F431729

General Info

Members Datasets Scaffolds Average Seq Length
390 225 780 356

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10175460|Ga0163162_101754603
Length 392
Sequence VPGYENNLSRPAIRFWNGMHHLEEKSKLKSNMKATQLLHNLGQSLWLDNITRDLLNNGRLKSYLDELSVTGLTSNPTIFDHAIKNSTAYDAAILDGLEKARSSENLFFDLALDDLTKAADLFRTIYDRTNGVDGWVSLEVSPLLAHDTAQTIAAARQLFARAGRPNLFIKIPGTPEGLPAIEEAIFAGVPVNVTLLFSREHYLAAAEAYLRGIERRMDAGLDPSVGSVASVFVSRWDSAVAGKIPAPLNNRLGIAIAGRTYKAYRDLLASPRWQRSYNAGARPQRLLWASTGTKDPKASDVLYVKSLAAPFTVNTMPEATLKALADHGELGSIMAADGGDCEQVLEQFAQAGINVENLAAKLQDEGAKSFVKSWNELLGVIASKSTELRKAA

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
160 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
161 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.05
Rhizosphere 96.41
Stem 0
Stem Tuber 0
Unclassified 7.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10175460 3300013306 Unclassified 2268
2 Ga0058862_12765769 3300004803 Unclassified 1583
3 Ga0065712_10001174 3300005290 Bacteria 10181
4 Ga0065707_10088610 3300005295 Bacteria 4607
5 Ga0070676_10003741 3300005328 Bacteria 7973
6 Ga0070683_100003020 3300005329 Bacteria 13516
7 Ga0070690_100018463 3300005330 Bacteria 4213
8 Ga0070690_100085511 3300005330 Bacteria 2069
9 Ga0070670_100078530 3300005331 Bacteria 2835
10 Ga0068869_100022784 3300005334 Bacteria 4320
11 Ga0070680_100011827 3300005336 Bacteria 6769
12 Ga0070660_100191772 3300005339 Unclassified 1655
13 Ga0070689_100029455 3300005340 Bacteria 4156
14 Ga0070689_100038821 3300005340 Unclassified 3643
15 Ga0070691_10071514 3300005341 Unclassified 1684
16 Ga0070687_100003639 3300005343 Bacteria 6021
17 Ga0070661_100239459 3300005344 Unclassified 1397
18 Ga0070668_100068225 3300005347 Bacteria 2764
19 Ga0070669_100124598 3300005353 Bacteria 1970
20 Ga0070675_100072347 3300005354 Bacteria 2862
21 Ga0070675_100156671 3300005354 Unclassified 1956
22 Ga0070673_100030523 3300005364 Bacteria 4035
23 Ga0070688_100043675 3300005365 Bacteria 2763
24 Ga0070688_100080619 3300005365 Bacteria 2105
25 Ga0070659_100105528 3300005366 Unclassified 2270
26 Ga0070659_100171034 3300005366 Bacteria 1780
27 Ga0070667_100078773 3300005367 Bacteria 2816
28 Ga0070667_100085153 3300005367 Bacteria 2710
29 Ga0070667_100098629 3300005367 Bacteria 2521
30 Ga0070667_100134015 3300005367 Bacteria 2165
31 Ga0070709_10019844 3300005434 Bacteria 3893
32 Ga0070709_10195879 3300005434 Bacteria 1428
33 Ga0070714_100190369 3300005435 Bacteria 1872
34 Ga0070713_100128212 3300005436 Bacteria 2235
35 Ga0070713_100129266 3300005436 Bacteria 2225
36 Ga0070713_100178149 3300005436 Bacteria 1909
37 Ga0070705_100138759 3300005440 Bacteria 1597
38 Ga0070705_100167699 3300005440 Bacteria 1474
39 Ga0070700_100088321 3300005441 Unclassified 2017
40 Ga0070700_100165673 3300005441 Bacteria 1526
41 Ga0070708_100004157 3300005445 Bacteria 11367
42 Ga0070708_100020618 3300005445 Bacteria 5563
43 Ga0070708_100330860 3300005445 Bacteria 1435
44 Ga0070662_100018740 3300005457 Bacteria 4687
45 Ga0070681_10017462 3300005458 Bacteria 7172
46 Ga0068867_100037494 3300005459 Bacteria 3523
47 Ga0070706_100006609 3300005467 Bacteria 10939
48 Ga0070706_100116606 3300005467 Bacteria 2487
49 Ga0070706_100247667 3300005467 Bacteria 1664
50 Ga0070707_100013935 3300005468 Bacteria 7530
51 Ga0070707_100024504 3300005468 Bacteria 5715
52 Ga0070707_100035644 3300005468 Bacteria 4747
53 Ga0070698_100010569 3300005471 Bacteria 9839
54 Ga0070698_100029133 3300005471 Bacteria 5730
55 Ga0070698_100073005 3300005471 Unclassified 3438
56 Ga0070698_100104227 3300005471 Bacteria 2806
57 Ga0070698_100272899 3300005471 Bacteria 1623
58 Ga0070699_100004626 3300005518 Bacteria 12174
59 Ga0070679_100246591 3300005530 Unclassified 1743
60 Ga0070684_100019864 3300005535 Bacteria 5566
61 Ga0070697_100010949 3300005536 Bacteria 7086
62 Ga0070697_100045241 3300005536 Bacteria 3567
63 Ga0070697_100079273 3300005536 Bacteria 2703
64 Ga0070697_100174084 3300005536 Bacteria 1823
65 Ga0070697_100314023 3300005536 Bacteria 1349
66 Ga0068853_100245470 3300005539 Bacteria 1642
67 Ga0070672_100043453 3300005543 Bacteria 3465
68 Ga0070672_100045429 3300005543 Bacteria 3397
69 Ga0070686_100027054 3300005544 Bacteria 3468
70 Ga0070665_100134934 3300005548 Bacteria 2470
71 Ga0070704_100066248 3300005549 Bacteria 2603
72 Ga0070664_100049012 3300005564 Bacteria 3571
73 Ga0070664_100118938 3300005564 Bacteria 2312
74 Ga0068856_100122869 3300005614 Bacteria 2599
75 Ga0068856_100331630 3300005614 Bacteria 1539
76 Ga0070702_100026602 3300005615 Bacteria 3111
77 Ga0068859_100341749 3300005617 Bacteria 1591
78 Ga0068870_10103161 3300005840 Unclassified 1616
79 Ga0068863_100030621 3300005841 Bacteria 5137
80 Ga0068863_100042017 3300005841 Bacteria 4345
81 Ga0068863_100095762 3300005841 Bacteria 2818
82 Ga0068858_100000106 3300005842 Bacteria 87461
83 Ga0068858_100091168 3300005842 Bacteria 2837
84 Ga0068860_100004825 3300005843 Bacteria 13732
85 Ga0068860_100016496 3300005843 Bacteria 7203
86 Ga0068862_100208155 3300005844 Unclassified 1766
87 Ga0081455_10002839 3300005937 Bacteria 20393
88 Ga0081455_10009669 3300005937 Bacteria 9890
89 Ga0081540_1060055 3300005983 Bacteria 1821
90 Ga0081540_1065306 3300005983 Bacteria 1712
91 Ga0081539_10000909 3300005985 Bacteria 56067
92 Ga0070717_10028406 3300006028 Bacteria 4477
93 Ga0070717_10094957 3300006028 Bacteria 2523
94 Ga0070717_10110255 3300006028 Bacteria 2347
95 Ga0075432_10003313 3300006058 Bacteria 5445
96 Ga0070712_100039037 3300006175 Bacteria 3247
97 Ga0070712_100101834 3300006175 Bacteria 2125
98 Ga0070712_100125710 3300006175 Bacteria 1937
99 Ga0097621_100004900 3300006237 Bacteria 9386
100 Ga0068871_100294631 3300006358 Unclassified 1423
101 Ga0068871_100308180 3300006358 Bacteria 1391
102 Ga0075428_100034356 3300006844 Bacteria 5594
103 Ga0075428_100088174 3300006844 Bacteria 3384
104 Ga0075428_100143318 3300006844 Bacteria 2597
105 Ga0075428_100147887 3300006844 Bacteria 2553
106 Ga0075428_100437310 3300006844 Bacteria 1401
107 Ga0075430_100041253 3300006846 Bacteria 3905
108 Ga0075431_100000931 3300006847 Bacteria 25851
109 Ga0075431_100041545 3300006847 Bacteria 4741
110 Ga0075431_100043263 3300006847 Bacteria 4648
111 Ga0075431_100420154 3300006847 Bacteria 1336
112 Ga0075433_10001225 3300006852 Bacteria 18731
113 Ga0075433_10063526 3300006852 Bacteria 3235
114 Ga0075433_10097874 3300006852 Bacteria 2597
115 Ga0075433_10123106 3300006852 Bacteria 2304
116 Ga0075433_10293867 3300006852 Bacteria 1439
117 Ga0075433_10319626 3300006852 Unclassified 1373
118 Ga0075433_10350945 3300006852 Bacteria 1304
119 Ga0075434_100000560 3300006871 Bacteria 28562
120 Ga0075434_100006591 3300006871 Bacteria 10653
121 Ga0075434_100407628 3300006871 Bacteria 1380
122 Ga0075429_100007019 3300006880 Bacteria 9787
123 Ga0075429_100011026 3300006880 Bacteria 7820
124 Ga0075429_100289815 3300006880 Bacteria 1433
125 Ga0075429_100301575 3300006880 Bacteria 1402
126 Ga0075436_100003908 3300006914 Bacteria 10210
127 Ga0075436_100012382 3300006914 Bacteria 5848
128 Ga0075436_100015817 3300006914 Bacteria 5166
129 Ga0097620_100341748 3300006931 Bacteria 1591
130 Ga0075435_100177799 3300007076 Bacteria 1797
131 Ga0075435_100218140 3300007076 Bacteria 1619
132 Ga0099794_10002732 3300007265 Bacteria 6583
133 Ga0099794_10004385 3300007265 Bacteria 5532
134 Ga0099794_10076540 3300007265 Bacteria 1645
135 Ga0099795_10001193 3300007788 Bacteria 5473
136 Ga0105240_10491473 3300009093 Bacteria 1366
137 Ga0111539_10061070 3300009094 Bacteria 4465
138 Ga0111539_10091865 3300009094 Bacteria 3567
139 Ga0111539_10209622 3300009094 Bacteria 2271
140 Ga0111539_10262921 3300009094 Bacteria 2009
141 Ga0111539_10495974 3300009094 Bacteria 1422
142 Ga0105245_10021375 3300009098 Bacteria 5676
143 Ga0105247_10010818 3300009101 Bacteria 5510
144 Ga0105247_10021466 3300009101 Bacteria 3885
145 Ga0114129_10036606 3300009147 Bacteria 6928
146 Ga0114129_10054357 3300009147 Bacteria 5613
147 Ga0114129_10089051 3300009147 Bacteria 4278
148 Ga0114129_10113227 3300009147 Bacteria 3741
149 Ga0114129_10529485 3300009147 Bacteria 1535
150 Ga0105242_10031130 3300009176 Bacteria 4260
151 Ga0105242_10143546 3300009176 Bacteria 2074
152 Ga0105248_10071023 3300009177 Bacteria 3910
153 Ga0105237_10035099 3300009545 Bacteria 5076
154 Ga0105238_10001338 3300009551 Bacteria 24740
155 Ga0105238_10020303 3300009551 Bacteria 6763
156 Ga0105249_10405367 3300009553 Unclassified 1395
157 Ga0105246_10019063 3300011119 Bacteria 4378
158 Ga0157374_10168484 3300013296 Bacteria 2136
159 Ga0157374_10192398 3300013296 Bacteria 1995
160 Ga0157374_10202935 3300013296 Bacteria 1942
161 Ga0157378_10100013 3300013297 Bacteria 2646
162 Ga0163162_10102871 3300013306 Bacteria 2950
163 Ga0157372_10021447 3300013307 Bacteria 6980
164 Ga0157375_10068307 3300013308 Bacteria 3556
165 Ga0157375_10455897 3300013308 Bacteria 1444
166 Ga0163163_10026891 3300014325 Bacteria 5505
167 Ga0163163_10320370 3300014325 Bacteria 1604
168 Ga0163163_10370290 3300014325 Unclassified 1490
169 Ga0157380_10172938 3300014326 Unclassified 1889
170 Ga0157379_10018043 3300014968 Bacteria 6220
171 Ga0157376_10048510 3300014969 Bacteria 3512
172 Ga0213872_10008354 3300021361 Bacteria 5012
173 Ga0213872_10041400 3300021361 Unclassified 2103
174 Ga0213871_10007467 3300021441 Bacteria 2366
175 Ga0207710_10010704 3300025900 Bacteria 3861
176 Ga0207710_10020233 3300025900 Bacteria 2845
177 Ga0207710_10049753 3300025900 Bacteria 1879
178 Ga0207680_10050344 3300025903 Bacteria 2485
179 Ga0207680_10075819 3300025903 Bacteria 2098
180 Ga0207647_10007190 3300025904 Bacteria 8065
181 Ga0207685_10038319 3300025905 Bacteria 1771
182 Ga0207699_10032449 3300025906 Bacteria 2943
183 Ga0207699_10181874 3300025906 Bacteria 1414
184 Ga0207645_10009733 3300025907 Bacteria 6637
185 Ga0207645_10023247 3300025907 Bacteria 4029
186 Ga0207643_10084991 3300025908 Bacteria 1837
187 Ga0207684_10000956 3300025910 Bacteria 32546
188 Ga0207684_10012910 3300025910 Bacteria 7234
189 Ga0207684_10022014 3300025910 Bacteria 5443
190 Ga0207684_10101677 3300025910 Bacteria 2457
191 Ga0207707_10100953 3300025912 Bacteria 2521
192 Ga0207671_10006879 3300025914 Bacteria 10035
193 Ga0207693_10026867 3300025915 Bacteria 4553
194 Ga0207693_10085121 3300025915 Bacteria 2477
195 Ga0207693_10127407 3300025915 Bacteria 2001
196 Ga0207693_10135820 3300025915 Bacteria 1934
197 Ga0207663_10121096 3300025916 Bacteria 1792
198 Ga0207657_10016559 3300025919 Bacteria 7104
199 Ga0207646_10002315 3300025922 Bacteria 22587
200 Ga0207646_10026601 3300025922 Bacteria 5278
201 Ga0207646_10038555 3300025922 Bacteria 4304
202 Ga0207646_10119404 3300025922 Unclassified 2368
203 Ga0207681_10037992 3300025923 Bacteria 3186
204 Ga0207694_10090993 3300025924 Bacteria 2408
205 Ga0207650_10118636 3300025925 Bacteria 2057
206 Ga0207659_10025639 3300025926 Bacteria 3965
207 Ga0207659_10063640 3300025926 Bacteria 2667
208 Ga0207687_10127711 3300025927 Bacteria 1912
209 Ga0207664_10193068 3300025929 Bacteria 1754
210 Ga0207664_10336600 3300025929 Unclassified 1334
211 Ga0207690_10149186 3300025932 Bacteria 1732
212 Ga0207706_10023479 3300025933 Bacteria 5538
213 Ga0207706_10290745 3300025933 Bacteria 1425
214 Ga0207686_10230810 3300025934 Bacteria 1342
215 Ga0207669_10051674 3300025937 Bacteria 2464
216 Ga0207665_10038194 3300025939 Bacteria 3196
217 Ga0207665_10207390 3300025939 Unclassified 1430
218 Ga0207691_10006828 3300025940 Bacteria 11007
219 Ga0207691_10365122 3300025940 Bacteria 1234
220 Ga0207711_10184698 3300025941 Bacteria 1898
221 Ga0207689_10142765 3300025942 Bacteria 1973
222 Ga0207679_10005855 3300025945 Bacteria 7720
223 Ga0207667_10067292 3300025949 Bacteria 3732
224 Ga0207667_10070549 3300025949 Bacteria 3636
225 Ga0207651_10121527 3300025960 Bacteria 1981
226 Ga0207712_10111040 3300025961 Bacteria 2056
227 Ga0207668_10053008 3300025972 Bacteria 2809
228 Ga0207668_10119450 3300025972 Bacteria 1993
229 Ga0207658_10054882 3300025986 Bacteria 2950
230 Ga0207658_10113737 3300025986 Bacteria 2145
231 Ga0207658_10213123 3300025986 Bacteria 1620
232 Ga0207658_10252827 3300025986 Unclassified 1498
233 Ga0207677_10071756 3300026023 Bacteria 2445
234 Ga0207703_10001945 3300026035 Bacteria 18264
235 Ga0207703_10007855 3300026035 Bacteria 8437
236 Ga0207703_10113937 3300026035 Bacteria 2312
237 Ga0207703_10323793 3300026035 Bacteria 1412
238 Ga0207708_10009561 3300026075 Bacteria 7188
239 Ga0207702_10279063 3300026078 Bacteria 1579
240 Ga0207641_10100178 3300026088 Archaea 2551
241 Ga0207641_10149944 3300026088 Unclassified 2111
242 Ga0207641_10229702 3300026088 Bacteria 1724
243 Ga0207648_10000103 3300026089 Bacteria 82511
244 Ga0207648_10126800 3300026089 Bacteria 2245
245 Ga0207676_10286433 3300026095 Unclassified 1498
246 Ga0207674_10152957 3300026116 Bacteria 2263
247 Ga0207683_10018339 3300026121 Bacteria 5970
248 Ga0209973_1002133 3300027252 Unclassified 1815
249 Ga0209969_1002214 3300027360 Bacteria 2682
250 Ga0209967_1000158 3300027364 Bacteria 9220
251 Ga0209981_1006675 3300027378 Unclassified 1547
252 Ga0209984_1002038 3300027424 Bacteria 2231
253 Ga0210000_1009442 3300027462 Unclassified 1435
254 Ga0209995_1001198 3300027471 Bacteria 3987
255 Ga0209179_1000425 3300027512 Bacteria 4213
256 Ga0209968_1000145 3300027526 Bacteria 12407
257 Ga0209999_1011121 3300027543 Bacteria 1628
258 Ga0209982_1006052 3300027552 Bacteria 1754
259 Ga0209970_1000431 3300027614 Bacteria 7135
260 Ga0210002_1000290 3300027617 Bacteria 6923
261 Ga0209983_1000638 3300027665 Bacteria 7478
262 Ga0209588_1025688 3300027671 Bacteria 1866
263 Ga0209588_1038498 3300027671 Bacteria 1541
264 Ga0209971_1000320 3300027682 Bacteria 13282
265 Ga0209966_1000185 3300027695 Bacteria 25638
266 Ga0209998_10000152 3300027717 Bacteria 26074
267 Ga0209974_10007338 3300027876 Bacteria 3796
268 Ga0207428_10000229 3300027907 Bacteria 77280
269 Ga0268266_10113211 3300028379 Bacteria 2406
270 Ga0268265_10148441 3300028380 Bacteria 1974
271 Ga0268264_10072942 3300028381 Bacteria 2912
272 Ga0265337_1014673 3300028556 Bacteria 2592
273 Ga0265326_10019912 3300028558 Bacteria 1926
274 Ga0265323_10000219 3300028653 Bacteria 33640
275 Ga0265323_10019972 3300028653 Bacteria 2583
276 Ga0265338_10000096 3300028800 Bacteria 164859
277 Ga0265338_10003922 3300028800 Bacteria 20517
278 Ga0265338_10011925 3300028800 Bacteria 9972
279 Ga0265338_10022181 3300028800 Bacteria 6586
280 Ga0265760_10021452 3300031090 Bacteria 1869
281 Ga0265330_10027222 3300031235 Bacteria 2583
282 Ga0265330_10028215 3300031235 Bacteria 2531
283 Ga0265332_10000912 3300031238 Bacteria 17744
284 Ga0265328_10007830 3300031239 Bacteria 4439
285 Ga0265328_10018994 3300031239 Bacteria 2644
286 Ga0265320_10025566 3300031240 Bacteria 3102
287 Ga0265329_10004413 3300031242 Bacteria 5857
288 Ga0265329_10009567 3300031242 Bacteria 3606
289 Ga0265329_10039311 3300031242 Bacteria 1521
290 Ga0265339_10084527 3300031249 Bacteria 1672
291 Ga0265331_10000381 3300031250 Bacteria 46160
292 Ga0265331_10050311 3300031250 Bacteria 1998
293 Ga0265327_10019241 3300031251 Bacteria 4205
294 Ga0265316_10000522 3300031344 Bacteria 43400
295 Ga0265316_10012169 3300031344 Bacteria 7722
296 Ga0265316_10048738 3300031344 Bacteria 3341
297 Ga0265316_10054437 3300031344 Bacteria 3132
298 Ga0265316_10117209 3300031344 Bacteria 2013
299 Ga0265316_10146212 3300031344 Bacteria 1772
300 Ga0265316_10285980 3300031344 Bacteria 1204
301 Ga0265314_10000653 3300031711 Bacteria 42465
302 Ga0265314_10001989 3300031711 Bacteria 21700
303 Ga0265314_10098795 3300031711 Bacteria 1882
304 Ga0265342_10004444 3300031712 Bacteria 11047
305 Ga0265342_10034960 3300031712 Bacteria 3080
306 Ga0265342_10069972 3300031712 Bacteria 2048
307 Ga0316583_10000143 3300032133 Bacteria 17023
308 Ga0373934_0033963 3300035086 Bacteria 2004
309 Ga0373949_0021654 3300035090 Bacteria 1477
310 Ga0373953_0060427 3300035117 Bacteria 1549
311 Ga0373955_0022387 3300035172 Bacteria 3206
312 Ga0316574_0122047 3300035398 Unclassified 1673
313 Ga0373947_0171407 3300035725 Bacteria 1408
314 Ga0436360_0641168 3300039438 Bacteria 10527
315 Ga0436360_0750654 3300039438 Bacteria 1741
316 Ga0436360_1225930 3300039438 Bacteria 3155
317 Ga0436361_0260442 3300039447 Bacteria 3061
318 Ga0436361_1061707 3300039447 Bacteria 5067
319 Ga0436363_1406109 3300039450 Bacteria 2007
320 Ga0436362_0004099 3300039453 Bacteria 3629
321 Ga0436362_0925906 3300039453 Bacteria 5038
322 Ga0451577_0124545 3300042876 Bacteria 2309
323 Ga0451577_0318312 3300042876 Bacteria 1410
324 Ga0451576_0045592 3300045051 Bacteria 4617
325 Ga0451576_0115895 3300045051 Bacteria 2789
326 Ga0495592_0059016 3300046454 Bacteria 2827
327 Ga0495651_0023112 3300046462 Bacteria 4835
328 Ga0495580_0089206 3300046472 Unclassified 2147
329 Ga0495662_0046476 3300046476 Bacteria 2097
330 Ga0495664_0114516 3300046477 Bacteria 1629
331 Ga0495618_0081036 3300046514 Bacteria 2072
332 Ga0495628_0024605 3300046516 Bacteria 4926
333 Ga0495628_0060865 3300046516 Bacteria 2962
334 Ga0495652_0029307 3300046529 Bacteria 4837
335 Ga0495652_0032132 3300046529 Bacteria 4591
336 Ga0495645_0092377 3300046543 Unclassified 2161
337 Ga0495635_0199929 3300046663 Bacteria 1356
338 Ga0495599_0139693 3300046678 Bacteria 1503
339 Ga0495669_0007990 3300046684 Bacteria 4439
340 Ga0495604_0066713 3300047317 Bacteria 2736
341 Ga0495636_0040142 3300047318 Bacteria 1940
342 Ga0495675_0073672 3300047444 Bacteria 2153
343 Ga0495602_0095840 3300048088 Bacteria 2448
344 Ga0496100_0323548 3300048903 Bacteria 1159
345 Ga0496102_0099017 3300048905 Bacteria 2706
346 Ga0496106_0181557 3300048909 Bacteria 1671
347 Ga0496109_0031980 3300048912 Bacteria 4727
348 Ga0496112_0002667 3300048915 Bacteria 14423
349 Ga0496112_0017966 3300048915 Bacteria 6655
350 Ga0496112_0048891 3300048915 Bacteria 4144
351 Ga0496113_0059208 3300048916 Bacteria 2885
352 Ga0496121_0002383 3300048924 Bacteria 28844
353 Ga0496125_0012269 3300048928 Bacteria 8519
354 Ga0496125_0058699 3300048928 Bacteria 3106
355 Ga0496126_0019707 3300048929 Bacteria 6638
356 Ga0496126_0308502 3300048929 Bacteria 1303
357 Ga0501035_0019483 3300049822 Bacteria 6238
358 Ga0501045_0199113 3300049824 Bacteria 1492
359 nmdc:mga05p37_148274_c1 3300050507 Bacteria 2871
360 nmdc:mga05p37_167764_c1 3300050507 Bacteria 2679
361 nmdc:mga05p37_197351_c1 3300050507 Bacteria 2440
362 nmdc:mga05p37_261730_c1 3300050507 Bacteria 2070
363 nmdc:mga05p37_48695_c1 3300050507 Bacteria 5212
364 nmdc:mga09592_119656_c1 3300050508 Bacteria 2262
365 nmdc:mga09592_337710_c1 3300050508 Bacteria 1304
366 nmdc:mga09592_34182_c1 3300050508 Bacteria 4250
367 nmdc:mga09592_365328_c1 3300050508 Bacteria 1249
368 nmdc:mga06r32_129996_c1 3300050510 Bacteria 2490
369 nmdc:mga06r32_131831_c1 3300050510 Bacteria 2472
370 nmdc:mga06r32_2138_c1 3300050510 Bacteria 17654
371 nmdc:mga06r32_30792_c1 3300050510 Bacteria 5035
372 nmdc:mga06r32_89093_c1 3300050510 Bacteria 3012
373 nmdc:mga08y16_171416_c1 3300050511 Bacteria 2254
374 nmdc:mga08y16_280280_c1 3300050511 Bacteria 1720
375 nmdc:mga08y16_46123_c1 3300050511 Bacteria 4564
376 nmdc:mga0n895_218805_c1 3300050512 Bacteria 1934
377 nmdc:mga0rr50_178510_c1 3300050513 Bacteria 1735
378 nmdc:mga08x19_135445_c1 3300050514 Bacteria 1660
379 nmdc:mga08x19_137961_c1 3300050514 Bacteria 1645
380 nmdc:mga08x19_14696_c1 3300050514 Bacteria 4754
381 nmdc:mga08x19_59454_c1 3300050514 Bacteria 2474
382 nmdc:mga0a205_186644_c1 3300050515 Bacteria 1966
383 nmdc:mga0a205_223351_c1 3300050515 Bacteria 1769
384 nmdc:mga0a205_23095_c1 3300050515 Bacteria 5898
385 nmdc:mga0a205_242559_c1 3300050515 Bacteria 1683
386 nmdc:mga0a205_63343_c1 3300050515 Bacteria 3572
387 nmdc:mga0a205_92405_c1 3300050515 Bacteria 2924
388 Ga0495595_0013628 3300053084 Bacteria 3436
389 Ga0495619_0199346 3300053085 Bacteria 1385
390 Ga0501084_0048753 3300054114 Bacteria 3545
391 Ga0163162_10175460
392 Ga0058862_12765769
393 Ga0065712_10001174
394 Ga0065707_10088610
395 Ga0070676_10003741
396 Ga0070683_100003020
397 Ga0070690_100018463
398 Ga0070690_100085511
399 Ga0070670_100078530
400 Ga0068869_100022784
401 Ga0070680_100011827
402 Ga0070660_100191772
403 Ga0070689_100029455
404 Ga0070689_100038821
405 Ga0070691_10071514
406 Ga0070687_100003639
407 Ga0070661_100239459
408 Ga0070668_100068225
409 Ga0070669_100124598
410 Ga0070675_100072347
411 Ga0070675_100156671
412 Ga0070673_100030523
413 Ga0070688_100043675
414 Ga0070688_100080619
415 Ga0070659_100105528
416 Ga0070659_100171034
417 Ga0070667_100078773
418 Ga0070667_100085153
419 Ga0070667_100098629
420 Ga0070667_100134015
421 Ga0070709_10019844
422 Ga0070709_10195879
423 Ga0070714_100190369
424 Ga0070713_100128212
425 Ga0070713_100129266
426 Ga0070713_100178149
427 Ga0070705_100138759
428 Ga0070705_100167699
429 Ga0070700_100088321
430 Ga0070700_100165673
431 Ga0070708_100004157
432 Ga0070708_100020618
433 Ga0070708_100330860
434 Ga0070662_100018740
435 Ga0070681_10017462
436 Ga0068867_100037494
437 Ga0070706_100006609
438 Ga0070706_100116606
439 Ga0070706_100247667
440 Ga0070707_100013935
441 Ga0070707_100024504
442 Ga0070707_100035644
443 Ga0070698_100010569
444 Ga0070698_100029133
445 Ga0070698_100073005
446 Ga0070698_100104227
447 Ga0070698_100272899
448 Ga0070699_100004626
449 Ga0070679_100246591
450 Ga0070684_100019864
451 Ga0070697_100010949
452 Ga0070697_100045241
453 Ga0070697_100079273
454 Ga0070697_100174084
455 Ga0070697_100314023
456 Ga0068853_100245470
457 Ga0070672_100043453
458 Ga0070672_100045429
459 Ga0070686_100027054
460 Ga0070665_100134934
461 Ga0070704_100066248
462 Ga0070664_100049012
463 Ga0070664_100118938
464 Ga0068856_100122869
465 Ga0068856_100331630
466 Ga0070702_100026602
467 Ga0068859_100341749
468 Ga0068870_10103161
469 Ga0068863_100030621
470 Ga0068863_100042017
471 Ga0068863_100095762
472 Ga0068858_100000106
473 Ga0068858_100091168
474 Ga0068860_100004825
475 Ga0068860_100016496
476 Ga0068862_100208155
477 Ga0081455_10002839
478 Ga0081455_10009669
479 Ga0081540_1060055
480 Ga0081540_1065306
481 Ga0081539_10000909
482 Ga0070717_10028406
483 Ga0070717_10094957
484 Ga0070717_10110255
485 Ga0075432_10003313
486 Ga0070712_100039037
487 Ga0070712_100101834
488 Ga0070712_100125710
489 Ga0097621_100004900
490 Ga0068871_100294631
491 Ga0068871_100308180
492 Ga0075428_100034356
493 Ga0075428_100088174
494 Ga0075428_100143318
495 Ga0075428_100147887
496 Ga0075428_100437310
497 Ga0075430_100041253
498 Ga0075431_100000931
499 Ga0075431_100041545
500 Ga0075431_100043263
501 Ga0075431_100420154
502 Ga0075433_10001225
503 Ga0075433_10063526
504 Ga0075433_10097874
505 Ga0075433_10123106
506 Ga0075433_10293867
507 Ga0075433_10319626
508 Ga0075433_10350945
509 Ga0075434_100000560
510 Ga0075434_100006591
511 Ga0075434_100407628
512 Ga0075429_100007019
513 Ga0075429_100011026
514 Ga0075429_100289815
515 Ga0075429_100301575
516 Ga0075436_100003908
517 Ga0075436_100012382
518 Ga0075436_100015817
519 Ga0097620_100341748
520 Ga0075435_100177799
521 Ga0075435_100218140
522 Ga0099794_10002732
523 Ga0099794_10004385
524 Ga0099794_10076540
525 Ga0099795_10001193
526 Ga0105240_10491473
527 Ga0111539_10061070
528 Ga0111539_10091865
529 Ga0111539_10209622
530 Ga0111539_10262921
531 Ga0111539_10495974
532 Ga0105245_10021375
533 Ga0105247_10010818
534 Ga0105247_10021466
535 Ga0114129_10036606
536 Ga0114129_10054357
537 Ga0114129_10089051
538 Ga0114129_10113227
539 Ga0114129_10529485
540 Ga0105242_10031130
541 Ga0105242_10143546
542 Ga0105248_10071023
543 Ga0105237_10035099
544 Ga0105238_10001338
545 Ga0105238_10020303
546 Ga0105249_10405367
547 Ga0105246_10019063
548 Ga0157374_10168484
549 Ga0157374_10192398
550 Ga0157374_10202935
551 Ga0157378_10100013
552 Ga0163162_10102871
553 Ga0157372_10021447
554 Ga0157375_10068307
555 Ga0157375_10455897
556 Ga0163163_10026891
557 Ga0163163_10320370
558 Ga0163163_10370290
559 Ga0157380_10172938
560 Ga0157379_10018043
561 Ga0157376_10048510
562 Ga0213872_10008354
563 Ga0213872_10041400
564 Ga0213871_10007467
565 Ga0207710_10010704
566 Ga0207710_10020233
567 Ga0207710_10049753
568 Ga0207680_10050344
569 Ga0207680_10075819
570 Ga0207647_10007190
571 Ga0207685_10038319
572 Ga0207699_10032449
573 Ga0207699_10181874
574 Ga0207645_10009733
575 Ga0207645_10023247
576 Ga0207643_10084991
577 Ga0207684_10000956
578 Ga0207684_10012910
579 Ga0207684_10022014
580 Ga0207684_10101677
581 Ga0207707_10100953
582 Ga0207671_10006879
583 Ga0207693_10026867
584 Ga0207693_10085121
585 Ga0207693_10127407
586 Ga0207693_10135820
587 Ga0207663_10121096
588 Ga0207657_10016559
589 Ga0207646_10002315
590 Ga0207646_10026601
591 Ga0207646_10038555
592 Ga0207646_10119404
593 Ga0207681_10037992
594 Ga0207694_10090993
595 Ga0207650_10118636
596 Ga0207659_10025639
597 Ga0207659_10063640
598 Ga0207687_10127711
599 Ga0207664_10193068
600 Ga0207664_10336600
601 Ga0207690_10149186
602 Ga0207706_10023479
603 Ga0207706_10290745
604 Ga0207686_10230810
605 Ga0207669_10051674
606 Ga0207665_10038194
607 Ga0207665_10207390
608 Ga0207691_10006828
609 Ga0207691_10365122
610 Ga0207711_10184698
611 Ga0207689_10142765
612 Ga0207679_10005855
613 Ga0207667_10067292
614 Ga0207667_10070549
615 Ga0207651_10121527
616 Ga0207712_10111040
617 Ga0207668_10053008
618 Ga0207668_10119450
619 Ga0207658_10054882
620 Ga0207658_10113737
621 Ga0207658_10213123
622 Ga0207658_10252827
623 Ga0207677_10071756
624 Ga0207703_10001945
625 Ga0207703_10007855
626 Ga0207703_10113937
627 Ga0207703_10323793
628 Ga0207708_10009561
629 Ga0207702_10279063
630 Ga0207641_10100178
631 Ga0207641_10149944
632 Ga0207641_10229702
633 Ga0207648_10000103
634 Ga0207648_10126800
635 Ga0207676_10286433
636 Ga0207674_10152957
637 Ga0207683_10018339
638 Ga0209973_1002133
639 Ga0209969_1002214
640 Ga0209967_1000158
641 Ga0209981_1006675
642 Ga0209984_1002038
643 Ga0210000_1009442
644 Ga0209995_1001198
645 Ga0209179_1000425
646 Ga0209968_1000145
647 Ga0209999_1011121
648 Ga0209982_1006052
649 Ga0209970_1000431
650 Ga0210002_1000290
651 Ga0209983_1000638
652 Ga0209588_1025688
653 Ga0209588_1038498
654 Ga0209971_1000320
655 Ga0209966_1000185
656 Ga0209998_10000152
657 Ga0209974_10007338
658 Ga0207428_10000229
659 Ga0268266_10113211
660 Ga0268265_10148441
661 Ga0268264_10072942
662 Ga0265337_1014673
663 Ga0265326_10019912
664 Ga0265323_10000219
665 Ga0265323_10019972
666 Ga0265338_10000096
667 Ga0265338_10003922
668 Ga0265338_10011925
669 Ga0265338_10022181
670 Ga0265760_10021452
671 Ga0265330_10027222
672 Ga0265330_10028215
673 Ga0265332_10000912
674 Ga0265328_10007830
675 Ga0265328_10018994
676 Ga0265320_10025566
677 Ga0265329_10004413
678 Ga0265329_10009567
679 Ga0265329_10039311
680 Ga0265339_10084527
681 Ga0265331_10000381
682 Ga0265331_10050311
683 Ga0265327_10019241
684 Ga0265316_10000522
685 Ga0265316_10012169
686 Ga0265316_10048738
687 Ga0265316_10054437
688 Ga0265316_10117209
689 Ga0265316_10146212
690 Ga0265316_10285980
691 Ga0265314_10000653
692 Ga0265314_10001989
693 Ga0265314_10098795
694 Ga0265342_10004444
695 Ga0265342_10034960
696 Ga0265342_10069972
697 Ga0316583_10000143
698 Ga0373934_0033963
699 Ga0373949_0021654
700 Ga0373953_0060427
701 Ga0373955_0022387
702 Ga0316574_0122047
703 Ga0373947_0171407
704 Ga0436360_0641168
705 Ga0436360_0750654
706 Ga0436360_1225930
707 Ga0436361_0260442
708 Ga0436361_1061707
709 Ga0436363_1406109
710 Ga0436362_0004099
711 Ga0436362_0925906
712 Ga0451577_0124545
713 Ga0451577_0318312
714 Ga0451576_0045592
715 Ga0451576_0115895
716 Ga0495592_0059016
717 Ga0495651_0023112
718 Ga0495580_0089206
719 Ga0495662_0046476
720 Ga0495664_0114516
721 Ga0495618_0081036
722 Ga0495628_0024605
723 Ga0495628_0060865
724 Ga0495652_0029307
725 Ga0495652_0032132
726 Ga0495645_0092377
727 Ga0495635_0199929
728 Ga0495599_0139693
729 Ga0495669_0007990
730 Ga0495604_0066713
731 Ga0495636_0040142
732 Ga0495675_0073672
733 Ga0495602_0095840
734 Ga0496100_0323548
735 Ga0496102_0099017
736 Ga0496106_0181557
737 Ga0496109_0031980
738 Ga0496112_0002667
739 Ga0496112_0017966
740 Ga0496112_0048891
741 Ga0496113_0059208
742 Ga0496121_0002383
743 Ga0496125_0012269
744 Ga0496125_0058699
745 Ga0496126_0019707
746 Ga0496126_0308502
747 Ga0501035_0019483
748 Ga0501045_0199113
749 nmdc:mga05p37_148274_c1
750 nmdc:mga05p37_167764_c1
751 nmdc:mga05p37_197351_c1
752 nmdc:mga05p37_261730_c1
753 nmdc:mga05p37_48695_c1
754 nmdc:mga09592_119656_c1
755 nmdc:mga09592_337710_c1
756 nmdc:mga09592_34182_c1
757 nmdc:mga09592_365328_c1
758 nmdc:mga06r32_129996_c1
759 nmdc:mga06r32_131831_c1
760 nmdc:mga06r32_2138_c1
761 nmdc:mga06r32_30792_c1
762 nmdc:mga06r32_89093_c1
763 nmdc:mga08y16_171416_c1
764 nmdc:mga08y16_280280_c1
765 nmdc:mga08y16_46123_c1
766 nmdc:mga0n895_218805_c1
767 nmdc:mga0rr50_178510_c1
768 nmdc:mga08x19_135445_c1
769 nmdc:mga08x19_137961_c1
770 nmdc:mga08x19_14696_c1
771 nmdc:mga08x19_59454_c1
772 nmdc:mga0a205_186644_c1
773 nmdc:mga0a205_223351_c1
774 nmdc:mga0a205_23095_c1
775 nmdc:mga0a205_242559_c1
776 nmdc:mga0a205_63343_c1
777 nmdc:mga0a205_92405_c1
778 Ga0495595_0013628
779 Ga0495619_0199346
780 Ga0501084_0048753

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

45

381

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oey-assembly1.cif.gz_B neisseria gonnorhoeae variant e93q at 1.35 angstrom resolution 0.9574 3 332
7bbx-assembly1.cif.gz_A neisseria gonorrhoeae transaldolase, variant k8a 0.9562 3 332
7bbw-assembly2.cif.gz_B neisseria gonorrhoeae transaldolase, variant c38s 0.9555 4 332
7odq-assembly1.cif.gz_A neisseria gonorrhoeae transaldolase at 5.4 mgy dose 0.9393 3 332
7oey-assembly1.cif.gz_B neisseria gonnorhoeae variant e93q at 1.35 angstrom resolution 0.9115 3 332
ID Description Score Start End Superfamily
af_I1JM01_1_306_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9311 66 335 3.20.20.70
af_K7L4A2_15_219_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9284 48 226 3.20.20.70
3clmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9277 3 332 3.20.20.70
af_B4FRC9_66_421_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9125 6 335 3.20.20.70
3r5eA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8864 1 336 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V8K2I0-F1-model_v4 transaldolase (EC 2.2.1.2) 0.9945 1 158 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-T0ZI10-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.9928 81 187 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A2V7D8D8-F1-model_v4 transaldolase (EC 2.2.1.2) 0.9921 1 177 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A6G3XGD8-F1-model_v4 transaldolase (EC 2.2.1.2) 0.9913 92 171 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A2V7FUG8-F1-model_v4 transaldolase (EC 2.2.1.2) 0.9912 1 202 GO:0004801
GO:0005737
GO:0005975
GO:0006098

Map