F431741

General Info

Members Datasets Scaffolds Average Seq Length
390 286 782 252

Family's Representative Sequence

Representative Sequence 3300025302|Ga0207426_1063538|Ga0207426_10635381
Length 297
Sequence VNTIGGPCIGQATAGTRGFVPGFPACMMAGKLSAETESHVPSKKALIRRPSPRLADGLVTHIEREKVDPDLALEQWEAYGEALRTHGWETIEVDPADDCPDSVFVEDTVVMYRNVALIARPGAESRRDETDGVEEAVARLGCSVNWIWEPGTLDGGDVLKVDDTLYVGRSERTNAAAVQQVRAVFEPLGARVVSVPVTRVLHLKSAVTALPDGTVIGHVPLVDKPALFPRFLPVPEESGSHVVVLGXXXLLMAASAPKTAELLADLGHEPVVVDISEFEKLEGCVTCLSVRMRELYV

Samples

Sample ID Description Type Environment
1 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
85 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
86 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
89 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
90 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
101 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
104 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
105 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
106 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
107 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
108 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
109 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
110 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
129 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
134 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
171 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
211 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
212 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
213 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
214 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
215 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
216 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
217 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
218 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
219 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
220 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
221 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
224 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
225 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
226 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
229 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
230 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
231 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
232 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
233 2643221647 Streptomyces sp. Root369 Isolate Unclassified
234 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
235 2643221714 Streptomyces sp. Root264 Isolate Unclassified
236 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
237 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
238 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
239 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
240 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
241 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
242 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
243 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
244 2808606448 Streptomyces sp. 193411 Isolate Unclassified
245 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
246 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
247 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
248 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
249 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
250 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
251 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
252 2862574272 Streptomyces sp. AcE210 Isolate Nodule
253 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
254 2867428634 Streptomyces sp. RP5T Isolate Unclassified
255 2867475112 Streptomyces sp. TM32 Isolate Unclassified
256 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
257 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
258 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
259 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
260 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
261 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
262 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
263 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
264 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
265 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
266 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
267 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
268 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
269 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
270 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
271 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
272 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
273 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
274 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
275 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
276 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
277 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
278 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
279 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
280 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
281 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
282 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
283 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
284 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
285 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
286 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.87
Metatranscriptomes 0.26
Isolates 14.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.67
Nodule 0.51
Rhizoplane 6.15
Rhizosphere 70.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207426_1063538 3300025302 Bacteria 1053
2 JGI24737J22298_10008327 3300001990 Bacteria 3477
3 JGI25406J46586_10034341 3300003203 Bacteria 1863
4 rootL2_10036488 3300003322 Bacteria 10363
5 rootL2_10082355 3300003322 Bacteria 1443
6 rootH1_10000102 3300003316 Bacteria 12454
7 rootH1_10000102 3300003323 Bacteria 7359
8 rootH1_10000109 3300003316 Eukaryota 18733
9 rootH1_10000109 3300003323 Bacteria 1866
10 Ga0006562J51391_1175031 3300003578 Bacteria 1790
11 Ga0070670_100373209 3300005331 Bacteria 1256
12 Ga0070691_10175050 3300005341 Bacteria 1114
13 Ga0070687_100192591 3300005343 Bacteria 1230
14 Ga0070668_100006308 3300005347 Bacteria 8782
15 Ga0070669_100021454 3300005353 Bacteria 4615
16 Ga0070674_100075190 3300005356 Bacteria 2398
17 Ga0070709_10146465 3300005434 Bacteria 1628
18 Ga0070714_100134704 3300005435 Bacteria 2211
19 Ga0070713_100179810 3300005436 Bacteria 1900
20 Ga0070700_100160527 3300005441 Bacteria 1547
21 Ga0070662_100008612 3300005457 Bacteria 6656
22 Ga0070681_10117679 3300005458 Bacteria 2594
23 Ga0068867_100005490 3300005459 Bacteria 8975
24 Ga0070685_10201255 3300005466 Bacteria 1294
25 Ga0068853_100013929 3300005539 Bacteria 6577
26 Ga0070686_100130233 3300005544 Bacteria 1739
27 Ga0070665_100071225 3300005548 Bacteria 3483
28 Ga0068854_100644092 3300005578 Bacteria 909
29 Ga0070702_100119235 3300005615 Bacteria 1649
30 Ga0068859_100670401 3300005617 Bacteria 1129
31 Ga0068864_100844734 3300005618 Bacteria 902
32 Ga0068866_10002011 3300005718 Bacteria 8461
33 Ga0068861_100002733 3300005719 Bacteria 11559
34 Ga0068863_100008293 3300005841 Bacteria 10155
35 Ga0068863_100312321 3300005841 Bacteria 1526
36 Ga0068862_100003221 3300005844 Bacteria 14133
37 Ga0068862_100095133 3300005844 Bacteria 2598
38 Ga0081455_10006692 3300005937 Bacteria 12316
39 Ga0081455_10166280 3300005937 Bacteria 1685
40 Ga0081539_10008872 3300005985 Bacteria 8592
41 Ga0075363_100012588 3300006048 Bacteria 4081
42 Ga0075367_10000764 3300006178 Bacteria 12574
43 Ga0075428_100191219 3300006844 Bacteria 2213
44 Ga0075430_100463752 3300006846 Bacteria 1045
45 Ga0075431_100001391 3300006847 Bacteria 22210
46 Ga0075431_100364829 3300006847 Bacteria 1450
47 Ga0075429_100312097 3300006880 Bacteria 1376
48 Ga0097620_100670432 3300006931 Bacteria 1129
49 Ga0105245_10428236 3300009098 Bacteria 1327
50 Ga0105247_10146686 3300009101 Bacteria 1551
51 Ga0114129_10998013 3300009147 Bacteria 1054
52 Ga0105243_10235966 3300009148 Bacteria 1625
53 Ga0105242_10082281 3300009176 Bacteria 2694
54 Ga0105242_10127836 3300009176 Bacteria 2189
55 Ga0105249_10008499 3300009553 Bacteria 8949
56 Ga0105249_10347896 3300009553 Bacteria 1501
57 Ga0105239_10020565 3300010375 Bacteria 7282
58 Ga0105239_10674159 3300010375 Bacteria 1181
59 Ga0157369_10375311 3300013105 Bacteria 1476
60 Ga0157375_10169383 3300013308 Bacteria 2331
61 Ga0157380_10147500 3300014326 Bacteria 2029
62 Ga0157380_10288185 3300014326 Bacteria 1506
63 Ga0182008_10000702 3300014497 Bacteria 23970
64 Ga0182006_1035718 3300015261 Bacteria 1979
65 Ga0182007_10000377 3300015262 Bacteria 28045
66 Ga0183367_1001 3300015688 Bacteria 1225545
67 Ga0209758_1002382 3300025297 Bacteria 19350
68 Ga0207426_1000758 3300025302 Bacteria 36003
69 Ga0207426_1001275 3300025302 Bacteria 21927
70 Ga0207426_1015262 3300025302 Bacteria 2789
71 Ga0207642_10002482 3300025899 Bacteria 5736
72 Ga0207647_10022817 3300025904 Bacteria 4151
73 Ga0207662_10312850 3300025918 Bacteria 1047
74 Ga0207681_10008388 3300025923 Bacteria 6318
75 Ga0207700_10212058 3300025928 Bacteria 1638
76 Ga0207706_10006365 3300025933 Bacteria 10972
77 Ga0207706_10324628 3300025933 Bacteria 1339
78 Ga0207686_10010741 3300025934 Bacteria 4988
79 Ga0207709_10037494 3300025935 Bacteria 2881
80 Ga0207669_10052273 3300025937 Bacteria 2453
81 Ga0207704_10163617 3300025938 Bacteria 1586
82 Ga0207691_10059606 3300025940 Bacteria 3470
83 Ga0207712_10004628 3300025961 Bacteria 8688
84 Ga0207712_10046369 3300025961 Bacteria 3013
85 Ga0207668_10092941 3300025972 Bacteria 2221
86 Ga0207658_10504506 3300025986 Bacteria 1078
87 Ga0207639_10450311 3300026041 Bacteria 1168
88 Ga0207678_10287403 3300026067 Bacteria 1412
89 Ga0207708_10037582 3300026075 Bacteria 3688
90 Ga0207641_10293539 3300026088 Bacteria 1533
91 Ga0207648_10001273 3300026089 Bacteria 28162
92 Ga0207676_10598974 3300026095 Bacteria 1058
93 Ga0207674_10005982 3300026116 Bacteria 14402
94 Ga0207674_10244269 3300026116 Bacteria 1742
95 Ga0207675_100012291 3300026118 Bacteria 7999
96 Ga0207675_100126084 3300026118 Bacteria 2425
97 Ga0209371_1018942 3300027312 Bacteria 1733
98 Ga0207428_10095849 3300027907 Bacteria 2298
99 Ga0268266_10036933 3300028379 Bacteria 4162
100 Ga0268265_10026587 3300028380 Bacteria 4119
101 Ga0307517_10005656 3300028786 Bacteria 18747
102 Ga0307517_10006621 3300028786 Bacteria 17080
103 Ga0307515_10000163 3300028794 Bacteria 163159
104 Ga0307515_10021485 3300028794 Bacteria 11443
105 Ga0307515_10122144 3300028794 Bacteria 2940
106 Ga0268256_1021266 3300030500 Bacteria 1730
107 Ga0307511_10000150 3300030521 Bacteria 66178
108 Ga0307511_10093646 3300030521 Bacteria 2018
109 Ga0307512_10002995 3300030522 Bacteria 20368
110 Ga0307512_10046066 3300030522 Bacteria 3561
111 Ga0307513_10006849 3300031456 Bacteria 14843
112 Ga0307513_10121909 3300031456 Bacteria 2572
113 Ga0307509_10028733 3300031507 Bacteria 6178
114 Ga0307509_10093162 3300031507 Bacteria 3076
115 Ga0307509_10135083 3300031507 Bacteria 2414
116 Ga0307508_10008953 3300031616 Bacteria 9222
117 Ga0307508_10011718 3300031616 Bacteria 8015
118 Ga0307508_10041613 3300031616 Bacteria 4123
119 Ga0307508_10154708 3300031616 Bacteria 1896
120 Ga0307514_10188551 3300031649 Bacteria 1317
121 Ga0307516_10001998 3300031730 Bacteria 27892
122 Ga0307516_10013008 3300031730 Bacteria 8915
123 Ga0307516_10018086 3300031730 Bacteria 7330
124 Ga0307518_10038872 3300031838 Bacteria 3459
125 Ga0307518_10061259 3300031838 Bacteria 2732
126 Ga0307518_10137090 3300031838 Bacteria 1712
127 Ga0307407_10219133 3300031903 Bacteria 1286
128 Ga0307409_100530315 3300031995 Bacteria 1152
129 Ga0307507_10007832 3300033179 Bacteria 15189
130 Ga0307510_10015605 3300033180 Bacteria 8986
131 Ga0307510_10023047 3300033180 Bacteria 7222
132 Ga0307510_10023601 3300033180 Bacteria 7126
133 Ga0307510_10145113 3300033180 Bacteria 2008
134 Ga0395898_0003047 3300037466 Bacteria 18989
135 Ga0395898_0003491 3300037466 Bacteria 17565
136 Ga0395898_0046986 3300037466 Bacteria 4238
137 Ga0395905_0077415 3300037471 Bacteria 3116
138 Ga0395901_0058197 3300038443 Bacteria 4020
139 Ga0439439_0005017 3300041406 Bacteria 3006
140 Ga0451837_0923568 3300041494 Bacteria 2661
141 Ga0451853_0117108 3300041512 Bacteria 1347
142 Ga0451853_3330844 3300041512 Bacteria 2305
143 Ga0451853_3964651 3300041512 Bacteria 3108
144 Ga0439433_0001813 3300041999 Bacteria 4447
145 Ga0439442_040429 3300042002 Bacteria 979
146 Ga0439448_0006799 3300042005 Bacteria 3298
147 Ga0439448_0064303 3300042005 Bacteria 1216
148 Ga0439449_0002071 3300042007 Bacteria 7893
149 Ga0439449_0015971 3300042007 Bacteria 2821
150 Ga0439455_0003195 3300042012 Bacteria 3099
151 Ga0439457_000534 3300042014 Bacteria 11048
152 Ga0439457_001425 3300042014 Bacteria 7195
153 Ga0450903_000863 3300042138 Bacteria 5869
154 Ga0439458_0001935 3300042157 Bacteria 5135
155 Ga0466972_0001272 3300044658 Bacteria 12174
156 Ga0466965_0012211 3300044683 Bacteria 4037
157 Ga0466965_0018504 3300044683 Bacteria 3340
158 Ga0466965_0105089 3300044683 Bacteria 1447
159 Ga0466966_0002941 3300044684 Bacteria 11222
160 Ga0466966_0005033 3300044684 Bacteria 8693
161 Ga0466961_0003148 3300044693 Bacteria 10278
162 Ga0466961_0052463 3300044693 Bacteria 2602
163 Ga0466963_0001169 3300044694 Bacteria 13766
164 Ga0466963_0116063 3300044694 Bacteria 1840
165 Ga0466964_0088100 3300044706 Bacteria 1346
166 Ga0466971_0001122 3300044719 Bacteria 11133
167 Ga0466970_0004932 3300044765 Bacteria 6591
168 Ga0466970_0011368 3300044765 Bacteria 4537
169 Ga0466970_0080311 3300044765 Bacteria 1762
170 Ga0466970_0379310 3300044765 Bacteria 805
171 Ga0466957_0001956 3300044842 Bacteria 10950
172 Ga0466957_0521486 3300044842 Bacteria 826
173 Ga0466960_0030844 3300044901 Bacteria 2470
174 Ga0466959_0001360 3300045049 Bacteria 14928
175 Ga0466959_0443949 3300045049 Bacteria 880
176 Ga0466958_0000912 3300045836 Bacteria 13268
177 Ga0466958_0449111 3300045836 Bacteria 835
178 Ga0466967_0016905 3300045976 Bacteria 5769
179 Ga0466967_0244185 3300045976 Bacteria 1713
180 Ga0466967_0280101 3300045976 Bacteria 1600
181 Ga0466967_0435790 3300045976 Bacteria 1279
182 Ga0466967_0794653 3300045976 Bacteria 939
183 Ga0495603_0073176 3300046455 Bacteria 2013
184 Ga0495629_0017275 3300046459 Bacteria 5173
185 Ga0495629_0018655 3300046459 Bacteria 4959
186 Ga0495629_0238781 3300046459 Bacteria 1251
187 Ga0495629_0440814 3300046459 Bacteria 882
188 Ga0495638_0033098 3300046460 Bacteria 3307
189 Ga0495651_0010325 3300046462 Bacteria 7175
190 Ga0495605_0066794 3300046474 Bacteria 1707
191 Ga0495662_0005125 3300046476 Bacteria 6564
192 Ga0495664_0271988 3300046477 Bacteria 1024
193 Ga0495584_0055946 3300046491 Bacteria 1985
194 Ga0495594_0031373 3300046499 Bacteria 2880
195 Ga0495594_0033964 3300046499 Bacteria 2775
196 Ga0495594_0083639 3300046499 Bacteria 1784
197 Ga0495607_0090577 3300046501 Bacteria 1657
198 Ga0495583_0053876 3300046506 Bacteria 1823
199 Ga0495606_0012292 3300046507 Bacteria 6885
200 Ga0495610_0040020 3300046512 Bacteria 2366
201 Ga0495616_0096206 3300046513 Bacteria 1394
202 Ga0495620_0005326 3300046515 Bacteria 7195
203 Ga0495628_0045172 3300046516 Bacteria 3504
204 Ga0495628_0309665 3300046516 Bacteria 1167
205 Ga0495630_0019701 3300046517 Bacteria 4963
206 Ga0495631_0006832 3300046518 Bacteria 5856
207 Ga0495643_0004189 3300046522 Bacteria 10224
208 Ga0495652_0045524 3300046529 Bacteria 3771
209 Ga0495640_0008995 3300046533 Bacteria 7798
210 Ga0495587_0002003 3300046536 Bacteria 13587
211 Ga0495597_0085444 3300046542 Bacteria 1344
212 Ga0495645_0001357 3300046543 Bacteria 16555
213 Ga0495622_0028193 3300046557 Bacteria 2621
214 Ga0495668_0011913 3300046616 Bacteria 5179
215 Ga0495634_0000940 3300046642 Bacteria 27601
216 Ga0495611_0018007 3300046648 Bacteria 3026
217 Ga0495611_0066290 3300046648 Bacteria 1646
218 Ga0495625_0017444 3300046660 Bacteria 5621
219 Ga0495625_0061224 3300046660 Bacteria 2664
220 Ga0495625_0135654 3300046660 Bacteria 1664
221 Ga0495635_0002126 3300046663 Bacteria 13437
222 Ga0495659_0175431 3300046664 Bacteria 871
223 Ga0495588_0005032 3300046674 Bacteria 5867
224 Ga0495657_0005988 3300046675 Bacteria 9545
225 Ga0495657_0016406 3300046675 Bacteria 5397
226 Ga0495646_0000248 3300046680 Bacteria 27181
227 Ga0495658_0024872 3300046683 Bacteria 3195
228 Ga0495613_0003052 3300046689 Bacteria 12512
229 Ga0495613_0017590 3300046689 Bacteria 5322
230 Ga0495613_0157150 3300046689 Bacteria 1619
231 Ga0495671_0012576 3300046692 Bacteria 4617
232 Ga0495649_0108543 3300046694 Bacteria 1472
233 Ga0495589_0003712 3300046794 Bacteria 8231
234 Ga0495600_0054883 3300046809 Bacteria 2602
235 Ga0495581_0008512 3300047315 Bacteria 5948
236 Ga0495604_0000808 3300047317 Bacteria 26330
237 Ga0495636_0031265 3300047318 Bacteria 2181
238 Ga0495674_0090307 3300047319 Bacteria 2618
239 Ga0495676_0019252 3300047321 Bacteria 6006
240 Ga0495676_0023046 3300047321 Bacteria 5409
241 Ga0495676_0023519 3300047321 Bacteria 5348
242 Ga0495687_001951 3300047443 Bacteria 17630
243 Ga0495687_004253 3300047443 Bacteria 9805
244 Ga0495687_066980 3300047443 Bacteria 1455
245 Ga0495685_000561 3300047447 Bacteria 11477
246 Ga0495685_000956 3300047447 Bacteria 8745
247 Ga0495685_005200 3300047447 Bacteria 4239
248 Ga0495685_010142 3300047447 Bacteria 3157
249 Ga0495681_0004584 3300047470 Bacteria 9409
250 Ga0495681_0007408 3300047470 Bacteria 7017
251 Ga0495686_0057876 3300047472 Bacteria 2418
252 Ga0495686_0188760 3300047472 Bacteria 1189
253 Ga0495593_0000622 3300047673 Bacteria 20247
254 Ga0495614_0037690 3300048089 Bacteria 2074
255 Ga0495614_0117951 3300048089 Bacteria 1168
256 Ga0495626_0015955 3300048091 Bacteria 3830
257 Ga0496100_0009260 3300048903 Bacteria 5530
258 Ga0496100_0058498 3300048903 Bacteria 2530
259 Ga0496101_0030151 3300048904 Bacteria 3800
260 Ga0496101_0034047 3300048904 Bacteria 3597
261 Ga0496101_0187095 3300048904 Bacteria 1597
262 Ga0496102_0092279 3300048905 Bacteria 2804
263 Ga0496104_0004610 3300048907 Bacteria 12010
264 Ga0496104_0022331 3300048907 Bacteria 5812
265 Ga0496105_0011790 3300048908 Bacteria 6921
266 Ga0496105_0018079 3300048908 Bacteria 5658
267 Ga0496105_0207541 3300048908 Bacteria 1598
268 Ga0496106_0090512 3300048909 Bacteria 2361
269 Ga0496107_0117499 3300048910 Bacteria 1958
270 Ga0496108_0115914 3300048911 Bacteria 2295
271 Ga0496109_0016242 3300048912 Bacteria 6508
272 Ga0496110_0192811 3300048913 Bacteria 1850
273 Ga0496111_0010936 3300048914 Bacteria 6105
274 Ga0496114_0027047 3300048917 Bacteria 4699
275 Ga0496114_0111312 3300048917 Bacteria 2346
276 Ga0496114_0138099 3300048917 Bacteria 2108
277 Ga0496114_0336082 3300048917 Bacteria 1335
278 Ga0496114_0625927 3300048917 Bacteria 948
279 Ga0496115_0032567 3300048918 Bacteria 4112
280 Ga0495678_041197 3300049459 Bacteria 1850
281 Ga0501031_0073552 3300049568 Bacteria 2225
282 Ga0501033_0012016 3300049570 Bacteria 6614
283 Ga0501033_0066092 3300049570 Bacteria 2659
284 Ga0501034_0031689 3300049571 Bacteria 5369
285 Ga0501036_0135992 3300049572 Bacteria 2074
286 Ga0501038_0021515 3300049574 Bacteria 5787
287 Ga0501038_0307970 3300049574 Bacteria 1241
288 Ga0501043_0079727 3300049579 Bacteria 2572
289 Ga0501043_0112776 3300049579 Bacteria 2135
290 Ga0501046_0305612 3300049580 Bacteria 1161
291 Ga0501069_0274010 3300049585 Bacteria 987
292 Ga0501070_0247326 3300049586 Bacteria 1459
293 Ga0501080_0019298 3300049742 Bacteria 6316
294 Ga0501081_0070101 3300049743 Bacteria 2443
295 Ga0501035_0063803 3300049822 Bacteria 3275
296 Ga0501035_0236234 3300049822 Bacteria 1556
297 Ga0501044_0009669 3300049823 Bacteria 10489
298 Ga0501044_0169502 3300049823 Bacteria 2155
299 Ga0501044_0323397 3300049823 Bacteria 1466
300 Ga0501044_0491984 3300049823 Bacteria 1128
301 nmdc:mga03n38_12417_c1 3300050490 Bacteria 3205
302 nmdc:mga06z11_6615_c1 3300050494 Bacteria 4734
303 nmdc:mga05p37_797644_c1 3300050507 Bacteria 1034
304 nmdc:mga09592_294903_c1 3300050508 Bacteria 1406
305 nmdc:mga09592_338409_c1 3300050508 Bacteria 1303
306 nmdc:mga09592_351141_c1 3300050508 Bacteria 1276
307 nmdc:mga09592_59780_c1 3300050508 Bacteria 3222
308 nmdc:mga0qj67_1251_c1 3300050509 Bacteria 11596
309 nmdc:mga0qj67_578360_c1 3300050509 Bacteria 900
310 nmdc:mga06r32_2597_c1 3300050510 Bacteria 16140
311 nmdc:mga06r32_3272_c1 3300050510 Bacteria 14506
312 nmdc:mga08y16_441_c1 3300050511 Bacteria 38348
313 nmdc:mga08y16_79763_c1 3300050511 Bacteria 3412
314 nmdc:mga08y16_94598_c1 3300050511 Bacteria 3112
315 Ga0500578_0027167 3300053086 Bacteria 3673
316 Ga0500646_0000586 3300053090 Bacteria 10495
317 Ga0500583_0089794 3300053092 Bacteria 1494
318 Ga0500640_001631 3300053095 Bacteria 6944
319 Ga0500654_098219 3300053099 Bacteria 1264
320 Ga0500569_004538 3300053109 Bacteria 2924
321 Ga0500572_004920 3300053111 Bacteria 3024
322 Ga0500628_001982 3300053129 Bacteria 3441
323 Ga0500658_0005050 3300053134 Bacteria 4909
324 Ga0500573_0148168 3300053140 Bacteria 1287
325 Ga0500579_024697 3300053143 Bacteria 3883
326 Ga0500600_0019469 3300053149 Bacteria 4086
327 Ga0500616_0002747 3300053153 Bacteria 14241
328 Ga0500627_0145444 3300053158 Bacteria 1071
329 Ga0500633_0000271 3300053160 Bacteria 7579
330 Ga0500656_025731 3300053732 Bacteria 756
331 Ga0500587_000761 3300053739 Bacteria 4167
332 Ga0466962_0004268 3300061719 Bacteria 6847
333 Ga0466962_0009340 3300061719 Bacteria 4698
334 Ga0530510_0052309 3300061734 Bacteria 2952
335 2547412130 2547132111 Bacteria 8013147
336 2585304022 2582581313 Bacteria 10042643
337 2585312019 2582581314 Bacteria 11452267
338 2616699013 2616644814 Bacteria 11555299
339 2644263790 2643221647 Bacteria 10741251
340 2644438127 2643221678 Bacteria 9540101
341 2644631881 2643221714 Bacteria 9015452
342 2774392685 2773857762 Bacteria 5971770
343 2784591888 2784132148 Bacteria 8627943
344 2785339826 2784746763 Bacteria 9783172
345 2785373110 2784746768 Bacteria 10036182
346 2786674926 2786546132 Bacteria 10419719
347 2808845259 2808606359 Bacteria 9866990
348 2808914956 2808606375 Bacteria 9466072
349 2809196487 2808606439 Bacteria 5952208
350 2809235499 2808606448 Bacteria 8656184
351 2811843325 2808606982 Bacteria 7791042
352 2812351359 2811994878 Bacteria 5992952
353 2852636076 2852635781 Bacteria 8251373
354 2861525518 2861520306 Bacteria 8348283
355 2862283123 2862281513 Bacteria 9621493
356 2862388694 2862382967 Bacteria 10317375
357 2862512139 2862507626 Bacteria 9425308
358 2862576268 2862574272 Bacteria 10567477
359 2863410194 2863404153 Bacteria 9672205
360 2867431250 2867428634 Bacteria 9590268
361 2867475540 2867475112 Bacteria 6909112
362 2873152694 2873151551 Bacteria 8625867
363 2877677784 2877676314 Bacteria 9512378
364 2891971022 2891968417 Bacteria 5821697
365 2912716070 2912715099 Bacteria 9460473
366 2912729028 2912723979 Bacteria 8557534
367 2919470947 2919468124 Bacteria 9133025
368 2946071246 2946064051 Bacteria 8957905
369 2946079087 2946072368 Bacteria 8999607
370 2947225497 2947224130 Bacteria 9938529
371 2954009701 2954002825 Bacteria 9173742
372 2954382572 2954380949 Bacteria 10050426
373 2954680476 2954673503 Bacteria 9685905
374 2954683676 2954682443 Bacteria 9862841
375 2954693372 2954691527 Bacteria 10720516
376 2954713078 2954711539 Bacteria 10867210
377 2954723038 2954721474 Bacteria 10456478
378 2954738792 2954731030 Bacteria 10243860
379 2954741945 2954740390 Bacteria 10229294
380 2954757649 2954749733 Bacteria 10366972
381 2954760922 2954759201 Bacteria 9358192
382 2997454073 2997451912 Bacteria 8492419
383 2997601879 2997600082 Bacteria 9896405
384 3006494791 3006493962 Bacteria 8825450
385 8023625784 8023623736 Bacteria 8593882
386 8047900029 8047893842 Bacteria 11723082
387 8048132930 8048127548 Bacteria 11053136
388 8048358899 8048356638 Bacteria 11044339
389 8048376977 8048369669 Bacteria 11666822
390 8048386031 8048379754 Bacteria 11877923
391 8048409683 8048406513 Bacteria 8936924
392 8056836040 8056829672 Bacteria 9045328
393 Ga0207426_1063538
394 JGI24737J22298_10008327
395 JGI25406J46586_10034341
396 rootL2_10036488
397 rootL2_10082355
398 rootH1_10000102
399 rootH1_10000109
400 Ga0006562J51391_1175031
401 Ga0070670_100373209
402 Ga0070691_10175050
403 Ga0070687_100192591
404 Ga0070668_100006308
405 Ga0070669_100021454
406 Ga0070674_100075190
407 Ga0070709_10146465
408 Ga0070714_100134704
409 Ga0070713_100179810
410 Ga0070700_100160527
411 Ga0070662_100008612
412 Ga0070681_10117679
413 Ga0068867_100005490
414 Ga0070685_10201255
415 Ga0068853_100013929
416 Ga0070686_100130233
417 Ga0070665_100071225
418 Ga0068854_100644092
419 Ga0070702_100119235
420 Ga0068859_100670401
421 Ga0068864_100844734
422 Ga0068866_10002011
423 Ga0068861_100002733
424 Ga0068863_100008293
425 Ga0068863_100312321
426 Ga0068862_100003221
427 Ga0068862_100095133
428 Ga0081455_10006692
429 Ga0081455_10166280
430 Ga0081539_10008872
431 Ga0075363_100012588
432 Ga0075367_10000764
433 Ga0075428_100191219
434 Ga0075430_100463752
435 Ga0075431_100001391
436 Ga0075431_100364829
437 Ga0075429_100312097
438 Ga0097620_100670432
439 Ga0105245_10428236
440 Ga0105247_10146686
441 Ga0114129_10998013
442 Ga0105243_10235966
443 Ga0105242_10082281
444 Ga0105242_10127836
445 Ga0105249_10008499
446 Ga0105249_10347896
447 Ga0105239_10020565
448 Ga0105239_10674159
449 Ga0157369_10375311
450 Ga0157375_10169383
451 Ga0157380_10147500
452 Ga0157380_10288185
453 Ga0182008_10000702
454 Ga0182006_1035718
455 Ga0182007_10000377
456 Ga0183367_1001
457 Ga0209758_1002382
458 Ga0207426_1000758
459 Ga0207426_1001275
460 Ga0207426_1015262
461 Ga0207642_10002482
462 Ga0207647_10022817
463 Ga0207662_10312850
464 Ga0207681_10008388
465 Ga0207700_10212058
466 Ga0207706_10006365
467 Ga0207706_10324628
468 Ga0207686_10010741
469 Ga0207709_10037494
470 Ga0207669_10052273
471 Ga0207704_10163617
472 Ga0207691_10059606
473 Ga0207712_10004628
474 Ga0207712_10046369
475 Ga0207668_10092941
476 Ga0207658_10504506
477 Ga0207639_10450311
478 Ga0207678_10287403
479 Ga0207708_10037582
480 Ga0207641_10293539
481 Ga0207648_10001273
482 Ga0207676_10598974
483 Ga0207674_10005982
484 Ga0207674_10244269
485 Ga0207675_100012291
486 Ga0207675_100126084
487 Ga0209371_1018942
488 Ga0207428_10095849
489 Ga0268266_10036933
490 Ga0268265_10026587
491 Ga0307517_10005656
492 Ga0307517_10006621
493 Ga0307515_10000163
494 Ga0307515_10021485
495 Ga0307515_10122144
496 Ga0268256_1021266
497 Ga0307511_10000150
498 Ga0307511_10093646
499 Ga0307512_10002995
500 Ga0307512_10046066
501 Ga0307513_10006849
502 Ga0307513_10121909
503 Ga0307509_10028733
504 Ga0307509_10093162
505 Ga0307509_10135083
506 Ga0307508_10008953
507 Ga0307508_10011718
508 Ga0307508_10041613
509 Ga0307508_10154708
510 Ga0307514_10188551
511 Ga0307516_10001998
512 Ga0307516_10013008
513 Ga0307516_10018086
514 Ga0307518_10038872
515 Ga0307518_10061259
516 Ga0307518_10137090
517 Ga0307407_10219133
518 Ga0307409_100530315
519 Ga0307507_10007832
520 Ga0307510_10015605
521 Ga0307510_10023047
522 Ga0307510_10023601
523 Ga0307510_10145113
524 Ga0395898_0003047
525 Ga0395898_0003491
526 Ga0395898_0046986
527 Ga0395905_0077415
528 Ga0395901_0058197
529 Ga0439439_0005017
530 Ga0451837_0923568
531 Ga0451853_0117108
532 Ga0451853_3330844
533 Ga0451853_3964651
534 Ga0439433_0001813
535 Ga0439442_040429
536 Ga0439448_0006799
537 Ga0439448_0064303
538 Ga0439449_0002071
539 Ga0439449_0015971
540 Ga0439455_0003195
541 Ga0439457_000534
542 Ga0439457_001425
543 Ga0450903_000863
544 Ga0439458_0001935
545 Ga0466972_0001272
546 Ga0466965_0012211
547 Ga0466965_0018504
548 Ga0466965_0105089
549 Ga0466966_0002941
550 Ga0466966_0005033
551 Ga0466961_0003148
552 Ga0466961_0052463
553 Ga0466963_0001169
554 Ga0466963_0116063
555 Ga0466964_0088100
556 Ga0466971_0001122
557 Ga0466970_0004932
558 Ga0466970_0011368
559 Ga0466970_0080311
560 Ga0466970_0379310
561 Ga0466957_0001956
562 Ga0466957_0521486
563 Ga0466960_0030844
564 Ga0466959_0001360
565 Ga0466959_0443949
566 Ga0466958_0000912
567 Ga0466958_0449111
568 Ga0466967_0016905
569 Ga0466967_0244185
570 Ga0466967_0280101
571 Ga0466967_0435790
572 Ga0466967_0794653
573 Ga0495603_0073176
574 Ga0495629_0017275
575 Ga0495629_0018655
576 Ga0495629_0238781
577 Ga0495629_0440814
578 Ga0495638_0033098
579 Ga0495651_0010325
580 Ga0495605_0066794
581 Ga0495662_0005125
582 Ga0495664_0271988
583 Ga0495584_0055946
584 Ga0495594_0031373
585 Ga0495594_0033964
586 Ga0495594_0083639
587 Ga0495607_0090577
588 Ga0495583_0053876
589 Ga0495606_0012292
590 Ga0495610_0040020
591 Ga0495616_0096206
592 Ga0495620_0005326
593 Ga0495628_0045172
594 Ga0495628_0309665
595 Ga0495630_0019701
596 Ga0495631_0006832
597 Ga0495643_0004189
598 Ga0495652_0045524
599 Ga0495640_0008995
600 Ga0495587_0002003
601 Ga0495597_0085444
602 Ga0495645_0001357
603 Ga0495622_0028193
604 Ga0495668_0011913
605 Ga0495634_0000940
606 Ga0495611_0018007
607 Ga0495611_0066290
608 Ga0495625_0017444
609 Ga0495625_0061224
610 Ga0495625_0135654
611 Ga0495635_0002126
612 Ga0495659_0175431
613 Ga0495588_0005032
614 Ga0495657_0005988
615 Ga0495657_0016406
616 Ga0495646_0000248
617 Ga0495658_0024872
618 Ga0495613_0003052
619 Ga0495613_0017590
620 Ga0495613_0157150
621 Ga0495671_0012576
622 Ga0495649_0108543
623 Ga0495589_0003712
624 Ga0495600_0054883
625 Ga0495581_0008512
626 Ga0495604_0000808
627 Ga0495636_0031265
628 Ga0495674_0090307
629 Ga0495676_0019252
630 Ga0495676_0023046
631 Ga0495676_0023519
632 Ga0495687_001951
633 Ga0495687_004253
634 Ga0495687_066980
635 Ga0495685_000561
636 Ga0495685_000956
637 Ga0495685_005200
638 Ga0495685_010142
639 Ga0495681_0004584
640 Ga0495681_0007408
641 Ga0495686_0057876
642 Ga0495686_0188760
643 Ga0495593_0000622
644 Ga0495614_0037690
645 Ga0495614_0117951
646 Ga0495626_0015955
647 Ga0496100_0009260
648 Ga0496100_0058498
649 Ga0496101_0030151
650 Ga0496101_0034047
651 Ga0496101_0187095
652 Ga0496102_0092279
653 Ga0496104_0004610
654 Ga0496104_0022331
655 Ga0496105_0011790
656 Ga0496105_0018079
657 Ga0496105_0207541
658 Ga0496106_0090512
659 Ga0496107_0117499
660 Ga0496108_0115914
661 Ga0496109_0016242
662 Ga0496110_0192811
663 Ga0496111_0010936
664 Ga0496114_0027047
665 Ga0496114_0111312
666 Ga0496114_0138099
667 Ga0496114_0336082
668 Ga0496114_0625927
669 Ga0496115_0032567
670 Ga0495678_041197
671 Ga0501031_0073552
672 Ga0501033_0012016
673 Ga0501033_0066092
674 Ga0501034_0031689
675 Ga0501036_0135992
676 Ga0501038_0021515
677 Ga0501038_0307970
678 Ga0501043_0079727
679 Ga0501043_0112776
680 Ga0501046_0305612
681 Ga0501069_0274010
682 Ga0501070_0247326
683 Ga0501080_0019298
684 Ga0501081_0070101
685 Ga0501035_0063803
686 Ga0501035_0236234
687 Ga0501044_0009669
688 Ga0501044_0169502
689 Ga0501044_0323397
690 Ga0501044_0491984
691 nmdc:mga03n38_12417_c1
692 nmdc:mga06z11_6615_c1
693 nmdc:mga05p37_797644_c1
694 nmdc:mga09592_294903_c1
695 nmdc:mga09592_338409_c1
696 nmdc:mga09592_351141_c1
697 nmdc:mga09592_59780_c1
698 nmdc:mga0qj67_1251_c1
699 nmdc:mga0qj67_578360_c1
700 nmdc:mga06r32_2597_c1
701 nmdc:mga06r32_3272_c1
702 nmdc:mga08y16_441_c1
703 nmdc:mga08y16_79763_c1
704 nmdc:mga08y16_94598_c1
705 Ga0500578_0027167
706 Ga0500646_0000586
707 Ga0500583_0089794
708 Ga0500640_001631
709 Ga0500654_098219
710 Ga0500569_004538
711 Ga0500572_004920
712 Ga0500628_001982
713 Ga0500658_0005050
714 Ga0500573_0148168
715 Ga0500579_024697
716 Ga0500600_0019469
717 Ga0500616_0002747
718 Ga0500627_0145444
719 Ga0500633_0000271
720 Ga0500656_025731
721 Ga0500587_000761
722 Ga0466962_0004268
723 Ga0466962_0009340
724 Ga0530510_0052309
725 2547412130
726 2585304022
727 2585312019
728 2616699013
729 2644263790
730 2644438127
731 2644631881
732 2774392685
733 2784591888
734 2785339826
735 2785373110
736 2786674926
737 2808845259
738 2808914956
739 2809196487
740 2809235499
741 2811843325
742 2812351359
743 2852636076
744 2861525518
745 2862283123
746 2862388694
747 2862512139
748 2862576268
749 2863410194
750 2867431250
751 2867475540
752 2873152694
753 2877677784
754 2891971022
755 2912716070
756 2912729028
757 2919470947
758 2946071246
759 2946079087
760 2947225497
761 2954009701
762 2954382572
763 2954680476
764 2954683676
765 2954693372
766 2954713078
767 2954723038
768 2954738792
769 2954741945
770 2954757649
771 2954760922
772 2997454073
773 2997601879
774 3006494791
775 8023625784
776 8047900029
777 8048132930
778 8048358899
779 8048376977
780 8048386031
781 8048409683
782 8056836040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bpb-assembly2.cif.gz_B crystal structure of the dimethylarginine dimethylaminohydrolase h162g adduct with s-methyl-l-thiocitrulline 0.9308 3 253
3p8p-assembly2.cif.gz_B crystal structure of human dimethylarginine dimethylaminohydrolase-1 (ddah-1) variant c274s bound with n5-(1-iminopentyl)-l-ornithine 0.929 3 252
1h70-assembly1.cif.gz_A ddah from pseudomonas aeruginosa. c249s mutant complexed with citrulline 0.9286 3 253
3i4a-assembly1.cif.gz_A crystal structure of dimethylarginine dimethylaminohydrolase-1 (ddah-1) in complex with n5-(1-iminopropyl)-l-ornithine 0.9262 3 251
7ulv-assembly6.cif.gz_F human ddah1 soaked with its inactivator s-((4-chloropyridin-2-yl)methyl)-l-cysteine 0.9214 3 251
ID Description Score Start End Superfamily
3bpbA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.931 3 253 3.75.10.10
3bpbA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9169 3 253 3.75.10.10
af_E9AG92_3_283_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9152 3 253 3.75.10.10
2jajB00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9027 5 251 3.75.10.10
af_A5PN62_6_283_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9005 5 253 3.75.10.10
ID Description Score Start End GO Terms
AF-A0A7X5VEF8-F1-model_v4 Dimethylargininase (EC 3.5.3.18) 0.9981 4 255 GO:0000052
GO:0006525
GO:0016403
GO:0016597
GO:0045429
AF-A0A4V6PT66-F1-model_v4 Dimethylargininase 0.9978 3 254 GO:0000052
GO:0006525
GO:0016403
GO:0016597
GO:0045429
AF-A0A4R7ITJ8-F1-model_v4 deleted 0.9975 1 258
AF-A0A7K1E237-F1-model_v4 Dimethylarginine dimethylaminohydrolase 0.9961 3 254 GO:0000052
GO:0006525
GO:0016020
GO:0016403
GO:0016597
GO:0045429
AF-A0A388SZZ3-F1-model_v4 N(G),N(G)-dimethylarginine dimethylaminohydrolase 0.9959 1 258 GO:0000052
GO:0006525
GO:0016403
GO:0016597
GO:0045429

Map