
92 Ga0224572_1008093 3300024225 Bacteria 1941
93 Ga0224572_1008727 3300024225 Bacteria 1879
94 Ga0207692_10014777 3300025898 Bacteria 3418
95 Ga0207680_10198632 3300025903 Bacteria 1365
96 Ga0207685_10138709 3300025905 Bacteria 1088
97 Ga0207685_10225563 3300025905 Bacteria 893
98 Ga0207685_10462650 3300025905 Unclassified 661
99 Ga0207699_10349459 3300025906 Bacteria 1044
100 Ga0207645_10183037 3300025907 Bacteria 1375
101 Ga0207707_10026453 3300025912 Bacteria 5071
102 Ga0207707_10108081 3300025912 Bacteria 2432
103 Ga0207671_10596098 3300025914 Bacteria 881
104 Ga0207693_10043495 3300025915 Bacteria 3533
105 Ga0207693_10108350 3300025915 Bacteria 2179
106 Ga0207693_10281579 3300025915 Bacteria 1303
107 Ga0207693_10947229 3300025915 Bacteria 659
108 Ga0207663_10379671 3300025916 Bacteria 1076
109 Ga0207663_10422990 3300025916 Bacteria 1023
110 Ga0207663_11256227 3300025916 Bacteria 596
111 Ga0207660_10311933 3300025917 Bacteria 1254
112 Ga0207662_10249858 3300025918 Bacteria 1164
113 Ga0207649_10015752 3300025920 Bacteria 4249
114 Ga0207652_10431886 3300025921 Bacteria 1188
115 Ga0207652_11063685 3300025921 Bacteria 709
116 Ga0207646_10643331 3300025922 Bacteria 950
117 Ga0207646_11227670 3300025922 Bacteria 657
118 Ga0207694_10385644 3300025924 Bacteria 1163
119 Ga0207687_10020875 3300025927 Bacteria 4347
120 Ga0207700_10127939 3300025928 Bacteria 2069
121 Ga0207700_10840722 3300025928 Bacteria 821
122 Ga0207644_10073261 3300025931 Bacteria 2511
123 Ga0207686_10007984 3300025934 Bacteria 5706
124 Ga0207665_10101716 3300025939 Bacteria 2007
125 Ga0207711_10295599 3300025941 Bacteria 1493
126 Ga0207711_10323346 3300025941 Bacteria 1426
127 Ga0207679_10244295 3300025945 Bacteria 1523
128 Ga0207668_10051441 3300025972 Bacteria 2845
129 Ga0207658_10675059 3300025986 Bacteria 932
130 Ga0207703_10603291 3300026035 Bacteria 1038
131 Ga0207678_10128581 3300026067 Bacteria 2160
132 Ga0207683_10010061 3300026121 Bacteria 8069
133 Ga0209981_1000240 3300027378 Bacteria 7048
134 Ga0209179_1007763 3300027512 Bacteria 1783
135 Ga0209999_1005273 3300027543 Bacteria 2325
136 Ga0209974_10225018 3300027876 Bacteria 699
137 Ga0207428_10000175 3300027907 Bacteria 89715
138 Ga0207428_10371295 3300027907 Bacteria 1050
139 Ga0265357_1002545 3300028023 Bacteria 1502
140 Ga0268265_10705018 3300028380 Bacteria 975
141 Ga0268264_10000046 3300028381 Bacteria 364597
142 Ga0268264_10887996 3300028381 Bacteria 894
143 Ga0265338_10141522 3300028800 Bacteria 1883
144 Ga0265338_10642049 3300028800 Bacteria 736
145 Ga0265324_10141118 3300029957 Bacteria 818
146 Ga0265773_1002606 3300031018 Bacteria 1110
147 Ga0265760_10005327 3300031090 Bacteria 3689
148 Ga0265760_10044825 3300031090 Bacteria 1324
149 Ga0265325_10183731 3300031241 Bacteria 972
150 Ga0265340_10149199 3300031247 Bacteria 1066
151 Ga0265340_10527130 3300031247 Bacteria 520
152 Ga0265339_10000047 3300031249 Bacteria 110601
153 Ga0265331_10298461 3300031250 Bacteria 722
154 Ga0265313_10000069 3300031595 Bacteria 100065
155 Ga0307508_10039149 3300031616 Bacteria 4260
156 Ga0265314_10125324 3300031711 Bacteria 1610
157 Ga0265342_10295900 3300031712 Bacteria 854
158 Ga0373926_0247705 3300035083 Bacteria 690
159 Ga0373934_0306207 3300035086 Bacteria 659
160 Ga0373944_0018321 3300035089 Bacteria 1998
161 Ga0373923_0043612 3300035111 Bacteria 1857
162 Ga0373923_0082046 3300035111 Bacteria 1400
163 Ga0373936_0005414 3300035113 Bacteria 4811
164 Ga0373936_0038965 3300035113 Bacteria 1901
165 Ga0373936_0148017 3300035113 Bacteria 1017
166 Ga0373945_0033965 3300035116 Bacteria 1816
167 Ga0373945_0034227 3300035116 Bacteria 1809
168 Ga0373945_0111683 3300035116 Bacteria 1079
169 Ga0373953_0073552 3300035117 Bacteria 1413
170 Ga0373954_0002062 3300035118 Bacteria 8346
171 Ga0373957_0023543 3300035120 Bacteria 2204
172 Ga0373943_0000293 3300035170 Bacteria 20759
173 Ga0373943_0018946 3300035170 Bacteria 3164
174 Ga0373943_0021021 3300035170 Bacteria 3014
175 Ga0373943_0079292 3300035170 Bacteria 1680
176 Ga0373943_0208011 3300035170 Bacteria 1085
177 Ga0373943_0881499 3300035170 Bacteria 534
178 Ga0373946_0005483 3300035171 Bacteria 4577
179 Ga0373946_0148615 3300035171 Bacteria 1091
180 Ga0373955_0017778 3300035172 Bacteria 3523
181 Ga0373962_0125592 3300035242 Bacteria 822
182 Ga0373924_0078264 3300035410 Bacteria 1403
183 Ga0373935_0017276 3300035692 Bacteria 4375
184 Ga0373935_0019994 3300035692 Bacteria 4087
185 Ga0373935_0025643 3300035692 Bacteria 3633
186 Ga0373927_0001227 3300035695 Bacteria 19468
187 Ga0373927_0013543 3300035695 Bacteria 5416
188 Ga0373927_0121117 3300035695 Bacteria 1707
189 Ga0373927_0151337 3300035695 Bacteria 1519
190 Ga0373933_0001279 3300035724 Bacteria 14789
191 Ga0373933_0195723 3300035724 Bacteria 1292
192 Ga0373947_0000689 3300035725 Bacteria 20122
193 Ga0373947_0002163 3300035725 Bacteria 11944
194 Ga0373947_0004503 3300035725 Bacteria 8173
195 Ga0373947_0083881 3300035725 Bacteria 1977
196 Ga0373947_0373868 3300035725 Bacteria 958
197 Ga0373937_0009426 3300036401 Bacteria 8487
198 Ga0372808_036774 3300036459 Bacteria 703
199 Ga0373925_0000768 3300037068 Bacteria 29481
200 Ga0373925_0010502 3300037068 Bacteria 6716
201 Ga0373925_0097677 3300037068 Bacteria 2253
202 Ga0373925_0118889 3300037068 Bacteria 2050
203 Ga0373925_0149926 3300037068 Bacteria 1830
204 Ga0395899_0000105 3300037312 Bacteria 146163
205 Ga0395899_0095696 3300037312 Bacteria 2148
206 Ga0395899_0153911 3300037312 Bacteria 1628
207 Ga0395899_0629061 3300037312 Bacteria 680
208 Ga0395900_0120330 3300037418 Bacteria 2694
209 Ga0395900_0221941 3300037418 Bacteria 1904
210 Ga0395898_0037769 3300037466 Bacteria 4789
211 Ga0395898_0154068 3300037466 Bacteria 2198
212 Ga0395898_1670810 3300037466 Bacteria 560
213 Ga0395901_0309236 3300038443 Bacteria 1637
214 Ga0395901_0470220 3300038443 Bacteria 1283
215 Ga0436365_0599109 3300039437 Bacteria 704
216 Ga0436360_0030501 3300039438 Bacteria 3777
217 Ga0436360_0097436 3300039438 Bacteria 1164
218 Ga0436360_0329944 3300039438 Bacteria 1927
219 Ga0436360_0497929 3300039438 Bacteria 964
220 Ga0436360_0974732 3300039438 Bacteria 755
221 Ga0436361_0013152 3300039447 Bacteria 579
222 Ga0436361_0202562 3300039447 Bacteria 3528
223 Ga0436361_0238489 3300039447 Bacteria 639
224 Ga0436361_0361257 3300039447 Bacteria 1395
225 Ga0436361_0832523 3300039447 Bacteria 3198
226 Ga0436361_0939772 3300039447 Bacteria 1779
227 Ga0436363_0841603 3300039450 Bacteria 1002
228 Ga0436362_0352740 3300039453 Bacteria 1072
229 Ga0436362_0862807 3300039453 Bacteria 1422
230 Ga0466959_0078922 3300045049 Bacteria 2374
231 Ga0466959_0266941 3300045049 Bacteria 1177
232 Ga0466967_0382854 3300045976 Bacteria 1366
233 Ga0495592_0022234 3300046454 Bacteria 4823
234 Ga0495592_0067473 3300046454 Bacteria 2614
235 Ga0495603_0072625 3300046455 Bacteria 2021
236 Ga0495603_0081934 3300046455 Bacteria 1890
237 Ga0495629_0016417 3300046459 Bacteria 5315
238 Ga0495629_0147897 3300046459 Bacteria 1633
239 Ga0495629_0196179 3300046459 Bacteria 1396
240 Ga0495629_0604218 3300046459 Bacteria 733
241 Ga0495641_0292857 3300046461 Bacteria 733
242 Ga0495651_0027630 3300046462 Bacteria 4421
243 Ga0495653_0015027 3300046463 Bacteria 6313
244 Ga0495653_0094239 3300046463 Bacteria 2182
245 Ga0495580_0022304 3300046472 Bacteria 4660
246 Ga0495580_0026219 3300046472 Bacteria 4252
247 Ga0495582_0026574 3300046473 Bacteria 3173
248 Ga0495582_0047518 3300046473 Bacteria 2364
249 Ga0495582_0082883 3300046473 Bacteria 1782
250 Ga0495582_0600315 3300046473 Bacteria 637
251 Ga0495639_0066705 3300046475 Bacteria 1657
252 Ga0495662_0000765 3300046476 Bacteria 15499
253 Ga0495662_0012376 3300046476 Bacteria 4163
254 Ga0495662_0467120 3300046476 Bacteria 619
255 Ga0495664_0000995 3300046477 Bacteria 14599
256 Ga0495664_0028974 3300046477 Bacteria 3236
257 Ga0495664_0068211 3300046477 Bacteria 2122
258 Ga0495594_0011170 3300046499 Bacteria 4662
259 Ga0495608_0000834 3300046511 Bacteria 21529
260 Ga0495618_0000238 3300046514 Bacteria 40125
261 Ga0495618_0003696 3300046514 Bacteria 9485
262 Ga0495618_0232834 3300046514 Bacteria 1159
263 Ga0495628_0011521 3300046516 Bacteria 7475
264 Ga0495628_0089744 3300046516 Bacteria 2380
265 Ga0495630_0010586 3300046517 Bacteria 6663
266 Ga0495630_0013373 3300046517 Bacteria 5973
267 Ga0495630_0121232 3300046517 Bacteria 1984
268 Ga0495630_0821966 3300046517 Bacteria 709
269 Ga0495666_0012616 3300046526 Bacteria 4212
270 Ga0495652_0040740 3300046529 Bacteria 4014
271 Ga0495652_0065593 3300046529 Bacteria 3050
272 Ga0495665_0011041 3300046531 Bacteria 4887
273 Ga0495665_0061325 3300046531 Bacteria 1986
274 Ga0495665_0105139 3300046531 Bacteria 1481
275 Ga0495665_0124416 3300046531 Bacteria 1350
276 Ga0495640_0001336 3300046533 Bacteria 19384
277 Ga0495640_0011007 3300046533 Bacteria 6967
278 Ga0495640_0024403 3300046533 Bacteria 4399
279 Ga0495640_0032023 3300046533 Bacteria 3748
280 Ga0495640_0223330 3300046533 Bacteria 1187
281 Ga0495586_0006214 3300046535 Bacteria 6387
282 Ga0495586_0463464 3300046535 Bacteria 731
283 Ga0495587_0001442 3300046536 Bacteria 15851
284 Ga0495645_0103602 3300046543 Bacteria 2021
285 Ga0495645_0129007 3300046543 Bacteria 1774
286 Ga0495622_0418011 3300046557 Bacteria 576
287 Ga0495667_0000933 3300046559 Bacteria 18869
288 Ga0495667_0137817 3300046559 Bacteria 1573
289 Ga0495634_0004962 3300046642 Bacteria 10283
290 Ga0495634_0005132 3300046642 Bacteria 10108
291 Ga0495634_0021798 3300046642 Bacteria 4522
292 Ga0495634_0052803 3300046642 Bacteria 2724
293 Ga0495635_0002515 3300046663 Bacteria 12534
294 Ga0495635_0010922 3300046663 Bacteria 6366
295 Ga0495635_0058723 3300046663 Bacteria 2646
296 Ga0495635_0301044 3300046663 Bacteria 1075
297 Ga0495588_0290162 3300046674 Bacteria 862
298 Ga0495657_0049129 3300046675 Bacteria 2843
299 Ga0495599_0006007 3300046678 Bacteria 7304
300 Ga0495646_0001625 3300046680 Bacteria 13391
301 Ga0495646_0029948 3300046680 Bacteria 3400
302 Ga0495647_0023503 3300046681 Bacteria 2235
303 Ga0495647_0098431 3300046681 Bacteria 1208
304 Ga0495658_0000556 3300046683 Bacteria 20391
305 Ga0495658_0187324 3300046683 Bacteria 1285
306 Ga0495669_0283744 3300046684 Bacteria 797
307 Ga0495613_0060947 3300046689 Bacteria 2763
308 Ga0495613_0126679 3300046689 Bacteria 1831
309 Ga0495613_0164424 3300046689 Bacteria 1577
310 Ga0495613_0592290 3300046689 Bacteria 738
311 Ga0495624_0025538 3300046690 Bacteria 3877
312 Ga0495624_0189982 3300046690 Bacteria 1249
313 Ga0495624_0211795 3300046690 Unclassified 1175
314 Ga0495624_0412352 3300046690 Bacteria 810
315 Ga0495600_0003263 3300046809 Bacteria 9500
316 Ga0495581_0040036 3300047315 Bacteria 2713
317 Ga0495581_0065715 3300047315 Bacteria 2097
318 Ga0495581_0071166 3300047315 Bacteria 2012
319 Ga0495581_0571568 3300047315 Bacteria 655
320 Ga0495604_0000812 3300047317 Bacteria 26188
321 Ga0495674_0000946 3300047319 Bacteria 27657
322 Ga0495674_0037728 3300047319 Bacteria 4341
323 Ga0495674_0043734 3300047319 Bacteria 3985
324 Ga0495674_0402238 3300047319 Bacteria 1105
325 Ga0495676_0033405 3300047321 Bacteria 4333
326 Ga0495676_0082930 3300047321 Bacteria 2425
327 Ga0495676_0224347 3300047321 Bacteria 1293
328 Ga0495680_0004854 3300047322 Bacteria 12739
329 Ga0495675_0045440 3300047444 Bacteria 2796
330 Ga0495684_0006955 3300047471 Bacteria 8784
331 Ga0495684_0008139 3300047471 Bacteria 8109
332 Ga0495684_0011292 3300047471 Bacteria 6899
333 Ga0495684_0283516 3300047471 Bacteria 1194
334 Ga0495684_0796321 3300047471 Unclassified 618
335 Ga0495593_0174764 3300047673 Bacteria 1082
336 Ga0495593_0231014 3300047673 Bacteria 927
337 Ga0495602_0043363 3300048088 Bacteria 4091
338 Ga0495614_0444706 3300048089 Bacteria 613
339 Ga0496100_0101955 3300048903 Bacteria 1979
340 Ga0496100_1605903 3300048903 Bacteria 514
341 Ga0496102_0011991 3300048905 Bacteria 7488
342 Ga0496103_0007995 3300048906 Bacteria 6281
343 Ga0496104_0004585 3300048907 Bacteria 12043
344 Ga0496104_0008003 3300048907 Bacteria 9373
345 Ga0496105_0047705 3300048908 Bacteria 3535
346 Ga0496105_0264508 3300048908 Bacteria 1390
347 Ga0496105_0536568 3300048908 Bacteria 915
348 Ga0496106_0031624 3300048909 Bacteria 3944
349 Ga0496108_0054796 3300048911 Bacteria 3347
350 Ga0496108_0153902 3300048911 Bacteria 1985
351 Ga0496109_0024275 3300048912 Bacteria 5389
352 Ga0496109_0170398 3300048912 Bacteria 2042
353 Ga0496114_0078590 3300048917 Bacteria 2783
354 Ga0496115_0038541 3300048918 Bacteria 3792
355 Ga0496115_0080115 3300048918 Bacteria 2658
356 Ga0501257_030427 3300049686 Bacteria 1300
357 Ga0501081_1276425 3300049743 Bacteria 557
358 nmdc:mga05p37_351_c2 3300050507 Bacteria 23990
359 nmdc:mga05p37_84739_c1 3300050507 Bacteria 3905
360 nmdc:mga09592_1218_c1 3300050508 Bacteria 20603
361 nmdc:mga0qj67_29549_c1 3300050509 Bacteria 4258
362 nmdc:mga06r32_4988_c1 3300050510 Bacteria 11950
363 nmdc:mga08y16_252108_c1 3300050511 Bacteria 1824
364 nmdc:mga08y16_3410_c1 3300050511 Bacteria 16482
365 nmdc:mga0n895_124344_c1 3300050512 Bacteria 2602
366 nmdc:mga0n895_446_c1 3300050512 Bacteria 27670
367 nmdc:mga0n895_76259_c1 3300050512 Bacteria 3334
368 nmdc:mga0rr50_13678_c1 3300050513 Bacteria 5295
369 nmdc:mga0rr50_574036_c1 3300050513 Bacteria 961
370 nmdc:mga08x19_126116_c1 3300050514 Bacteria 1719
371 nmdc:mga08x19_366960_c1 3300050514 Bacteria 1007
372 nmdc:mga0a205_358155_c1 3300050515 Bacteria 1326
373 nmdc:mga0a205_65_c1 3300050515 Bacteria 57461
374 Ga0495601_0002357 3300053077 Bacteria 10699
375 Ga0495601_0002437 3300053077 Bacteria 10566
376 Ga0495601_0020332 3300053077 Bacteria 4054
377 Ga0495612_0000758 3300053078 Bacteria 13165
378 Ga0495612_0014499 3300053078 Bacteria 3169
379 Ga0495595_0008288 3300053084 Bacteria 4267
380 Ga0495595_0198398 3300053084 Bacteria 999
381 Ga0495619_0002909 3300053085 Bacteria 11127
382 Ga0495619_0003523 3300053085 Bacteria 10094
383 Ga0495619_0006401 3300053085 Bacteria 7462
384 Ga0495619_0247903 3300053085 Bacteria 1234
385 Ga0501084_1283748 3300054114 Unclassified 614
386 Ga0587083_0018390 3300059505 Bacteria 1263
387 Ga0587128_120366 3300059630 Bacteria 571
388 Ga0587107_034730 3300059652 Bacteria 786
389 Ga0587111_0207303 3300060346 Bacteria 559

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8002060224 8002060584 136
2 3300005983 Ga0081540_1036277 Ga0081540_10362774 138
3 3300005336 Ga0070680_100971450 Ga0070680_1009714501 139
4 3300005458 Ga0070681_10086498 Ga0070681_100864982 139
5 3300025912 Ga0207707_10108081 Ga0207707_101080812 139
6 3300035170 Ga0373943_0021021 Ga0373943_0021021_1661_2080 139
7 3300003911 JGI25405J52794_10007577 JGI25405J52794_100075773 140
8 3300005328 Ga0070676_10648727 Ga0070676_106487271 140
9 3300005335 Ga0070666_10073861 Ga0070666_100738612 140
10 3300005336 Ga0070680_100674296 Ga0070680_1006742961 140
11 3300005344 Ga0070661_100068950 Ga0070661_1000689502 140
12 3300005347 Ga0070668_100030792 Ga0070668_1000307923 140
13 3300005356 Ga0070674_100549213 Ga0070674_1005492131 140
14 3300005366 Ga0070659_101454278 Ga0070659_1014542781 140
15 3300005367 Ga0070667_100344811 Ga0070667_1003448113 140
16 3300005435 Ga0070714_100163439 Ga0070714_1001634392 140
17 3300005435 Ga0070714_100566205 Ga0070714_1005662051 140
18 3300005436 Ga0070713_100218337 Ga0070713_1002183371 140
19 3300005436 Ga0070713_100826661 Ga0070713_1008266612 140
20 3300005436 Ga0070713_100883454 Ga0070713_1008834541 140
21 3300005437 Ga0070710_10054624 Ga0070710_100546242 140
22 3300005439 Ga0070711_100075838 Ga0070711_1000758381 140
23 3300005439 Ga0070711_100170115 Ga0070711_1001701152 140
24 3300005439 Ga0070711_100458120 Ga0070711_1004581202 140
25 3300005439 Ga0070711_100688173 Ga0070711_1006881731 140
26 3300005439 Ga0070711_101661806 Ga0070711_1016618061 140
27 3300005445 Ga0070708_100308688 Ga0070708_1003086882 140
28 3300005455 Ga0070663_100309054 Ga0070663_1003090542 140
29 3300005456 Ga0070678_100051792 Ga0070678_1000517923 140
30 3300005458 Ga0070681_10050253 Ga0070681_100502533 140
31 3300005467 Ga0070706_100317442 Ga0070706_1003174421 140
32 3300005471 Ga0070698_100507782 Ga0070698_1005077822 140
33 3300005530 Ga0070679_100248518 Ga0070679_1002485181 140
34 3300005535 Ga0070684_100531623 Ga0070684_1005316231 140
35 3300005539 Ga0068853_101655233 Ga0068853_1016552331 140
36 3300005545 Ga0070695_100246279 Ga0070695_1002462792 140
37 3300005834 Ga0068851_10513069 Ga0068851_105130691 140
38 3300005842 Ga0068858_100430358 Ga0068858_1004303583 140
39 3300005843 Ga0068860_100000139 Ga0068860_10000013918 140
40 3300005937 Ga0081455_10004151 Ga0081455_1000415112 140
41 3300005937 Ga0081455_10027910 Ga0081455_100279106 140
42 3300006028 Ga0070717_10007659 Ga0070717_100076594 140
43 3300006058 Ga0075432_10000371 Ga0075432_100003714 140
44 3300006163 Ga0070715_10050994 Ga0070715_100509945 140
45 3300006163 Ga0070715_10150984 Ga0070715_101509843 140
46 3300006163 Ga0070715_10514780 Ga0070715_105147802 140
47 3300006173 Ga0070716_100065461 Ga0070716_1000654612 140
48 3300006175 Ga0070712_100003153 Ga0070712_1000031539 140
49 3300006175 Ga0070712_100140727 Ga0070712_1001407272 140
50 3300006175 Ga0070712_100293639 Ga0070712_1002936392 140
51 3300006178 Ga0075367_10252565 Ga0075367_102525652 140
52 3300006194 Ga0075427_10000614 Ga0075427_100006143 140
53 3300006237 Ga0097621_100030060 Ga0097621_1000300607 140
54 3300006237 Ga0097621_100117656 Ga0097621_1001176562 140
55 3300006844 Ga0075428_100022068 Ga0075428_10002206811 140
56 3300006846 Ga0075430_100005927 Ga0075430_10000592720 140
57 3300006847 Ga0075431_100010592 Ga0075431_1000105923 140
58 3300006852 Ga0075433_10000016 Ga0075433_1000001642 140
59 3300006852 Ga0075433_10240372 Ga0075433_102403722 140
60 3300006871 Ga0075434_100022778 Ga0075434_1000227783 140
61 3300006871 Ga0075434_100041713 Ga0075434_1000417134 140
62 3300006871 Ga0075434_100123820 Ga0075434_1001238203 140
63 3300006880 Ga0075429_100005305 Ga0075429_10000530520 140
64 3300006914 Ga0075436_100063747 Ga0075436_1000637473 140
65 3300006914 Ga0075436_100407015 Ga0075436_1004070151 140
66 3300007076 Ga0075435_100005033 Ga0075435_1000050339 140
67 3300007076 Ga0075435_100571664 Ga0075435_1005716642 140
68 3300007265 Ga0099794_10311825 Ga0099794_103118252 140
69 3300007788 Ga0099795_10001572 Ga0099795_100015722 140
70 3300009093 Ga0105240_10349445 Ga0105240_103494452 140
71 3300009094 Ga0111539_10013241 Ga0111539_1001324119 140
72 3300009094 Ga0111539_10304609 Ga0111539_103046092 140
73 3300009098 Ga0105245_10032735 Ga0105245_100327354 140
74 3300009147 Ga0114129_10015047 Ga0114129_100150473 140
75 3300009147 Ga0114129_10076974 Ga0114129_100769748 140
76 3300009174 Ga0105241_11914394 Ga0105241_119143941 140
77 3300009176 Ga0105242_10052807 Ga0105242_100528073 140
78 3300009177 Ga0105248_10036293 Ga0105248_100362937 140
79 3300009177 Ga0105248_10384043 Ga0105248_103840432 140
80 3300009177 Ga0105248_11887317 Ga0105248_118873172 140
81 3300009545 Ga0105237_10042422 Ga0105237_100424226 140
82 3300009551 Ga0105238_10168504 Ga0105238_101685043 140
83 3300010375 Ga0105239_10419636 Ga0105239_104196362 140
84 3300013296 Ga0157374_10769422 Ga0157374_107694221 140
85 3300013297 Ga0157378_11090060 Ga0157378_110900602 140
86 3300013306 Ga0163162_10609504 Ga0163162_106095042 140
87 3300013307 Ga0157372_12942386 Ga0157372_129423861 140
88 3300014968 Ga0157379_10546383 Ga0157379_105463832 140
89 3300020069 Ga0197907_10229620 Ga0197907_102296201 140
90 3300020077 Ga0206351_10950140 Ga0206351_109501402 140
91 3300021384 Ga0213876_10335826 Ga0213876_103358261 140
92 3300021441 Ga0213871_10074452 Ga0213871_100744522 140
93 3300021441 Ga0213871_10240097 Ga0213871_102400972 140
94 3300022467 Ga0224712_10215573 Ga0224712_102155732 140
95 3300024225 Ga0224572_1008093 Ga0224572_10080934 140
96 3300024225 Ga0224572_1008727 Ga0224572_10087272 140
97 3300025898 Ga0207692_10014777 Ga0207692_100147777 140
98 3300025903 Ga0207680_10198632 Ga0207680_101986322 140
99 3300025905 Ga0207685_10138709 Ga0207685_101387093 140
100 3300025905 Ga0207685_10225563 Ga0207685_102255631 140
101 3300025905 Ga0207685_10462650 Ga0207685_104626501 140
102 3300025906 Ga0207699_10349459 Ga0207699_103494592 140
103 3300025907 Ga0207645_10183037 Ga0207645_101830373 140
104 3300025912 Ga0207707_10026453 Ga0207707_100264537 140
105 3300025914 Ga0207671_10596098 Ga0207671_105960982 140
106 3300025915 Ga0207693_10043495 Ga0207693_100434952 140
107 3300025915 Ga0207693_10108350 Ga0207693_101083501 140
108 3300025915 Ga0207693_10281579 Ga0207693_102815793 140
109 3300025915 Ga0207693_10947229 Ga0207693_109472291 140
110 3300025916 Ga0207663_10379671 Ga0207663_103796711 140
111 3300025916 Ga0207663_10422990 Ga0207663_104229902 140
112 3300025916 Ga0207663_11256227 Ga0207663_112562272 140
113 3300025917 Ga0207660_10311933 Ga0207660_103119332 140
114 3300025918 Ga0207662_10249858 Ga0207662_102498582 140
115 3300025920 Ga0207649_10015752 Ga0207649_100157521 140
116 3300025921 Ga0207652_10431886 Ga0207652_104318862 140
117 3300025921 Ga0207652_11063685 Ga0207652_110636851 140
118 3300025922 Ga0207646_10643331 Ga0207646_106433312 140
119 3300025922 Ga0207646_11227670 Ga0207646_112276701 140
120 3300025924 Ga0207694_10385644 Ga0207694_103856442 140
121 3300025927 Ga0207687_10020875 Ga0207687_100208752 140
122 3300025928 Ga0207700_10127939 Ga0207700_101279393 140
123 3300025928 Ga0207700_10840722 Ga0207700_108407222 140
124 3300025931 Ga0207644_10073261 Ga0207644_100732612 140
125 3300025934 Ga0207686_10007984 Ga0207686_100079847 140
126 3300025939 Ga0207665_10101716 Ga0207665_101017162 140
127 3300025941 Ga0207711_10295599 Ga0207711_102955991 140
128 3300025941 Ga0207711_10323346 Ga0207711_103233462 140
129 3300025945 Ga0207679_10244295 Ga0207679_102442954 140
130 3300025972 Ga0207668_10051441 Ga0207668_100514412 140
131 3300025986 Ga0207658_10675059 Ga0207658_106750592 140
132 3300026035 Ga0207703_10603291 Ga0207703_106032913 140
133 3300026067 Ga0207678_10128581 Ga0207678_101285813 140
134 3300026121 Ga0207683_10010061 Ga0207683_1001006110 140
135 3300027378 Ga0209981_1000240 Ga0209981_10002407 140
136 3300027512 Ga0209179_1007763 Ga0209179_10077632 140
137 3300027543 Ga0209999_1005273 Ga0209999_10052734 140
138 3300027876 Ga0209974_10225018 Ga0209974_102250182 140
139 3300027907 Ga0207428_10000175 Ga0207428_1000017556 140
140 3300027907 Ga0207428_10371295 Ga0207428_103712951 140
141 3300028023 Ga0265357_1002545 Ga0265357_10025452 140
142 3300028380 Ga0268265_10705018 Ga0268265_107050182 140
143 3300028381 Ga0268264_10000046 Ga0268264_10000046208 140
144 3300028381 Ga0268264_10887996 Ga0268264_108879962 140
145 3300028800 Ga0265338_10141522 Ga0265338_101415222 140
146 3300028800 Ga0265338_10642049 Ga0265338_106420491 140
147 3300029957 Ga0265324_10141118 Ga0265324_101411181 140
148 3300031018 Ga0265773_1002606 Ga0265773_10026063 140
149 3300031090 Ga0265760_10005327 Ga0265760_100053273 140
150 3300031090 Ga0265760_10044825 Ga0265760_100448252 140
151 3300031241 Ga0265325_10183731 Ga0265325_101837311 140
152 3300031247 Ga0265340_10149199 Ga0265340_101491992 140
153 3300031247 Ga0265340_10527130 Ga0265340_105271301 140
154 3300031249 Ga0265339_10000047 Ga0265339_1000004762 140
155 3300031250 Ga0265331_10298461 Ga0265331_102984612 140
156 3300031595 Ga0265313_10000069 Ga0265313_1000006947 140
157 3300031616 Ga0307508_10039149 Ga0307508_100391492 140
158 3300031711 Ga0265314_10125324 Ga0265314_101253242 140
159 3300031712 Ga0265342_10295900 Ga0265342_102959002 140
160 3300035083 Ga0373926_0247705 Ga0373926_0247705_56_478 140
161 3300035086 Ga0373934_0306207 Ga0373934_0306207_38_460 140
162 3300035089 Ga0373944_0018321 Ga0373944_0018321_481_903 140
163 3300035111 Ga0373923_0043612 Ga0373923_0043612_411_833 140
164 3300035111 Ga0373923_0082046 Ga0373923_0082046_117_539 140
165 3300035113 Ga0373936_0005414 Ga0373936_0005414_3588_4010 140
166 3300035113 Ga0373936_0038965 Ga0373936_0038965_1141_1563 140
167 3300035113 Ga0373936_0148017 Ga0373936_0148017_320_742 140
168 3300035116 Ga0373945_0033965 Ga0373945_0033965_577_999 140
169 3300035116 Ga0373945_0034227 Ga0373945_0034227_972_1394 140
170 3300035116 Ga0373945_0111683 Ga0373945_0111683_256_678 140
171 3300035117 Ga0373953_0073552 Ga0373953_0073552_653_1075 140
172 3300035118 Ga0373954_0002062 Ga0373954_0002062_835_1257 140
173 3300035120 Ga0373957_0023543 Ga0373957_0023543_690_1112 140
174 3300035170 Ga0373943_0000293 Ga0373943_0000293_7811_8233 140
175 3300035170 Ga0373943_0018946 Ga0373943_0018946_2239_2661 140
176 3300035170 Ga0373943_0079292 Ga0373943_0079292_279_701 140
177 3300035170 Ga0373943_0208011 Ga0373943_0208011_237_659 140
178 3300035170 Ga0373943_0881499 Ga0373943_0881499_84_506 140
179 3300035171 Ga0373946_0005483 Ga0373946_0005483_3523_3945 140
180 3300035171 Ga0373946_0148615 Ga0373946_0148615_28_450 140
181 3300035172 Ga0373955_0017778 Ga0373955_0017778_3001_3423 140
182 3300035242 Ga0373962_0125592 Ga0373962_0125592_387_809 140
183 3300035410 Ga0373924_0078264 Ga0373924_0078264_853_1275 140
184 3300035692 Ga0373935_0017276 Ga0373935_0017276_2755_3177 140
185 3300035692 Ga0373935_0019994 Ga0373935_0019994_1999_2421 140
186 3300035692 Ga0373935_0025643 Ga0373935_0025643_1629_2051 140
187 3300035695 Ga0373927_0001227 Ga0373927_0001227_13605_14027 140
188 3300035695 Ga0373927_0013543 Ga0373927_0013543_4291_4713 140
189 3300035695 Ga0373927_0121117 Ga0373927_0121117_1021_1443 140
190 3300035695 Ga0373927_0151337 Ga0373927_0151337_840_1262 140
191 3300035724 Ga0373933_0001279 Ga0373933_0001279_10913_11335 140
192 3300035724 Ga0373933_0195723 Ga0373933_0195723_271_693 140
193 3300035725 Ga0373947_0000689 Ga0373947_0000689_14259_14681 140
194 3300035725 Ga0373947_0002163 Ga0373947_0002163_10453_10875 140
195 3300035725 Ga0373947_0004503 Ga0373947_0004503_6199_6621 140
196 3300035725 Ga0373947_0083881 Ga0373947_0083881_1029_1451 140
197 3300035725 Ga0373947_0373868 Ga0373947_0373868_335_757 140
198 3300036401 Ga0373937_0009426 Ga0373937_0009426_5278_5700 140
199 3300036459 Ga0372808_036774 Ga0372808_036774_21_443 140
200 3300037068 Ga0373925_0000768 Ga0373925_0000768_10430_10852 140
201 3300037068 Ga0373925_0010502 Ga0373925_0010502_1179_1601 140
202 3300037068 Ga0373925_0097677 Ga0373925_0097677_1215_1637 140
203 3300037068 Ga0373925_0118889 Ga0373925_0118889_751_1230 140
204 3300037068 Ga0373925_0149926 Ga0373925_0149926_680_1102 140
205 3300037312 Ga0395899_0000105 Ga0395899_0000105_77808_78230 140
206 3300037312 Ga0395899_0095696 Ga0395899_0095696_61_486 140
207 3300037312 Ga0395899_0153911 Ga0395899_0153911_834_1259 140
208 3300037312 Ga0395899_0629061 Ga0395899_0629061_204_629 140
209 3300037418 Ga0395900_0120330 Ga0395900_0120330_358_783 140
210 3300037418 Ga0395900_0221941 Ga0395900_0221941_447_872 140
211 3300037466 Ga0395898_0037769 Ga0395898_0037769_1259_1684 140
212 3300037466 Ga0395898_0154068 Ga0395898_0154068_332_754 140
213 3300037466 Ga0395898_1670810 Ga0395898_1670810_32_457 140
214 3300038443 Ga0395901_0309236 Ga0395901_0309236_452_877 140
215 3300038443 Ga0395901_0470220 Ga0395901_0470220_180_605 140
216 3300039437 Ga0436365_0599109 Ga0436365_0599109_260_682 140
217 3300039438 Ga0436360_0030501 Ga0436360_0030501_87_512 140
218 3300039438 Ga0436360_0097436 Ga0436360_0097436_317_742 140
219 3300039438 Ga0436360_0329944 Ga0436360_0329944_477_902 140
220 3300039438 Ga0436360_0497929 Ga0436360_0497929_247_669 140
221 3300039438 Ga0436360_0974732 Ga0436360_0974732_105_527 140
222 3300039447 Ga0436361_0013152 Ga0436361_0013152_81_503 140
223 3300039447 Ga0436361_0202562 Ga0436361_0202562_435_860 140
224 3300039447 Ga0436361_0238489 Ga0436361_0238489_73_495 140
225 3300039447 Ga0436361_0361257 Ga0436361_0361257_678_1103 140
226 3300039447 Ga0436361_0832523 Ga0436361_0832523_149_574 140
227 3300039447 Ga0436361_0939772 Ga0436361_0939772_977_1399 140
228 3300039450 Ga0436363_0841603 Ga0436363_0841603_74_496 140
229 3300039453 Ga0436362_0352740 Ga0436362_0352740_445_870 140
230 3300039453 Ga0436362_0862807 Ga0436362_0862807_340_762 140
231 3300045049 Ga0466959_0078922 Ga0466959_0078922_215_637 140
232 3300045049 Ga0466959_0266941 Ga0466959_0266941_452_874 140
233 3300045976 Ga0466967_0382854 Ga0466967_0382854_596_1021 140
234 3300046454 Ga0495592_0022234 Ga0495592_0022234_1692_2114 140
235 3300046454 Ga0495592_0067473 Ga0495592_0067473_1766_2188 140
236 3300046455 Ga0495603_0072625 Ga0495603_0072625_1163_1585 140
237 3300046455 Ga0495603_0081934 Ga0495603_0081934_1061_1483 140
238 3300046459 Ga0495629_0016417 Ga0495629_0016417_2085_2507 140
239 3300046459 Ga0495629_0147897 Ga0495629_0147897_372_851 140
240 3300046459 Ga0495629_0196179 Ga0495629_0196179_268_690 140
241 3300046459 Ga0495629_0604218 Ga0495629_0604218_197_619 140
242 3300046461 Ga0495641_0292857 Ga0495641_0292857_268_690 140
243 3300046462 Ga0495651_0027630 Ga0495651_0027630_1417_1839 140
244 3300046463 Ga0495653_0015027 Ga0495653_0015027_2511_2933 140
245 3300046463 Ga0495653_0094239 Ga0495653_0094239_1616_2038 140
246 3300046472 Ga0495580_0022304 Ga0495580_0022304_2112_2591 140
247 3300046472 Ga0495580_0026219 Ga0495580_0026219_252_674 140
248 3300046473 Ga0495582_0026574 Ga0495582_0026574_1770_2249 140
249 3300046473 Ga0495582_0047518 Ga0495582_0047518_367_789 140
250 3300046473 Ga0495582_0082883 Ga0495582_0082883_1098_1520 140
251 3300046473 Ga0495582_0600315 Ga0495582_0600315_193_615 140
252 3300046475 Ga0495639_0066705 Ga0495639_0066705_886_1308 140
253 3300046476 Ga0495662_0000765 Ga0495662_0000765_1094_1516 140
254 3300046476 Ga0495662_0012376 Ga0495662_0012376_3494_3916 140
255 3300046476 Ga0495662_0467120 Ga0495662_0467120_142_564 140
256 3300046477 Ga0495664_0000995 Ga0495664_0000995_6088_6510 140
257 3300046477 Ga0495664_0028974 Ga0495664_0028974_1472_1894 140
258 3300046477 Ga0495664_0068211 Ga0495664_0068211_668_1090 140
259 3300046499 Ga0495594_0011170 Ga0495594_0011170_3997_4419 140
260 3300046511 Ga0495608_0000834 Ga0495608_0000834_12283_12705 140
261 3300046514 Ga0495618_0000238 Ga0495618_0000238_14935_15357 140
262 3300046514 Ga0495618_0003696 Ga0495618_0003696_7306_7728 140
263 3300046514 Ga0495618_0232834 Ga0495618_0232834_146_568 140
264 3300046516 Ga0495628_0011521 Ga0495628_0011521_3585_4007 140
265 3300046516 Ga0495628_0089744 Ga0495628_0089744_803_1225 140
266 3300046517 Ga0495630_0010586 Ga0495630_0010586_2635_3057 140
267 3300046517 Ga0495630_0013373 Ga0495630_0013373_5437_5859 140
268 3300046517 Ga0495630_0121232 Ga0495630_0121232_1120_1542 140
269 3300046517 Ga0495630_0821966 Ga0495630_0821966_237_659 140
270 3300046526 Ga0495666_0012616 Ga0495666_0012616_2967_3389 140
271 3300046529 Ga0495652_0040740 Ga0495652_0040740_23_445 140
272 3300046529 Ga0495652_0065593 Ga0495652_0065593_393_815 140
273 3300046531 Ga0495665_0011041 Ga0495665_0011041_3175_3597 140
274 3300046531 Ga0495665_0061325 Ga0495665_0061325_762_1241 140
275 3300046531 Ga0495665_0105139 Ga0495665_0105139_262_684 140
276 3300046531 Ga0495665_0124416 Ga0495665_0124416_529_951 140
277 3300046533 Ga0495640_0001336 Ga0495640_0001336_18376_18798 140
278 3300046533 Ga0495640_0011007 Ga0495640_0011007_3262_3684 140
279 3300046533 Ga0495640_0024403 Ga0495640_0024403_3635_4057 140
280 3300046533 Ga0495640_0032023 Ga0495640_0032023_1384_1806 140
281 3300046533 Ga0495640_0223330 Ga0495640_0223330_467_889 140
282 3300046535 Ga0495586_0006214 Ga0495586_0006214_1990_2412 140
283 3300046535 Ga0495586_0463464 Ga0495586_0463464_242_664 140
284 3300046536 Ga0495587_0001442 Ga0495587_0001442_8301_8723 140
285 3300046543 Ga0495645_0103602 Ga0495645_0103602_854_1276 140
286 3300046543 Ga0495645_0129007 Ga0495645_0129007_1148_1570 140
287 3300046557 Ga0495622_0418011 Ga0495622_0418011_13_435 140
288 3300046559 Ga0495667_0000933 Ga0495667_0000933_2993_3415 140
289 3300046559 Ga0495667_0137817 Ga0495667_0137817_801_1223 140
290 3300046642 Ga0495634_0004962 Ga0495634_0004962_874_1296 140
291 3300046642 Ga0495634_0005132 Ga0495634_0005132_6388_6810 140
292 3300046642 Ga0495634_0021798 Ga0495634_0021798_2864_3286 140
293 3300046642 Ga0495634_0052803 Ga0495634_0052803_1488_1910 140
294 3300046663 Ga0495635_0002515 Ga0495635_0002515_1765_2187 140
295 3300046663 Ga0495635_0010922 Ga0495635_0010922_2851_3273 140
296 3300046663 Ga0495635_0058723 Ga0495635_0058723_1311_1733 140
297 3300046663 Ga0495635_0301044 Ga0495635_0301044_219_698 140
298 3300046674 Ga0495588_0290162 Ga0495588_0290162_289_711 140
299 3300046675 Ga0495657_0049129 Ga0495657_0049129_1070_1492 140
300 3300046678 Ga0495599_0006007 Ga0495599_0006007_2780_3202 140
301 3300046680 Ga0495646_0001625 Ga0495646_0001625_3192_3614 140
302 3300046680 Ga0495646_0029948 Ga0495646_0029948_2429_2851 140
303 3300046681 Ga0495647_0023503 Ga0495647_0023503_1379_1801 140
304 3300046681 Ga0495647_0098431 Ga0495647_0098431_520_942 140
305 3300046683 Ga0495658_0000556 Ga0495658_0000556_6695_7174 140
306 3300046683 Ga0495658_0187324 Ga0495658_0187324_383_805 140
307 3300046684 Ga0495669_0283744 Ga0495669_0283744_209_631 140
308 3300046689 Ga0495613_0060947 Ga0495613_0060947_1541_1963 140
309 3300046689 Ga0495613_0126679 Ga0495613_0126679_177_599 140
310 3300046689 Ga0495613_0164424 Ga0495613_0164424_251_673 140
311 3300046689 Ga0495613_0592290 Ga0495613_0592290_172_594 140
312 3300046690 Ga0495624_0025538 Ga0495624_0025538_265_687 140
313 3300046690 Ga0495624_0189982 Ga0495624_0189982_254_676 140
314 3300046690 Ga0495624_0211795 Ga0495624_0211795_58_480 140
315 3300046690 Ga0495624_0412352 Ga0495624_0412352_167_589 140
316 3300046809 Ga0495600_0003263 Ga0495600_0003263_5276_5698 140
317 3300047315 Ga0495581_0040036 Ga0495581_0040036_90_512 140
318 3300047315 Ga0495581_0065715 Ga0495581_0065715_84_563 140
319 3300047315 Ga0495581_0071166 Ga0495581_0071166_699_1121 140
320 3300047315 Ga0495581_0571568 Ga0495581_0571568_191_613 140
321 3300047317 Ga0495604_0000812 Ga0495604_0000812_5479_5901 140
322 3300047319 Ga0495674_0000946 Ga0495674_0000946_9389_9811 140
323 3300047319 Ga0495674_0037728 Ga0495674_0037728_3735_4157 140
324 3300047319 Ga0495674_0043734 Ga0495674_0043734_2958_3380 140
325 3300047319 Ga0495674_0402238 Ga0495674_0402238_168_590 140
326 3300047321 Ga0495676_0033405 Ga0495676_0033405_3467_3889 140
327 3300047321 Ga0495676_0082930 Ga0495676_0082930_1399_1821 140
328 3300047321 Ga0495676_0224347 Ga0495676_0224347_198_620 140
329 3300047322 Ga0495680_0004854 Ga0495680_0004854_8556_8978 140
330 3300047444 Ga0495675_0045440 Ga0495675_0045440_242_664 140
331 3300047471 Ga0495684_0006955 Ga0495684_0006955_4874_5296 140
332 3300047471 Ga0495684_0008139 Ga0495684_0008139_2195_2617 140
333 3300047471 Ga0495684_0011292 Ga0495684_0011292_6081_6503 140
334 3300047471 Ga0495684_0283516 Ga0495684_0283516_266_688 140
335 3300047471 Ga0495684_0796321 Ga0495684_0796321_116_538 140
336 3300047673 Ga0495593_0174764 Ga0495593_0174764_566_988 140
337 3300047673 Ga0495593_0231014 Ga0495593_0231014_243_665 140
338 3300048088 Ga0495602_0043363 Ga0495602_0043363_3016_3438 140
339 3300048089 Ga0495614_0444706 Ga0495614_0444706_73_495 140
340 3300048903 Ga0496100_0101955 Ga0496100_0101955_1078_1500 140
341 3300048903 Ga0496100_1605903 Ga0496100_1605903_36_458 140
342 3300048905 Ga0496102_0011991 Ga0496102_0011991_4226_4648 140
343 3300048906 Ga0496103_0007995 Ga0496103_0007995_547_969 140
344 3300048907 Ga0496104_0004585 Ga0496104_0004585_4378_4800 140
345 3300048907 Ga0496104_0008003 Ga0496104_0008003_6182_6604 140
346 3300048908 Ga0496105_0047705 Ga0496105_0047705_223_645 140
347 3300048908 Ga0496105_0264508 Ga0496105_0264508_532_954 140
348 3300048908 Ga0496105_0536568 Ga0496105_0536568_415_837 140
349 3300048909 Ga0496106_0031624 Ga0496106_0031624_142_564 140
350 3300048911 Ga0496108_0054796 Ga0496108_0054796_1708_2130 140
351 3300048911 Ga0496108_0153902 Ga0496108_0153902_337_759 140
352 3300048912 Ga0496109_0024275 Ga0496109_0024275_4746_5168 140
353 3300048912 Ga0496109_0170398 Ga0496109_0170398_892_1314 140
354 3300048917 Ga0496114_0078590 Ga0496114_0078590_1504_1926 140
355 3300048918 Ga0496115_0038541 Ga0496115_0038541_284_877 140
356 3300048918 Ga0496115_0080115 Ga0496115_0080115_480_902 140
357 3300049686 Ga0501257_030427 Ga0501257_030427_111_533 140
358 3300049743 Ga0501081_1276425 Ga0501081_1276425_86_508 140
359 3300050507 nmdc:mga05p37_351_c2 nmdc:mga05p37_351_c2_21781_22203 140
360 3300050507 nmdc:mga05p37_84739_c1 nmdc:mga05p37_84739_c1_489_911 140
361 3300050508 nmdc:mga09592_1218_c1 nmdc:mga09592_1218_c1_5334_5756 140
362 3300050509 nmdc:mga0qj67_29549_c1 nmdc:mga0qj67_29549_c1_1214_1636 140
363 3300050510 nmdc:mga06r32_4988_c1 nmdc:mga06r32_4988_c1_3047_3469 140
364 3300050511 nmdc:mga08y16_252108_c1 nmdc:mga08y16_252108_c1_588_1010 140
365 3300050511 nmdc:mga08y16_3410_c1 nmdc:mga08y16_3410_c1_6421_6843 140
366 3300050512 nmdc:mga0n895_124344_c1 nmdc:mga0n895_124344_c1_1972_2394 140
367 3300050512 nmdc:mga0n895_446_c1 nmdc:mga0n895_446_c1_7733_8155 140
368 3300050512 nmdc:mga0n895_76259_c1 nmdc:mga0n895_76259_c1_645_1067 140
369 3300050513 nmdc:mga0rr50_13678_c1 nmdc:mga0rr50_13678_c1_2128_2550 140
370 3300050513 nmdc:mga0rr50_574036_c1 nmdc:mga0rr50_574036_c1_426_848 140
371 3300050514 nmdc:mga08x19_126116_c1 nmdc:mga08x19_126116_c1_880_1302 140
372 3300050514 nmdc:mga08x19_366960_c1 nmdc:mga08x19_366960_c1_562_984 140
373 3300050515 nmdc:mga0a205_358155_c1 nmdc:mga0a205_358155_c1_444_866 140
374 3300050515 nmdc:mga0a205_65_c1 nmdc:mga0a205_65_c1_41717_42139 140
375 3300053077 Ga0495601_0002357 Ga0495601_0002357_3496_3918 140
376 3300053077 Ga0495601_0002437 Ga0495601_0002437_2065_2487 140
377 3300053077 Ga0495601_0020332 Ga0495601_0020332_3263_3685 140
378 3300053078 Ga0495612_0000758 Ga0495612_0000758_1857_2279 140
379 3300053078 Ga0495612_0014499 Ga0495612_0014499_1697_2119 140
380 3300053084 Ga0495595_0008288 Ga0495595_0008288_2803_3225 140
381 3300053084 Ga0495595_0198398 Ga0495595_0198398_216_638 140
382 3300053085 Ga0495619_0002909 Ga0495619_0002909_9833_10255 140
383 3300053085 Ga0495619_0003523 Ga0495619_0003523_6389_6811 140
384 3300053085 Ga0495619_0006401 Ga0495619_0006401_5103_5525 140
385 3300053085 Ga0495619_0247903 Ga0495619_0247903_321_743 140
386 3300054114 Ga0501084_1283748 Ga0501084_1283748_172_594 140
387 3300059505 Ga0587083_0018390 Ga0587083_0018390_568_993 140
388 3300059630 Ga0587128_120366 Ga0587128_120366_120_545 140
389 3300059652 Ga0587107_034730 Ga0587107_034730_242_667 140
390 3300060346 Ga0587111_0207303 Ga0587111_0207303_36_467 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

39

138

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.9455 1 139
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9442 1 140
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9405 1 139
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9402 1 140
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9377 1 140
ID Description Score Start End Superfamily
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9331 1 139 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9204 1 139 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8795 1 140 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8758 4 140 3.30.300.20
af_Q2G1T3_42_139_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8745 45 140 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A257KYW8-F1-model_v4 OsmC family peroxiredoxin 0.984 42 140 GO:0004601
GO:0006979
AF-A0A2W5FXT9-F1-model_v4 OsmC family peroxiredoxin 0.9755 43 140 GO:0004601
GO:0006979
AF-A0A257KYW8-F1-model_v4 OsmC family peroxiredoxin 0.9738 42 140 GO:0004601
GO:0006979
AF-A0A510J5A0-F1-model_v4 deleted 0.9721 70 140
AF-A0A258Y8I4-F1-model_v4 OsmC family peroxiredoxin 0.9717 51 140 GO:0004601
GO:0006979

Feature Viewer

pLDDT pTM Quality
93.88 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map