F431625
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 390 | 191 | 387 | 437 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100019940|Ga0070683_1000199402 |
| Length | 462 |
| Sequence | MSSLHLKPATCNLQPAMKLWQKNIESLKEVEKFTVGNDREFDLQLAPFDVLGSIAHAKMLAEVGLLTKDEAQKLSRELKNIYTSIHDSRFTIDETVEDIHSQVEFLLTQKLGDVGKKIHSARSRNDQVLVDIKLFLRNEIEELVKKILPFFELLQSQSEKYKDDLLPGYTHLQLAMPSSFGLWFGAYAESLVDDIITLKAAYDVVNKNPLGSAAGYGSSFPISRTLTTKLLGFETLNYNVVYAQMGRGKSERIVAMALANVADTLSRLSMDACLFLNQNFDFISFPAELTTGSSIMPHKKNPDVFELIRSHGNRIKSLPNEIMLMTTNLPSGYHRDLQLLKEHLFPAFKTIKNCLEMAGLMLSNIEIKKNILADEKYKYLFTVDEVHKLVMQGIPFRDAYTIVGQKVEDGTFAPPPSEEITRGLHEGSVGNLSNEQIKKQMEKVIASFPFTAVHSAVSGLLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 2 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 3 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 94 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 138 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 139 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 140 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 141 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 142 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 143 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 144 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 145 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 146 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 153 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 154 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 155 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 156 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 157 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 158 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 159 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 160 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 170 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 186 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 188 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 189 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 190 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 191 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.23 |
| Metatranscriptomes | 0 |
| Isolates | 0.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.56 |
| Nodule | 0 |
| Rhizoplane | 0.77 |
| Rhizosphere | 93.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10046607 | 3300003320 | Bacteria | 9030 |
| 2 | rootH2_10216978 | 3300003320 | Bacteria | 3235 |
| 3 | JGI25160J50197_1000376 | 3300003354 | Bacteria | 29172 |
| 4 | Ga0065712_10090935 | 3300005290 | Bacteria | 2396 |
| 5 | Ga0065715_10127698 | 3300005293 | Bacteria | 2081 |
| 6 | Ga0065707_10117759 | 3300005295 | Bacteria | 2204 |
| 7 | Ga0070676_10005918 | 3300005328 | Bacteria | 6528 |
| 8 | Ga0070683_100002536 | 3300005329 | Bacteria | 14576 |
| 9 | Ga0070683_100010174 | 3300005329 | Bacteria | 8074 |
| 10 | Ga0070683_100019940 | 3300005329 | Bacteria | 5961 |
| 11 | Ga0070683_100076332 | 3300005329 | Bacteria | 3132 |
| 12 | Ga0070683_100120760 | 3300005329 | Bacteria | 2475 |
| 13 | Ga0070683_100172058 | 3300005329 | Bacteria | 2056 |
| 14 | Ga0070690_100018071 | 3300005330 | Bacteria | 4251 |
| 15 | Ga0070670_100015951 | 3300005331 | Bacteria | 6446 |
| 16 | Ga0070670_100071955 | 3300005331 | Bacteria | 2969 |
| 17 | Ga0070670_100076846 | 3300005331 | Bacteria | 2869 |
| 18 | Ga0070670_100165474 | 3300005331 | Bacteria | 1917 |
| 19 | Ga0068869_100000827 | 3300005334 | Bacteria | 17676 |
| 20 | Ga0068869_100007930 | 3300005334 | Bacteria | 6821 |
| 21 | Ga0068869_100079486 | 3300005334 | Bacteria | 2444 |
| 22 | Ga0068869_100152936 | 3300005334 | Bacteria | 1791 |
| 23 | Ga0070666_10000323 | 3300005335 | Bacteria | 30548 |
| 24 | Ga0070666_10021310 | 3300005335 | Bacteria | 4200 |
| 25 | Ga0070680_100141301 | 3300005336 | Bacteria | 2019 |
| 26 | Ga0070680_100148844 | 3300005336 | Bacteria | 1965 |
| 27 | Ga0070682_100000039 | 3300005337 | Bacteria | 144400 |
| 28 | Ga0070682_100066319 | 3300005337 | Bacteria | 2296 |
| 29 | Ga0068868_100003336 | 3300005338 | Bacteria | 11167 |
| 30 | Ga0068868_100007843 | 3300005338 | Bacteria | 7619 |
| 31 | Ga0068868_100017573 | 3300005338 | Bacteria | 5332 |
| 32 | Ga0068868_100136165 | 3300005338 | Bacteria | 2013 |
| 33 | Ga0070660_100002764 | 3300005339 | Bacteria | 12054 |
| 34 | Ga0070689_100050420 | 3300005340 | Bacteria | 3216 |
| 35 | Ga0070689_100121494 | 3300005340 | Bacteria | 2086 |
| 36 | Ga0070661_100002636 | 3300005344 | Bacteria | 12270 |
| 37 | Ga0070661_100135391 | 3300005344 | Bacteria | 1853 |
| 38 | Ga0070668_100004850 | 3300005347 | Bacteria | 9964 |
| 39 | Ga0070669_100022615 | 3300005353 | Bacteria | 4495 |
| 40 | Ga0070675_100010179 | 3300005354 | Bacteria | 7335 |
| 41 | Ga0070675_100032180 | 3300005354 | Bacteria | 4243 |
| 42 | Ga0070675_100058264 | 3300005354 | Bacteria | 3186 |
| 43 | Ga0070675_100287358 | 3300005354 | Unclassified | 1447 |
| 44 | Ga0070671_100005531 | 3300005355 | Bacteria | 10067 |
| 45 | Ga0070674_100009316 | 3300005356 | Bacteria | 5878 |
| 46 | Ga0070673_100017710 | 3300005364 | Bacteria | 5074 |
| 47 | Ga0070673_100052074 | 3300005364 | Bacteria | 3210 |
| 48 | Ga0070673_100141003 | 3300005364 | Unclassified | 2033 |
| 49 | Ga0070688_100039955 | 3300005365 | Bacteria | 2873 |
| 50 | Ga0070688_100053059 | 3300005365 | Bacteria | 2535 |
| 51 | Ga0070659_100027782 | 3300005366 | Bacteria | 4362 |
| 52 | Ga0070659_100074542 | 3300005366 | Bacteria | 2703 |
| 53 | Ga0070667_100025990 | 3300005367 | Bacteria | 4870 |
| 54 | Ga0070678_100002885 | 3300005456 | Bacteria | 9515 |
| 55 | Ga0070678_100021447 | 3300005456 | Bacteria | 4260 |
| 56 | Ga0070662_100010552 | 3300005457 | Bacteria | 6069 |
| 57 | Ga0070662_100072138 | 3300005457 | Unclassified | 2548 |
| 58 | Ga0070662_100095207 | 3300005457 | Bacteria | 2244 |
| 59 | Ga0070662_100159779 | 3300005457 | Bacteria | 1762 |
| 60 | Ga0070681_10104078 | 3300005458 | Bacteria | 2781 |
| 61 | Ga0070685_10083650 | 3300005466 | Unclassified | 1917 |
| 62 | Ga0070685_10093187 | 3300005466 | Bacteria | 1826 |
| 63 | Ga0070698_100002644 | 3300005471 | Bacteria | 19745 |
| 64 | Ga0070698_100008254 | 3300005471 | Bacteria | 11260 |
| 65 | Ga0070699_100157147 | 3300005518 | Bacteria | 2012 |
| 66 | Ga0070679_100018050 | 3300005530 | Bacteria | 6838 |
| 67 | Ga0070679_100136887 | 3300005530 | Bacteria | 2430 |
| 68 | Ga0070679_100268792 | 3300005530 | Bacteria | 1659 |
| 69 | Ga0070684_100000097 | 3300005535 | Bacteria | 56477 |
| 70 | Ga0070684_100004583 | 3300005535 | Bacteria | 10540 |
| 71 | Ga0070684_100138458 | 3300005535 | Bacteria | 2200 |
| 72 | Ga0070697_100195137 | 3300005536 | Bacteria | 1719 |
| 73 | Ga0068853_100010492 | 3300005539 | Bacteria | 7492 |
| 74 | Ga0068853_100013848 | 3300005539 | Bacteria | 6592 |
| 75 | Ga0068853_100051958 | 3300005539 | Bacteria | 3529 |
| 76 | Ga0068853_100067510 | 3300005539 | Bacteria | 3107 |
| 77 | Ga0070672_100002698 | 3300005543 | Bacteria | 11352 |
| 78 | Ga0070672_100013153 | 3300005543 | Bacteria | 5835 |
| 79 | Ga0070672_100049912 | 3300005543 | Bacteria | 3257 |
| 80 | Ga0070672_100144054 | 3300005543 | Bacteria | 1968 |
| 81 | Ga0070686_100054956 | 3300005544 | Bacteria | 2549 |
| 82 | Ga0070693_100131926 | 3300005547 | Bacteria | 1563 |
| 83 | Ga0070665_100010164 | 3300005548 | Bacteria | 9518 |
| 84 | Ga0068855_100008654 | 3300005563 | Bacteria | 12297 |
| 85 | Ga0068855_100339577 | 3300005563 | Bacteria | 1656 |
| 86 | Ga0070664_100002153 | 3300005564 | Bacteria | 15793 |
| 87 | Ga0070664_100025602 | 3300005564 | Bacteria | 4892 |
| 88 | Ga0070664_100109106 | 3300005564 | Bacteria | 2414 |
| 89 | Ga0070664_100147385 | 3300005564 | Bacteria | 2076 |
| 90 | Ga0068857_100001948 | 3300005577 | Bacteria | 16668 |
| 91 | Ga0068857_100025391 | 3300005577 | Bacteria | 5217 |
| 92 | Ga0068854_100011495 | 3300005578 | Bacteria | 5766 |
| 93 | Ga0068854_100085413 | 3300005578 | Bacteria | 2337 |
| 94 | Ga0068854_100086010 | 3300005578 | Bacteria | 2330 |
| 95 | Ga0068856_100013119 | 3300005614 | Bacteria | 8028 |
| 96 | Ga0068852_100007001 | 3300005616 | Bacteria | 8208 |
| 97 | Ga0068852_100315376 | 3300005616 | Bacteria | 1517 |
| 98 | Ga0068859_100000106 | 3300005617 | Bacteria | 78128 |
| 99 | Ga0068859_100007461 | 3300005617 | Bacteria | 11100 |
| 100 | Ga0068859_100013598 | 3300005617 | Bacteria | 8160 |
| 101 | Ga0068859_100017266 | 3300005617 | Bacteria | 7246 |
| 102 | Ga0068859_100072344 | 3300005617 | Bacteria | 3485 |
| 103 | Ga0068859_100188649 | 3300005617 | Bacteria | 2145 |
| 104 | Ga0068859_100394044 | 3300005617 | Bacteria | 1480 |
| 105 | Ga0068859_100441080 | 3300005617 | Bacteria | 1398 |
| 106 | Ga0068864_100021891 | 3300005618 | Bacteria | 5359 |
| 107 | Ga0068864_100023396 | 3300005618 | Bacteria | 5188 |
| 108 | Ga0068864_100047498 | 3300005618 | Bacteria | 3687 |
| 109 | Ga0068864_100125955 | 3300005618 | Bacteria | 2296 |
| 110 | Ga0068866_10005336 | 3300005718 | Bacteria | 5299 |
| 111 | Ga0068866_10011364 | 3300005718 | Bacteria | 3849 |
| 112 | Ga0068861_100204696 | 3300005719 | Bacteria | 1659 |
| 113 | Ga0068851_10042676 | 3300005834 | Bacteria | 2284 |
| 114 | Ga0068870_10037347 | 3300005840 | Bacteria | 2504 |
| 115 | Ga0068863_100008926 | 3300005841 | Bacteria | 9789 |
| 116 | Ga0068863_100015218 | 3300005841 | Bacteria | 7392 |
| 117 | Ga0068863_100044635 | 3300005841 | Bacteria | 4206 |
| 118 | Ga0068863_100082768 | 3300005841 | Unclassified | 3041 |
| 119 | Ga0068858_100006822 | 3300005842 | Bacteria | 11107 |
| 120 | Ga0068860_100004286 | 3300005843 | Bacteria | 14580 |
| 121 | Ga0068860_100005770 | 3300005843 | Bacteria | 12479 |
| 122 | Ga0068860_100027668 | 3300005843 | Bacteria | 5459 |
| 123 | Ga0068860_100072596 | 3300005843 | Unclassified | 3271 |
| 124 | Ga0068862_100009607 | 3300005844 | Bacteria | 7994 |
| 125 | Ga0068862_100010565 | 3300005844 | Bacteria | 7630 |
| 126 | Ga0068862_100054443 | 3300005844 | Bacteria | 3426 |
| 127 | Ga0068862_100075095 | 3300005844 | Bacteria | 2923 |
| 128 | Ga0068862_100093907 | 3300005844 | Bacteria | 2616 |
| 129 | Ga0081539_10001169 | 3300005985 | Bacteria | 47510 |
| 130 | Ga0075366_10066842 | 3300006195 | Bacteria | 2139 |
| 131 | Ga0075366_10095718 | 3300006195 | Bacteria | 1780 |
| 132 | Ga0068871_100021314 | 3300006358 | Bacteria | 4980 |
| 133 | Ga0068871_100038096 | 3300006358 | Bacteria | 3837 |
| 134 | Ga0068871_100044561 | 3300006358 | Bacteria | 3568 |
| 135 | Ga0068871_100046702 | 3300006358 | Bacteria | 3489 |
| 136 | Ga0068871_100047840 | 3300006358 | Bacteria | 3450 |
| 137 | Ga0075428_100004442 | 3300006844 | Bacteria | 15481 |
| 138 | Ga0075428_100162076 | 3300006844 | Bacteria | 2427 |
| 139 | Ga0075431_100011013 | 3300006847 | Bacteria | 9103 |
| 140 | Ga0075429_100004992 | 3300006880 | Bacteria | 11424 |
| 141 | Ga0068865_100185382 | 3300006881 | Bacteria | 1605 |
| 142 | Ga0097620_100000106 | 3300006931 | Bacteria | 78128 |
| 143 | Ga0097620_100007461 | 3300006931 | Bacteria | 11100 |
| 144 | Ga0097620_100013598 | 3300006931 | Bacteria | 8160 |
| 145 | Ga0097620_100017266 | 3300006931 | Bacteria | 7246 |
| 146 | Ga0097620_100072341 | 3300006931 | Bacteria | 3485 |
| 147 | Ga0097620_100188669 | 3300006931 | Bacteria | 2145 |
| 148 | Ga0097620_100394053 | 3300006931 | Bacteria | 1480 |
| 149 | Ga0097620_100441050 | 3300006931 | Bacteria | 1398 |
| 150 | Ga0105240_10019288 | 3300009093 | Bacteria | 9115 |
| 151 | Ga0111539_10376871 | 3300009094 | Bacteria | 1652 |
| 152 | Ga0105247_10000918 | 3300009101 | Bacteria | 22128 |
| 153 | Ga0105247_10006091 | 3300009101 | Bacteria | 7498 |
| 154 | Ga0114129_10268537 | 3300009147 | Bacteria | 2283 |
| 155 | Ga0105241_10001462 | 3300009174 | Bacteria | 18113 |
| 156 | Ga0105242_10005938 | 3300009176 | Bacteria | 9420 |
| 157 | Ga0105242_10008165 | 3300009176 | Bacteria | 8050 |
| 158 | Ga0105237_10002321 | 3300009545 | Bacteria | 23628 |
| 159 | Ga0105237_10003093 | 3300009545 | Bacteria | 20049 |
| 160 | Ga0105237_10019088 | 3300009545 | Bacteria | 7087 |
| 161 | Ga0105249_10002137 | 3300009553 | Bacteria | 17128 |
| 162 | Ga0105249_10003042 | 3300009553 | Bacteria | 14469 |
| 163 | Ga0105249_10006302 | 3300009553 | Bacteria | 10308 |
| 164 | Ga0105249_10042119 | 3300009553 | Bacteria | 4152 |
| 165 | Ga0105239_10257595 | 3300010375 | Bacteria | 1960 |
| 166 | Ga0105239_10337804 | 3300010375 | Bacteria | 1699 |
| 167 | Ga0105239_10357709 | 3300010375 | Unclassified | 1648 |
| 168 | Ga0105246_10139552 | 3300011119 | Bacteria | 1821 |
| 169 | Ga0157373_10004894 | 3300013100 | Bacteria | 10082 |
| 170 | Ga0157373_10132335 | 3300013100 | Bacteria | 1754 |
| 171 | Ga0157371_10000232 | 3300013102 | Bacteria | 79717 |
| 172 | Ga0157371_10000741 | 3300013102 | Bacteria | 38124 |
| 173 | Ga0157371_10001331 | 3300013102 | Bacteria | 25968 |
| 174 | Ga0157371_10028986 | 3300013102 | Bacteria | 4008 |
| 175 | Ga0157371_10101752 | 3300013102 | Bacteria | 2038 |
| 176 | Ga0157370_10000242 | 3300013104 | Bacteria | 69678 |
| 177 | Ga0157370_10007303 | 3300013104 | Bacteria | 12057 |
| 178 | Ga0157369_10026498 | 3300013105 | Bacteria | 6429 |
| 179 | Ga0157369_10111129 | 3300013105 | Bacteria | 2913 |
| 180 | Ga0157369_10377583 | 3300013105 | Bacteria | 1471 |
| 181 | Ga0157374_10003727 | 3300013296 | Bacteria | 12805 |
| 182 | Ga0157374_10008894 | 3300013296 | Bacteria | 8601 |
| 183 | Ga0157374_10009845 | 3300013296 | Bacteria | 8203 |
| 184 | Ga0157374_10024479 | 3300013296 | Bacteria | 5414 |
| 185 | Ga0157374_10091145 | 3300013296 | Unclassified | 2906 |
| 186 | Ga0157374_10097937 | 3300013296 | Bacteria | 2807 |
| 187 | Ga0157374_10199219 | 3300013296 | Bacteria | 1960 |
| 188 | Ga0157378_10004824 | 3300013297 | Bacteria | 11816 |
| 189 | Ga0157378_10007368 | 3300013297 | Bacteria | 9613 |
| 190 | Ga0157378_10012137 | 3300013297 | Bacteria | 7544 |
| 191 | Ga0157378_10029970 | 3300013297 | Bacteria | 4804 |
| 192 | Ga0157378_10123277 | 3300013297 | Bacteria | 2391 |
| 193 | Ga0163162_10011449 | 3300013306 | Bacteria | 8650 |
| 194 | Ga0163162_10090199 | 3300013306 | Bacteria | 3146 |
| 195 | Ga0163162_10114349 | 3300013306 | Bacteria | 2798 |
| 196 | Ga0163162_10168785 | 3300013306 | Bacteria | 2312 |
| 197 | Ga0157372_10049053 | 3300013307 | Bacteria | 4694 |
| 198 | Ga0157372_10368672 | 3300013307 | Bacteria | 1673 |
| 199 | Ga0157375_10022829 | 3300013308 | Bacteria | 5763 |
| 200 | Ga0157375_10029302 | 3300013308 | Bacteria | 5175 |
| 201 | Ga0157375_10032468 | 3300013308 | Bacteria | 4952 |
| 202 | Ga0157375_10037235 | 3300013308 | Bacteria | 4659 |
| 203 | Ga0157375_10259438 | 3300013308 | Bacteria | 1899 |
| 204 | Ga0163163_10000088 | 3300014325 | Bacteria | 101126 |
| 205 | Ga0163163_10184986 | 3300014325 | Bacteria | 2131 |
| 206 | Ga0157380_10000796 | 3300014326 | Bacteria | 19825 |
| 207 | Ga0157380_10187723 | 3300014326 | Bacteria | 1822 |
| 208 | Ga0157377_10050276 | 3300014745 | Bacteria | 2347 |
| 209 | Ga0157379_10012914 | 3300014968 | Bacteria | 7306 |
| 210 | Ga0157379_10268299 | 3300014968 | Bacteria | 1552 |
| 211 | Ga0157376_10017122 | 3300014969 | Bacteria | 5521 |
| 212 | Ga0163161_10016307 | 3300017792 | Bacteria | 5186 |
| 213 | Ga0163161_10078942 | 3300017792 | Bacteria | 2420 |
| 214 | Ga0163161_10171362 | 3300017792 | Bacteria | 1660 |
| 215 | Ga0213876_10001773 | 3300021384 | Bacteria | 13075 |
| 216 | Ga0207426_1000026 | 3300025302 | Bacteria | 515228 |
| 217 | Ga0207697_10033506 | 3300025315 | Bacteria | 2102 |
| 218 | Ga0207656_10030515 | 3300025321 | Bacteria | 2228 |
| 219 | Ga0207656_10032152 | 3300025321 | Bacteria | 2178 |
| 220 | Ga0207642_10007453 | 3300025899 | Bacteria | 3699 |
| 221 | Ga0207710_10006684 | 3300025900 | Bacteria | 4913 |
| 222 | Ga0207710_10031166 | 3300025900 | Bacteria | 2330 |
| 223 | Ga0207680_10000958 | 3300025903 | Bacteria | 13597 |
| 224 | Ga0207647_10018132 | 3300025904 | Bacteria | 4771 |
| 225 | Ga0207647_10031308 | 3300025904 | Bacteria | 3423 |
| 226 | Ga0207645_10002278 | 3300025907 | Bacteria | 15224 |
| 227 | Ga0207645_10020715 | 3300025907 | Bacteria | 4300 |
| 228 | Ga0207645_10149973 | 3300025907 | Bacteria | 1522 |
| 229 | Ga0207643_10003128 | 3300025908 | Bacteria | 8906 |
| 230 | Ga0207643_10027820 | 3300025908 | Bacteria | 3137 |
| 231 | Ga0207707_10116130 | 3300025912 | Bacteria | 2339 |
| 232 | Ga0207671_10007498 | 3300025914 | Bacteria | 9463 |
| 233 | Ga0207660_10030214 | 3300025917 | Bacteria | 3723 |
| 234 | Ga0207657_10001653 | 3300025919 | Bacteria | 24053 |
| 235 | Ga0207649_10004075 | 3300025920 | Bacteria | 7952 |
| 236 | Ga0207649_10124094 | 3300025920 | Bacteria | 1745 |
| 237 | Ga0207652_10000029 | 3300025921 | Bacteria | 149054 |
| 238 | Ga0207652_10000115 | 3300025921 | Bacteria | 87927 |
| 239 | Ga0207652_10304572 | 3300025921 | Bacteria | 1438 |
| 240 | Ga0207650_10199863 | 3300025925 | Bacteria | 1601 |
| 241 | Ga0207650_10253989 | 3300025925 | Bacteria | 1424 |
| 242 | Ga0207690_10032510 | 3300025932 | Bacteria | 3348 |
| 243 | Ga0207706_10007006 | 3300025933 | Bacteria | 10420 |
| 244 | Ga0207706_10011137 | 3300025933 | Bacteria | 8196 |
| 245 | Ga0207706_10024985 | 3300025933 | Bacteria | 5356 |
| 246 | Ga0207706_10026625 | 3300025933 | Bacteria | 5175 |
| 247 | Ga0207706_10093681 | 3300025933 | Bacteria | 2641 |
| 248 | Ga0207706_10102844 | 3300025933 | Bacteria | 2513 |
| 249 | Ga0207706_10237140 | 3300025933 | Bacteria | 1595 |
| 250 | Ga0207686_10002663 | 3300025934 | Bacteria | 9686 |
| 251 | Ga0207686_10180315 | 3300025934 | Unclassified | 1497 |
| 252 | Ga0207704_10133735 | 3300025938 | Bacteria | 1722 |
| 253 | Ga0207691_10005078 | 3300025940 | Bacteria | 12705 |
| 254 | Ga0207691_10048807 | 3300025940 | Bacteria | 3879 |
| 255 | Ga0207691_10077859 | 3300025940 | Bacteria | 2986 |
| 256 | Ga0207689_10000360 | 3300025942 | Bacteria | 42854 |
| 257 | Ga0207689_10001010 | 3300025942 | Bacteria | 27038 |
| 258 | Ga0207689_10180421 | 3300025942 | Bacteria | 1741 |
| 259 | Ga0207661_10002590 | 3300025944 | Bacteria | 12431 |
| 260 | Ga0207679_10258024 | 3300025945 | Unclassified | 1485 |
| 261 | Ga0207679_10264564 | 3300025945 | Bacteria | 1468 |
| 262 | Ga0207667_10011285 | 3300025949 | Bacteria | 10390 |
| 263 | Ga0207667_10028760 | 3300025949 | Bacteria | 6034 |
| 264 | Ga0207651_10012195 | 3300025960 | Bacteria | 4851 |
| 265 | Ga0207651_10024667 | 3300025960 | Bacteria | 3724 |
| 266 | Ga0207651_10166919 | 3300025960 | Bacteria | 1732 |
| 267 | Ga0207651_10192843 | 3300025960 | Bacteria | 1627 |
| 268 | Ga0207712_10001164 | 3300025961 | Bacteria | 18264 |
| 269 | Ga0207712_10011368 | 3300025961 | Bacteria | 5672 |
| 270 | Ga0207712_10021922 | 3300025961 | Bacteria | 4199 |
| 271 | Ga0207712_10038507 | 3300025961 | Bacteria | 3270 |
| 272 | Ga0207668_10115548 | 3300025972 | Bacteria | 2022 |
| 273 | Ga0207668_10180729 | 3300025972 | Bacteria | 1663 |
| 274 | Ga0207658_10158847 | 3300025986 | Bacteria | 1851 |
| 275 | Ga0207677_10044038 | 3300026023 | Bacteria | 2970 |
| 276 | Ga0207703_10001922 | 3300026035 | Bacteria | 18410 |
| 277 | Ga0207639_10008635 | 3300026041 | Bacteria | 6992 |
| 278 | Ga0207639_10014729 | 3300026041 | Bacteria | 5509 |
| 279 | Ga0207639_10028699 | 3300026041 | Bacteria | 4065 |
| 280 | Ga0207678_10056356 | 3300026067 | Bacteria | 3383 |
| 281 | Ga0207708_10116732 | 3300026075 | Bacteria | 2076 |
| 282 | Ga0207641_10000082 | 3300026088 | Bacteria | 138385 |
| 283 | Ga0207641_10003172 | 3300026088 | Bacteria | 14709 |
| 284 | Ga0207641_10018346 | 3300026088 | Bacteria | 5736 |
| 285 | Ga0207641_10019559 | 3300026088 | Bacteria | 5559 |
| 286 | Ga0207641_10096906 | 3300026088 | Bacteria | 2591 |
| 287 | Ga0207641_10129905 | 3300026088 | Bacteria | 2261 |
| 288 | Ga0207648_10001709 | 3300026089 | Bacteria | 24030 |
| 289 | Ga0207648_10172377 | 3300026089 | Bacteria | 1913 |
| 290 | Ga0207676_10029977 | 3300026095 | Bacteria | 4078 |
| 291 | Ga0207676_10061484 | 3300026095 | Bacteria | 2974 |
| 292 | Ga0207674_10005014 | 3300026116 | Bacteria | 15819 |
| 293 | Ga0207674_10019675 | 3300026116 | Bacteria | 7311 |
| 294 | Ga0207674_10065358 | 3300026116 | Bacteria | 3666 |
| 295 | Ga0207674_10152656 | 3300026116 | Bacteria | 2266 |
| 296 | Ga0207675_100001037 | 3300026118 | Bacteria | 27537 |
| 297 | Ga0207675_100089254 | 3300026118 | Bacteria | 2896 |
| 298 | Ga0207683_10000974 | 3300026121 | Bacteria | 26229 |
| 299 | Ga0207683_10011575 | 3300026121 | Bacteria | 7532 |
| 300 | Ga0207683_10210993 | 3300026121 | Bacteria | 1767 |
| 301 | Ga0207698_10008386 | 3300026142 | Bacteria | 6533 |
| 302 | Ga0207698_10078465 | 3300026142 | Bacteria | 2652 |
| 303 | Ga0268265_10018798 | 3300028380 | Bacteria | 4794 |
| 304 | Ga0268265_10080130 | 3300028380 | Bacteria | 2574 |
| 305 | Ga0268265_10145638 | 3300028380 | Bacteria | 1990 |
| 306 | Ga0268264_10007283 | 3300028381 | Bacteria | 9258 |
| 307 | Ga0268264_10013367 | 3300028381 | Bacteria | 6755 |
| 308 | Ga0268264_10022683 | 3300028381 | Bacteria | 5123 |
| 309 | Ga0268264_10028427 | 3300028381 | Bacteria | 4574 |
| 310 | Ga0268264_10068669 | 3300028381 | Bacteria | 2996 |
| 311 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 312 | Ga0307515_10000190 | 3300028794 | Bacteria | 150300 |
| 313 | Ga0265327_10000248 | 3300031251 | Bacteria | 107284 |
| 314 | Ga0265327_10000452 | 3300031251 | Bacteria | 73846 |
| 315 | Ga0265327_10006450 | 3300031251 | Bacteria | 9375 |
| 316 | Ga0265327_10029993 | 3300031251 | Bacteria | 3083 |
| 317 | Ga0307513_10059661 | 3300031456 | Bacteria | 4049 |
| 318 | Ga0307509_10043396 | 3300031507 | Bacteria | 4866 |
| 319 | Ga0307509_10117642 | 3300031507 | Bacteria | 2644 |
| 320 | Ga0307408_100110922 | 3300031548 | Unclassified | 2107 |
| 321 | Ga0307508_10004493 | 3300031616 | Bacteria | 13606 |
| 322 | Ga0307407_10052665 | 3300031903 | Unclassified | 2339 |
| 323 | Ga0307415_100012985 | 3300032126 | Bacteria | 4843 |
| 324 | Ga0373947_0026193 | 3300035725 | Bacteria | 3406 |
| 325 | Ga0373937_0009340 | 3300036401 | Bacteria | 8516 |
| 326 | Ga0395899_0017114 | 3300037312 | Bacteria | 5523 |
| 327 | Ga0395899_0064301 | 3300037312 | Bacteria | 2697 |
| 328 | Ga0395899_0107715 | 3300037312 | Bacteria | 2005 |
| 329 | Ga0395900_0002285 | 3300037418 | Bacteria | 21289 |
| 330 | Ga0395900_0052792 | 3300037418 | Bacteria | 4184 |
| 331 | Ga0395900_0241095 | 3300037418 | Bacteria | 1813 |
| 332 | Ga0395898_0004777 | 3300037466 | Bacteria | 14740 |
| 333 | Ga0395898_0040525 | 3300037466 | Bacteria | 4605 |
| 334 | Ga0395898_0046113 | 3300037466 | Bacteria | 4281 |
| 335 | Ga0395905_0114102 | 3300037471 | Bacteria | 2539 |
| 336 | Ga0395901_0002351 | 3300038443 | Bacteria | 19230 |
| 337 | Ga0395901_0063792 | 3300038443 | Bacteria | 3835 |
| 338 | Ga0395901_0216050 | 3300038443 | Bacteria | 2005 |
| 339 | Ga0436365_0079092 | 3300039437 | Bacteria | 37171 |
| 340 | Ga0436365_0575116 | 3300039437 | Bacteria | 12036 |
| 341 | Ga0439439_0020111 | 3300041406 | Bacteria | 1659 |
| 342 | Ga0439461_0012881 | 3300041410 | Bacteria | 1571 |
| 343 | Ga0439449_0037956 | 3300042007 | Bacteria | 1792 |
| 344 | Ga0450894_001519 | 3300042131 | Bacteria | 3301 |
| 345 | Ga0451577_0003822 | 3300042876 | Bacteria | 16392 |
| 346 | Ga0466972_0000001 | 3300044658 | Bacteria | 412457 |
| 347 | Ga0466970_0004272 | 3300044765 | Bacteria | 7034 |
| 348 | Ga0495653_0015741 | 3300046463 | Bacteria | 6166 |
| 349 | Ga0495618_0094667 | 3300046514 | Bacteria | 1910 |
| 350 | Ga0495628_0051288 | 3300046516 | Bacteria | 3262 |
| 351 | Ga0495630_0054590 | 3300046517 | Bacteria | 2993 |
| 352 | Ga0495587_0068745 | 3300046536 | Bacteria | 2063 |
| 353 | Ga0495668_0000257 | 3300046616 | Bacteria | 75166 |
| 354 | Ga0495634_0052833 | 3300046642 | Bacteria | 2723 |
| 355 | Ga0495657_0064243 | 3300046675 | Bacteria | 2419 |
| 356 | Ga0496108_0099847 | 3300048911 | Bacteria | 2475 |
| 357 | Ga0496110_0029754 | 3300048913 | Bacteria | 4704 |
| 358 | Ga0496110_0053529 | 3300048913 | Bacteria | 3549 |
| 359 | Ga0501032_0006571 | 3300049569 | Bacteria | 8539 |
| 360 | Ga0501032_0034121 | 3300049569 | Bacteria | 3484 |
| 361 | Ga0501033_0058342 | 3300049570 | Bacteria | 2851 |
| 362 | Ga0501034_0012481 | 3300049571 | Bacteria | 8775 |
| 363 | Ga0501034_0015240 | 3300049571 | Bacteria | 7900 |
| 364 | Ga0501034_0069327 | 3300049571 | Bacteria | 3537 |
| 365 | Ga0501036_0044598 | 3300049572 | Bacteria | 3756 |
| 366 | Ga0501036_0044824 | 3300049572 | Bacteria | 3747 |
| 367 | Ga0501037_0043532 | 3300049573 | Bacteria | 3299 |
| 368 | Ga0501038_0014165 | 3300049574 | Bacteria | 7265 |
| 369 | Ga0501038_0027154 | 3300049574 | Bacteria | 5095 |
| 370 | Ga0501043_0129450 | 3300049579 | Bacteria | 1978 |
| 371 | Ga0501047_0042863 | 3300049581 | Bacteria | 4372 |
| 372 | Ga0501047_0075412 | 3300049581 | Bacteria | 3245 |
| 373 | Ga0501069_0089211 | 3300049585 | Bacteria | 1743 |
| 374 | Ga0501072_0038926 | 3300049588 | Bacteria | 3733 |
| 375 | Ga0501073_0018558 | 3300049589 | Bacteria | 5028 |
| 376 | Ga0501074_0023054 | 3300049590 | Bacteria | 4527 |
| 377 | Ga0501080_0235473 | 3300049742 | Bacteria | 1673 |
| 378 | Ga0501035_0006054 | 3300049822 | Bacteria | 11393 |
| 379 | Ga0501035_0065626 | 3300049822 | Bacteria | 3223 |
| 380 | Ga0501044_0172224 | 3300049823 | Bacteria | 2135 |
| 381 | nmdc:mga0k408_2685_c1 | 3300050493 | Bacteria | 6636 |
| 382 | nmdc:mga09592_9012_c1 | 3300050508 | Bacteria | 8112 |
| 383 | Ga0500562_000053 | 3300053108 | Bacteria | 58984 |
| 384 | Ga0500568_0000274 | 3300053139 | Bacteria | 43327 |
| 385 | Ga0500616_0006236 | 3300053153 | Bacteria | 7865 |
| 386 | Ga0500622_0003854 | 3300053156 | Bacteria | 9746 |
| 387 | Ga0500611_000004 | 3300053727 | Bacteria | 253326 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025315 | Ga0207697_10033506 | Ga0207697_100335062 | 372 |
| 2 | 3300048913 | Ga0496110_0029754 | Ga0496110_0029754_3458_4672 | 376 |
| 3 | 3300041406 | Ga0439439_0020111 | Ga0439439_0020111_427_1632 | 389 |
| 4 | 3300013297 | Ga0157378_10007368 | Ga0157378_1000736811 | 394 |
| 5 | 3300005564 | Ga0070664_100109106 | Ga0070664_1001091062 | 398 |
| 6 | 3300026121 | Ga0207683_10011575 | Ga0207683_100115752 | 398 |
| 7 | 3300013306 | Ga0163162_10114349 | Ga0163162_101143493 | 401 |
| 8 | 3300009093 | Ga0105240_10019288 | Ga0105240_100192884 | 404 |
| 9 | 3300046514 | Ga0495618_0094667 | Ga0495618_0094667_10_1296 | 404 |
| 10 | 3300049742 | Ga0501080_0235473 | Ga0501080_0235473_302_1555 | 404 |
| 11 | 3300005840 | Ga0068870_10037347 | Ga0068870_100373471 | 407 |
| 12 | 3300005330 | Ga0070690_100018071 | Ga0070690_1000180714 | 411 |
| 13 | 3300005331 | Ga0070670_100076846 | Ga0070670_1000768462 | 411 |
| 14 | 3300005338 | Ga0068868_100136165 | Ga0068868_1001361652 | 411 |
| 15 | 3300005456 | Ga0070678_100021447 | Ga0070678_1000214474 | 411 |
| 16 | 3300005457 | Ga0070662_100072138 | Ga0070662_1000721382 | 411 |
| 17 | 3300005544 | Ga0070686_100054956 | Ga0070686_1000549562 | 411 |
| 18 | 3300005547 | Ga0070693_100131926 | Ga0070693_1001319261 | 411 |
| 19 | 3300005578 | Ga0068854_100086010 | Ga0068854_1000860101 | 411 |
| 20 | 3300013296 | Ga0157374_10008894 | Ga0157374_100088944 | 411 |
| 21 | 3300013308 | Ga0157375_10022829 | Ga0157375_100228295 | 411 |
| 22 | 3300014325 | Ga0163163_10184986 | Ga0163163_101849862 | 411 |
| 23 | 3300017792 | Ga0163161_10016307 | Ga0163161_100163073 | 411 |
| 24 | 3300025925 | Ga0207650_10199863 | Ga0207650_101998632 | 411 |
| 25 | 3300025933 | Ga0207706_10011137 | Ga0207706_100111372 | 411 |
| 26 | 3300025934 | Ga0207686_10180315 | Ga0207686_101803151 | 411 |
| 27 | 3300025960 | Ga0207651_10192843 | Ga0207651_101928431 | 411 |
| 28 | 3300005366 | Ga0070659_100074542 | Ga0070659_1000745422 | 413 |
| 29 | 3300025932 | Ga0207690_10032510 | Ga0207690_100325102 | 413 |
| 30 | 3300049571 | Ga0501034_0069327 | Ga0501034_0069327_2230_3507 | 413 |
| 31 | 3300049823 | Ga0501044_0172224 | Ga0501044_0172224_20_1297 | 413 |
| 32 | 3300013296 | Ga0157374_10097937 | Ga0157374_100979372 | 414 |
| 33 | 3300005329 | Ga0070683_100120760 | Ga0070683_1001207602 | 416 |
| 34 | 3300005337 | Ga0070682_100066319 | Ga0070682_1000663192 | 416 |
| 35 | 3300005338 | Ga0068868_100017573 | Ga0068868_1000175736 | 416 |
| 36 | 3300005339 | Ga0070660_100002764 | Ga0070660_10000276413 | 416 |
| 37 | 3300005344 | Ga0070661_100135391 | Ga0070661_1001353912 | 416 |
| 38 | 3300005354 | Ga0070675_100058264 | Ga0070675_1000582644 | 416 |
| 39 | 3300005366 | Ga0070659_100027782 | Ga0070659_1000277826 | 416 |
| 40 | 3300005457 | Ga0070662_100010552 | Ga0070662_1000105522 | 416 |
| 41 | 3300005530 | Ga0070679_100136887 | Ga0070679_1001368872 | 416 |
| 42 | 3300006358 | Ga0068871_100038096 | Ga0068871_1000380965 | 416 |
| 43 | 3300013100 | Ga0157373_10132335 | Ga0157373_101323351 | 416 |
| 44 | 3300013105 | Ga0157369_10111129 | Ga0157369_101111292 | 416 |
| 45 | 3300013297 | Ga0157378_10012137 | Ga0157378_100121375 | 416 |
| 46 | 3300025919 | Ga0207657_10001653 | Ga0207657_1000165317 | 416 |
| 47 | 3300025920 | Ga0207649_10124094 | Ga0207649_101240942 | 416 |
| 48 | 3300025933 | Ga0207706_10024985 | Ga0207706_100249852 | 416 |
| 49 | 3300003320 | rootH2_10216978 | rootH2_102169783 | 417 |
| 50 | 3300017792 | Ga0163161_10171362 | Ga0163161_101713621 | 417 |
| 51 | 3300026118 | Ga0207675_100089254 | Ga0207675_1000892542 | 417 |
| 52 | 3300005985 | Ga0081539_10001169 | Ga0081539_1000116951 | 418 |
| 53 | 3300014968 | Ga0157379_10268299 | Ga0157379_102682991 | 418 |
| 54 | 3300025933 | Ga0207706_10237140 | Ga0207706_102371401 | 418 |
| 55 | 3300042007 | Ga0439449_0037956 | Ga0439449_0037956_481_1773 | 418 |
| 56 | 3300005334 | Ga0068869_100079486 | Ga0068869_1000794862 | 419 |
| 57 | 3300005577 | Ga0068857_100025391 | Ga0068857_1000253912 | 420 |
| 58 | 3300026095 | Ga0207676_10061484 | Ga0207676_100614842 | 420 |
| 59 | 3300026116 | Ga0207674_10019675 | Ga0207674_100196752 | 420 |
| 60 | 3300031251 | Ga0265327_10006450 | Ga0265327_100064502 | 420 |
| 61 | 3300005844 | Ga0068862_100093907 | Ga0068862_1000939071 | 421 |
| 62 | 3300013105 | Ga0157369_10026498 | Ga0157369_100264987 | 421 |
| 63 | 3300021384 | Ga0213876_10001773 | Ga0213876_100017734 | 421 |
| 64 | 3300025961 | Ga0207712_10011368 | Ga0207712_100113684 | 421 |
| 65 | 3300026095 | Ga0207676_10029977 | Ga0207676_100299772 | 421 |
| 66 | 3300028380 | Ga0268265_10080130 | Ga0268265_100801301 | 421 |
| 67 | 3300039437 | Ga0436365_0079092 | Ga0436365_0079092_22668_24005 | 421 |
| 68 | 3300035725 | Ga0373947_0026193 | Ga0373947_0026193_970_2310 | 422 |
| 69 | 3300036401 | Ga0373937_0009340 | Ga0373937_0009340_5288_6628 | 422 |
| 70 | 3300046463 | Ga0495653_0015741 | Ga0495653_0015741_3935_5275 | 422 |
| 71 | 3300046516 | Ga0495628_0051288 | Ga0495628_0051288_1733_3073 | 422 |
| 72 | 3300046517 | Ga0495630_0054590 | Ga0495630_0054590_1411_2751 | 422 |
| 73 | 3300046536 | Ga0495587_0068745 | Ga0495587_0068745_386_1726 | 422 |
| 74 | 3300046642 | Ga0495634_0052833 | Ga0495634_0052833_1127_2467 | 422 |
| 75 | 3300046675 | Ga0495657_0064243 | Ga0495657_0064243_264_1604 | 422 |
| 76 | 3300005329 | Ga0070683_100002536 | Ga0070683_1000025362 | 424 |
| 77 | 3300005344 | Ga0070661_100002636 | Ga0070661_1000026369 | 424 |
| 78 | 3300005535 | Ga0070684_100000097 | Ga0070684_10000009714 | 424 |
| 79 | 3300005539 | Ga0068853_100010492 | Ga0068853_1000104924 | 424 |
| 80 | 3300005564 | Ga0070664_100002153 | Ga0070664_1000021534 | 424 |
| 81 | 3300005577 | Ga0068857_100001948 | Ga0068857_10000194815 | 424 |
| 82 | 3300025920 | Ga0207649_10004075 | Ga0207649_100040754 | 424 |
| 83 | 3300025944 | Ga0207661_10002590 | Ga0207661_100025903 | 424 |
| 84 | 3300026041 | Ga0207639_10008635 | Ga0207639_100086352 | 424 |
| 85 | 3300026116 | Ga0207674_10005014 | Ga0207674_1000501413 | 424 |
| 86 | 3300005617 | Ga0068859_100072344 | Ga0068859_1000723443 | 426 |
| 87 | 3300006931 | Ga0097620_100072341 | Ga0097620_1000723413 | 426 |
| 88 | 3300049588 | Ga0501072_0038926 | Ga0501072_0038926_1757_3088 | 426 |
| 89 | iso_pu_bacteria | 2914759650 | 2914763513 | 427 |
| 90 | 3300009101 | Ga0105247_10000918 | Ga0105247_1000091815 | 428 |
| 91 | 3300025900 | Ga0207710_10006684 | Ga0207710_100066842 | 428 |
| 92 | 3300025938 | Ga0207704_10133735 | Ga0207704_101337352 | 428 |
| 93 | 3300005329 | Ga0070683_100010174 | Ga0070683_1000101748 | 429 |
| 94 | 3300005334 | Ga0068869_100000827 | Ga0068869_10000082712 | 429 |
| 95 | 3300005365 | Ga0070688_100053059 | Ga0070688_1000530592 | 429 |
| 96 | 3300005457 | Ga0070662_100095207 | Ga0070662_1000952072 | 429 |
| 97 | 3300005466 | Ga0070685_10083650 | Ga0070685_100836501 | 429 |
| 98 | 3300005466 | Ga0070685_10093187 | Ga0070685_100931872 | 429 |
| 99 | 3300005535 | Ga0070684_100004583 | Ga0070684_1000045835 | 429 |
| 100 | 3300005543 | Ga0070672_100049912 | Ga0070672_1000499123 | 429 |
| 101 | 3300005564 | Ga0070664_100147385 | Ga0070664_1001473852 | 429 |
| 102 | 3300005617 | Ga0068859_100188649 | Ga0068859_1001886492 | 429 |
| 103 | 3300005617 | Ga0068859_100394044 | Ga0068859_1003940442 | 429 |
| 104 | 3300005618 | Ga0068864_100047498 | Ga0068864_1000474982 | 429 |
| 105 | 3300005618 | Ga0068864_100125955 | Ga0068864_1001259552 | 429 |
| 106 | 3300005841 | Ga0068863_100044635 | Ga0068863_1000446354 | 429 |
| 107 | 3300006358 | Ga0068871_100044561 | Ga0068871_1000445613 | 429 |
| 108 | 3300006931 | Ga0097620_100188669 | Ga0097620_1001886692 | 429 |
| 109 | 3300006931 | Ga0097620_100394053 | Ga0097620_1003940532 | 429 |
| 110 | 3300009176 | Ga0105242_10005938 | Ga0105242_100059386 | 429 |
| 111 | 3300013296 | Ga0157374_10003727 | Ga0157374_100037275 | 429 |
| 112 | 3300013308 | Ga0157375_10259438 | Ga0157375_102594382 | 429 |
| 113 | 3300014325 | Ga0163163_10000088 | Ga0163163_10000088100 | 429 |
| 114 | 3300014745 | Ga0157377_10050276 | Ga0157377_100502762 | 429 |
| 115 | 3300014969 | Ga0157376_10017122 | Ga0157376_100171224 | 429 |
| 116 | 3300025904 | Ga0207647_10018132 | Ga0207647_100181322 | 429 |
| 117 | 3300025907 | Ga0207645_10020715 | Ga0207645_100207153 | 429 |
| 118 | 3300025933 | Ga0207706_10007006 | Ga0207706_100070066 | 429 |
| 119 | 3300025934 | Ga0207686_10002663 | Ga0207686_100026635 | 429 |
| 120 | 3300025945 | Ga0207679_10264564 | Ga0207679_102645641 | 429 |
| 121 | 3300025972 | Ga0207668_10115548 | Ga0207668_101155482 | 429 |
| 122 | 3300025986 | Ga0207658_10158847 | Ga0207658_101588472 | 429 |
| 123 | 3300026067 | Ga0207678_10056356 | Ga0207678_100563562 | 429 |
| 124 | 3300026088 | Ga0207641_10003172 | Ga0207641_100031729 | 429 |
| 125 | 3300026088 | Ga0207641_10018346 | Ga0207641_100183462 | 429 |
| 126 | 3300048913 | Ga0496110_0053529 | Ga0496110_0053529_563_1903 | 429 |
| 127 | 3300005290 | Ga0065712_10090935 | Ga0065712_100909352 | 430 |
| 128 | 3300005340 | Ga0070689_100050420 | Ga0070689_1000504203 | 430 |
| 129 | 3300005719 | Ga0068861_100204696 | Ga0068861_1002046962 | 430 |
| 130 | 3300005843 | Ga0068860_100005770 | Ga0068860_1000057706 | 430 |
| 131 | 3300006195 | Ga0075366_10066842 | Ga0075366_100668421 | 430 |
| 132 | 3300006195 | Ga0075366_10095718 | Ga0075366_100957181 | 430 |
| 133 | 3300025908 | Ga0207643_10027820 | Ga0207643_100278202 | 430 |
| 134 | 3300026075 | Ga0207708_10116732 | Ga0207708_101167323 | 430 |
| 135 | 3300026116 | Ga0207674_10065358 | Ga0207674_100653583 | 430 |
| 136 | 3300028381 | Ga0268264_10022683 | Ga0268264_100226834 | 430 |
| 137 | 3300050493 | nmdc:mga0k408_2685_c1 | nmdc:mga0k408_2685_c1_402_1733 | 430 |
| 138 | 3300005295 | Ga0065707_10117759 | Ga0065707_101177591 | 431 |
| 139 | 3300005328 | Ga0070676_10005918 | Ga0070676_100059185 | 431 |
| 140 | 3300005329 | Ga0070683_100019940 | Ga0070683_1000199402 | 431 |
| 141 | 3300005329 | Ga0070683_100076332 | Ga0070683_1000763321 | 431 |
| 142 | 3300005331 | Ga0070670_100015951 | Ga0070670_1000159512 | 431 |
| 143 | 3300005331 | Ga0070670_100071955 | Ga0070670_1000719553 | 431 |
| 144 | 3300005331 | Ga0070670_100165474 | Ga0070670_1001654742 | 431 |
| 145 | 3300005334 | Ga0068869_100007930 | Ga0068869_1000079306 | 431 |
| 146 | 3300005334 | Ga0068869_100152936 | Ga0068869_1001529362 | 431 |
| 147 | 3300005335 | Ga0070666_10000323 | Ga0070666_1000032322 | 431 |
| 148 | 3300005335 | Ga0070666_10021310 | Ga0070666_100213103 | 431 |
| 149 | 3300005336 | Ga0070680_100141301 | Ga0070680_1001413012 | 431 |
| 150 | 3300005336 | Ga0070680_100148844 | Ga0070680_1001488442 | 431 |
| 151 | 3300005338 | Ga0068868_100003336 | Ga0068868_1000033364 | 431 |
| 152 | 3300005340 | Ga0070689_100121494 | Ga0070689_1001214942 | 431 |
| 153 | 3300005347 | Ga0070668_100004850 | Ga0070668_1000048503 | 431 |
| 154 | 3300005354 | Ga0070675_100032180 | Ga0070675_1000321802 | 431 |
| 155 | 3300005354 | Ga0070675_100287358 | Ga0070675_1002873581 | 431 |
| 156 | 3300005355 | Ga0070671_100005531 | Ga0070671_1000055318 | 431 |
| 157 | 3300005356 | Ga0070674_100009316 | Ga0070674_1000093164 | 431 |
| 158 | 3300005364 | Ga0070673_100052074 | Ga0070673_1000520743 | 431 |
| 159 | 3300005365 | Ga0070688_100039955 | Ga0070688_1000399552 | 431 |
| 160 | 3300005367 | Ga0070667_100025990 | Ga0070667_1000259903 | 431 |
| 161 | 3300005456 | Ga0070678_100002885 | Ga0070678_1000028858 | 431 |
| 162 | 3300005458 | Ga0070681_10104078 | Ga0070681_101040782 | 431 |
| 163 | 3300005471 | Ga0070698_100002644 | Ga0070698_1000026449 | 431 |
| 164 | 3300005471 | Ga0070698_100008254 | Ga0070698_1000082544 | 431 |
| 165 | 3300005518 | Ga0070699_100157147 | Ga0070699_1001571472 | 431 |
| 166 | 3300005530 | Ga0070679_100018050 | Ga0070679_1000180502 | 431 |
| 167 | 3300005530 | Ga0070679_100268792 | Ga0070679_1002687921 | 431 |
| 168 | 3300005536 | Ga0070697_100195137 | Ga0070697_1001951372 | 431 |
| 169 | 3300005539 | Ga0068853_100051958 | Ga0068853_1000519583 | 431 |
| 170 | 3300005539 | Ga0068853_100067510 | Ga0068853_1000675102 | 431 |
| 171 | 3300005543 | Ga0070672_100002698 | Ga0070672_1000026985 | 431 |
| 172 | 3300005543 | Ga0070672_100144054 | Ga0070672_1001440542 | 431 |
| 173 | 3300005548 | Ga0070665_100010164 | Ga0070665_1000101644 | 431 |
| 174 | 3300005563 | Ga0068855_100008654 | Ga0068855_10000865410 | 431 |
| 175 | 3300005563 | Ga0068855_100339577 | Ga0068855_1003395771 | 431 |
| 176 | 3300005564 | Ga0070664_100025602 | Ga0070664_1000256024 | 431 |
| 177 | 3300005578 | Ga0068854_100085413 | Ga0068854_1000854131 | 431 |
| 178 | 3300005614 | Ga0068856_100013119 | Ga0068856_1000131195 | 431 |
| 179 | 3300005616 | Ga0068852_100007001 | Ga0068852_1000070017 | 431 |
| 180 | 3300005616 | Ga0068852_100315376 | Ga0068852_1003153762 | 431 |
| 181 | 3300005617 | Ga0068859_100000106 | Ga0068859_10000010655 | 431 |
| 182 | 3300005617 | Ga0068859_100007461 | Ga0068859_1000074612 | 431 |
| 183 | 3300005617 | Ga0068859_100013598 | Ga0068859_1000135985 | 431 |
| 184 | 3300005617 | Ga0068859_100017266 | Ga0068859_1000172664 | 431 |
| 185 | 3300005617 | Ga0068859_100441080 | Ga0068859_1004410801 | 431 |
| 186 | 3300005618 | Ga0068864_100021891 | Ga0068864_1000218915 | 431 |
| 187 | 3300005618 | Ga0068864_100023396 | Ga0068864_1000233964 | 431 |
| 188 | 3300005718 | Ga0068866_10005336 | Ga0068866_100053363 | 431 |
| 189 | 3300005718 | Ga0068866_10011364 | Ga0068866_100113644 | 431 |
| 190 | 3300005834 | Ga0068851_10042676 | Ga0068851_100426762 | 431 |
| 191 | 3300005841 | Ga0068863_100015218 | Ga0068863_1000152184 | 431 |
| 192 | 3300005841 | Ga0068863_100082768 | Ga0068863_1000827684 | 431 |
| 193 | 3300005842 | Ga0068858_100006822 | Ga0068858_10000682211 | 431 |
| 194 | 3300005843 | Ga0068860_100004286 | Ga0068860_1000042864 | 431 |
| 195 | 3300005843 | Ga0068860_100027668 | Ga0068860_1000276684 | 431 |
| 196 | 3300005843 | Ga0068860_100072596 | Ga0068860_1000725963 | 431 |
| 197 | 3300005844 | Ga0068862_100009607 | Ga0068862_1000096072 | 431 |
| 198 | 3300005844 | Ga0068862_100075095 | Ga0068862_1000750952 | 431 |
| 199 | 3300006358 | Ga0068871_100021314 | Ga0068871_1000213145 | 431 |
| 200 | 3300006358 | Ga0068871_100046702 | Ga0068871_1000467022 | 431 |
| 201 | 3300006358 | Ga0068871_100047840 | Ga0068871_1000478403 | 431 |
| 202 | 3300006844 | Ga0075428_100162076 | Ga0075428_1001620762 | 431 |
| 203 | 3300006847 | Ga0075431_100011013 | Ga0075431_1000110136 | 431 |
| 204 | 3300006881 | Ga0068865_100185382 | Ga0068865_1001853821 | 431 |
| 205 | 3300006931 | Ga0097620_100000106 | Ga0097620_10000010655 | 431 |
| 206 | 3300006931 | Ga0097620_100007461 | Ga0097620_1000074612 | 431 |
| 207 | 3300006931 | Ga0097620_100013598 | Ga0097620_1000135985 | 431 |
| 208 | 3300006931 | Ga0097620_100017266 | Ga0097620_1000172664 | 431 |
| 209 | 3300006931 | Ga0097620_100441050 | Ga0097620_1004410501 | 431 |
| 210 | 3300009094 | Ga0111539_10376871 | Ga0111539_103768712 | 431 |
| 211 | 3300009101 | Ga0105247_10006091 | Ga0105247_100060911 | 431 |
| 212 | 3300009147 | Ga0114129_10268537 | Ga0114129_102685371 | 431 |
| 213 | 3300009174 | Ga0105241_10001462 | Ga0105241_1000146213 | 431 |
| 214 | 3300009545 | Ga0105237_10003093 | Ga0105237_1000309314 | 431 |
| 215 | 3300009545 | Ga0105237_10019088 | Ga0105237_100190882 | 431 |
| 216 | 3300009553 | Ga0105249_10002137 | Ga0105249_1000213716 | 431 |
| 217 | 3300009553 | Ga0105249_10003042 | Ga0105249_100030424 | 431 |
| 218 | 3300009553 | Ga0105249_10042119 | Ga0105249_100421194 | 431 |
| 219 | 3300010375 | Ga0105239_10257595 | Ga0105239_102575952 | 431 |
| 220 | 3300010375 | Ga0105239_10337804 | Ga0105239_103378042 | 431 |
| 221 | 3300013100 | Ga0157373_10004894 | Ga0157373_100048947 | 431 |
| 222 | 3300013102 | Ga0157371_10000232 | Ga0157371_1000023268 | 431 |
| 223 | 3300013102 | Ga0157371_10000741 | Ga0157371_1000074130 | 431 |
| 224 | 3300013102 | Ga0157371_10001331 | Ga0157371_100013313 | 431 |
| 225 | 3300013102 | Ga0157371_10028986 | Ga0157371_100289863 | 431 |
| 226 | 3300013102 | Ga0157371_10101752 | Ga0157371_101017522 | 431 |
| 227 | 3300013104 | Ga0157370_10000242 | Ga0157370_1000024256 | 431 |
| 228 | 3300013104 | Ga0157370_10007303 | Ga0157370_1000730311 | 431 |
| 229 | 3300013105 | Ga0157369_10377583 | Ga0157369_103775831 | 431 |
| 230 | 3300013296 | Ga0157374_10009845 | Ga0157374_100098452 | 431 |
| 231 | 3300013296 | Ga0157374_10024479 | Ga0157374_100244793 | 431 |
| 232 | 3300013296 | Ga0157374_10199219 | Ga0157374_101992193 | 431 |
| 233 | 3300013297 | Ga0157378_10004824 | Ga0157378_1000482410 | 431 |
| 234 | 3300013297 | Ga0157378_10029970 | Ga0157378_100299705 | 431 |
| 235 | 3300013297 | Ga0157378_10123277 | Ga0157378_101232772 | 431 |
| 236 | 3300013306 | Ga0163162_10011449 | Ga0163162_1001144910 | 431 |
| 237 | 3300013306 | Ga0163162_10090199 | Ga0163162_100901993 | 431 |
| 238 | 3300013306 | Ga0163162_10168785 | Ga0163162_101687852 | 431 |
| 239 | 3300013307 | Ga0157372_10049053 | Ga0157372_100490534 | 431 |
| 240 | 3300013307 | Ga0157372_10368672 | Ga0157372_103686722 | 431 |
| 241 | 3300013308 | Ga0157375_10032468 | Ga0157375_100324684 | 431 |
| 242 | 3300014326 | Ga0157380_10187723 | Ga0157380_101877232 | 431 |
| 243 | 3300014968 | Ga0157379_10012914 | Ga0157379_100129144 | 431 |
| 244 | 3300017792 | Ga0163161_10078942 | Ga0163161_100789422 | 431 |
| 245 | 3300025321 | Ga0207656_10030515 | Ga0207656_100305152 | 431 |
| 246 | 3300025321 | Ga0207656_10032152 | Ga0207656_100321522 | 431 |
| 247 | 3300025899 | Ga0207642_10007453 | Ga0207642_100074533 | 431 |
| 248 | 3300025900 | Ga0207710_10031166 | Ga0207710_100311662 | 431 |
| 249 | 3300025903 | Ga0207680_10000958 | Ga0207680_100009589 | 431 |
| 250 | 3300025904 | Ga0207647_10031308 | Ga0207647_100313082 | 431 |
| 251 | 3300025907 | Ga0207645_10002278 | Ga0207645_1000227811 | 431 |
| 252 | 3300025907 | Ga0207645_10149973 | Ga0207645_101499732 | 431 |
| 253 | 3300025908 | Ga0207643_10003128 | Ga0207643_100031284 | 431 |
| 254 | 3300025912 | Ga0207707_10116130 | Ga0207707_101161302 | 431 |
| 255 | 3300025914 | Ga0207671_10007498 | Ga0207671_100074984 | 431 |
| 256 | 3300025917 | Ga0207660_10030214 | Ga0207660_100302143 | 431 |
| 257 | 3300025921 | Ga0207652_10000029 | Ga0207652_1000002961 | 431 |
| 258 | 3300025921 | Ga0207652_10000115 | Ga0207652_1000011570 | 431 |
| 259 | 3300025921 | Ga0207652_10304572 | Ga0207652_103045721 | 431 |
| 260 | 3300025933 | Ga0207706_10093681 | Ga0207706_100936812 | 431 |
| 261 | 3300025940 | Ga0207691_10005078 | Ga0207691_100050783 | 431 |
| 262 | 3300025940 | Ga0207691_10048807 | Ga0207691_100488071 | 431 |
| 263 | 3300025940 | Ga0207691_10077859 | Ga0207691_100778592 | 431 |
| 264 | 3300025942 | Ga0207689_10000360 | Ga0207689_1000036023 | 431 |
| 265 | 3300025942 | Ga0207689_10001010 | Ga0207689_1000101022 | 431 |
| 266 | 3300025945 | Ga0207679_10258024 | Ga0207679_102580241 | 431 |
| 267 | 3300025949 | Ga0207667_10011285 | Ga0207667_100112852 | 431 |
| 268 | 3300025949 | Ga0207667_10028760 | Ga0207667_100287605 | 431 |
| 269 | 3300025960 | Ga0207651_10012195 | Ga0207651_100121952 | 431 |
| 270 | 3300025960 | Ga0207651_10024667 | Ga0207651_100246672 | 431 |
| 271 | 3300025961 | Ga0207712_10001164 | Ga0207712_100011642 | 431 |
| 272 | 3300025961 | Ga0207712_10038507 | Ga0207712_100385073 | 431 |
| 273 | 3300025972 | Ga0207668_10180729 | Ga0207668_101807291 | 431 |
| 274 | 3300026023 | Ga0207677_10044038 | Ga0207677_100440382 | 431 |
| 275 | 3300026035 | Ga0207703_10001922 | Ga0207703_1000192212 | 431 |
| 276 | 3300026041 | Ga0207639_10014729 | Ga0207639_100147292 | 431 |
| 277 | 3300026088 | Ga0207641_10000082 | Ga0207641_10000082109 | 431 |
| 278 | 3300026088 | Ga0207641_10096906 | Ga0207641_100969062 | 431 |
| 279 | 3300026088 | Ga0207641_10129905 | Ga0207641_101299052 | 431 |
| 280 | 3300026089 | Ga0207648_10001709 | Ga0207648_100017098 | 431 |
| 281 | 3300026121 | Ga0207683_10000974 | Ga0207683_100009747 | 431 |
| 282 | 3300026121 | Ga0207683_10210993 | Ga0207683_102109931 | 431 |
| 283 | 3300026142 | Ga0207698_10008386 | Ga0207698_100083863 | 431 |
| 284 | 3300026142 | Ga0207698_10078465 | Ga0207698_100784652 | 431 |
| 285 | 3300028380 | Ga0268265_10018798 | Ga0268265_100187982 | 431 |
| 286 | 3300028381 | Ga0268264_10007283 | Ga0268264_100072833 | 431 |
| 287 | 3300028381 | Ga0268264_10013367 | Ga0268264_100133672 | 431 |
| 288 | 3300028381 | Ga0268264_10028427 | Ga0268264_100284272 | 431 |
| 289 | 3300028381 | Ga0268264_10068669 | Ga0268264_100686691 | 431 |
| 290 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000011214 | 431 |
| 291 | 3300028794 | Ga0307515_10000190 | Ga0307515_1000019033 | 431 |
| 292 | 3300031251 | Ga0265327_10000248 | Ga0265327_1000024847 | 431 |
| 293 | 3300031456 | Ga0307513_10059661 | Ga0307513_100596612 | 431 |
| 294 | 3300031507 | Ga0307509_10043396 | Ga0307509_100433962 | 431 |
| 295 | 3300031507 | Ga0307509_10117642 | Ga0307509_101176422 | 431 |
| 296 | 3300031616 | Ga0307508_10004493 | Ga0307508_100044932 | 431 |
| 297 | 3300037312 | Ga0395899_0017114 | Ga0395899_0017114_28_1359 | 431 |
| 298 | 3300037312 | Ga0395899_0064301 | Ga0395899_0064301_274_1605 | 431 |
| 299 | 3300037312 | Ga0395899_0107715 | Ga0395899_0107715_496_1827 | 431 |
| 300 | 3300037418 | Ga0395900_0002285 | Ga0395900_0002285_3207_4538 | 431 |
| 301 | 3300037418 | Ga0395900_0052792 | Ga0395900_0052792_2650_3981 | 431 |
| 302 | 3300037418 | Ga0395900_0241095 | Ga0395900_0241095_212_1543 | 431 |
| 303 | 3300037466 | Ga0395898_0004777 | Ga0395898_0004777_10192_11523 | 431 |
| 304 | 3300037466 | Ga0395898_0040525 | Ga0395898_0040525_143_1474 | 431 |
| 305 | 3300037466 | Ga0395898_0046113 | Ga0395898_0046113_118_1449 | 431 |
| 306 | 3300037471 | Ga0395905_0114102 | Ga0395905_0114102_510_1841 | 431 |
| 307 | 3300038443 | Ga0395901_0002351 | Ga0395901_0002351_11330_12661 | 431 |
| 308 | 3300038443 | Ga0395901_0063792 | Ga0395901_0063792_637_1968 | 431 |
| 309 | 3300038443 | Ga0395901_0216050 | Ga0395901_0216050_496_1827 | 431 |
| 310 | 3300039437 | Ga0436365_0575116 | Ga0436365_0575116_8761_10092 | 431 |
| 311 | 3300041410 | Ga0439461_0012881 | Ga0439461_0012881_38_1369 | 431 |
| 312 | 3300042131 | Ga0450894_001519 | Ga0450894_001519_454_1785 | 431 |
| 313 | 3300042876 | Ga0451577_0003822 | Ga0451577_0003822_669_2000 | 431 |
| 314 | 3300046616 | Ga0495668_0000257 | Ga0495668_0000257_18900_20231 | 431 |
| 315 | 3300048911 | Ga0496108_0099847 | Ga0496108_0099847_557_1888 | 431 |
| 316 | 3300049569 | Ga0501032_0006571 | Ga0501032_0006571_1550_2881 | 431 |
| 317 | 3300049569 | Ga0501032_0034121 | Ga0501032_0034121_31_1401 | 431 |
| 318 | 3300049570 | Ga0501033_0058342 | Ga0501033_0058342_811_2142 | 431 |
| 319 | 3300049571 | Ga0501034_0012481 | Ga0501034_0012481_7294_8625 | 431 |
| 320 | 3300049571 | Ga0501034_0015240 | Ga0501034_0015240_5340_6671 | 431 |
| 321 | 3300049572 | Ga0501036_0044598 | Ga0501036_0044598_1975_3345 | 431 |
| 322 | 3300049572 | Ga0501036_0044824 | Ga0501036_0044824_741_2072 | 431 |
| 323 | 3300049573 | Ga0501037_0043532 | Ga0501037_0043532_1295_2626 | 431 |
| 324 | 3300049574 | Ga0501038_0014165 | Ga0501038_0014165_1834_3165 | 431 |
| 325 | 3300049574 | Ga0501038_0027154 | Ga0501038_0027154_3567_4937 | 431 |
| 326 | 3300049579 | Ga0501043_0129450 | Ga0501043_0129450_11_1342 | 431 |
| 327 | 3300049581 | Ga0501047_0042863 | Ga0501047_0042863_2064_3395 | 431 |
| 328 | 3300049581 | Ga0501047_0075412 | Ga0501047_0075412_1065_2396 | 431 |
| 329 | 3300049589 | Ga0501073_0018558 | Ga0501073_0018558_1398_2729 | 431 |
| 330 | 3300049590 | Ga0501074_0023054 | Ga0501074_0023054_1776_3107 | 431 |
| 331 | 3300049822 | Ga0501035_0006054 | Ga0501035_0006054_8550_9881 | 431 |
| 332 | 3300049822 | Ga0501035_0065626 | Ga0501035_0065626_866_2236 | 431 |
| 333 | 3300053139 | Ga0500568_0000274 | Ga0500568_0000274_2652_3983 | 431 |
| 334 | 3300053153 | Ga0500616_0006236 | Ga0500616_0006236_6474_7820 | 431 |
| 335 | 3300003354 | JGI25160J50197_1000376 | JGI25160J50197_10003769 | 432 |
| 336 | 3300005337 | Ga0070682_100000039 | Ga0070682_10000003914 | 432 |
| 337 | 3300005539 | Ga0068853_100013848 | Ga0068853_1000138487 | 432 |
| 338 | 3300005841 | Ga0068863_100008926 | Ga0068863_1000089265 | 432 |
| 339 | 3300009553 | Ga0105249_10006302 | Ga0105249_100063027 | 432 |
| 340 | 3300025302 | Ga0207426_1000026 | Ga0207426_1000026433 | 432 |
| 341 | 3300026041 | Ga0207639_10028699 | Ga0207639_100286994 | 432 |
| 342 | 3300026088 | Ga0207641_10019559 | Ga0207641_100195595 | 432 |
| 343 | 3300031251 | Ga0265327_10029993 | Ga0265327_100299933 | 432 |
| 344 | 3300005293 | Ga0065715_10127698 | Ga0065715_101276982 | 433 |
| 345 | 3300005353 | Ga0070669_100022615 | Ga0070669_1000226152 | 433 |
| 346 | 3300005354 | Ga0070675_100010179 | Ga0070675_1000101797 | 433 |
| 347 | 3300005364 | Ga0070673_100017710 | Ga0070673_1000177103 | 433 |
| 348 | 3300005457 | Ga0070662_100159779 | Ga0070662_1001597792 | 433 |
| 349 | 3300005543 | Ga0070672_100013153 | Ga0070672_1000131535 | 433 |
| 350 | 3300005844 | Ga0068862_100010565 | Ga0068862_1000105651 | 433 |
| 351 | 3300013308 | Ga0157375_10029302 | Ga0157375_100293023 | 433 |
| 352 | 3300014326 | Ga0157380_10000796 | Ga0157380_1000079612 | 433 |
| 353 | 3300025933 | Ga0207706_10102844 | Ga0207706_101028443 | 433 |
| 354 | 3300025960 | Ga0207651_10166919 | Ga0207651_101669192 | 433 |
| 355 | 3300025961 | Ga0207712_10021922 | Ga0207712_100219223 | 433 |
| 356 | 3300026116 | Ga0207674_10152656 | Ga0207674_101526562 | 433 |
| 357 | 3300026118 | Ga0207675_100001037 | Ga0207675_1000010377 | 433 |
| 358 | 3300031548 | Ga0307408_100110922 | Ga0307408_1001109222 | 433 |
| 359 | 3300031903 | Ga0307407_10052665 | Ga0307407_100526654 | 433 |
| 360 | 3300032126 | Ga0307415_100012985 | Ga0307415_1000129853 | 433 |
| 361 | 3300044658 | Ga0466972_0000001 | Ga0466972_0000001_217251_218591 | 433 |
| 362 | 3300044765 | Ga0466970_0004272 | Ga0466970_0004272_1335_2675 | 433 |
| 363 | 3300005338 | Ga0068868_100007843 | Ga0068868_1000078437 | 434 |
| 364 | 3300005364 | Ga0070673_100141003 | Ga0070673_1001410032 | 434 |
| 365 | 3300005578 | Ga0068854_100011495 | Ga0068854_1000114953 | 434 |
| 366 | 3300010375 | Ga0105239_10357709 | Ga0105239_103577092 | 434 |
| 367 | 3300013296 | Ga0157374_10091145 | Ga0157374_100911452 | 434 |
| 368 | 3300013308 | Ga0157375_10037235 | Ga0157375_100372354 | 434 |
| 369 | 3300025933 | Ga0207706_10026625 | Ga0207706_100266254 | 434 |
| 370 | 3300025942 | Ga0207689_10180421 | Ga0207689_101804212 | 434 |
| 371 | 3300026089 | Ga0207648_10172377 | Ga0207648_101723772 | 434 |
| 372 | 3300049585 | Ga0501069_0089211 | Ga0501069_0089211_207_1580 | 434 |
| 373 | 3300053727 | Ga0500611_000004 | Ga0500611_000004_184982_186322 | 434 |
| 374 | iso_pu_bacteria | 2818991444 | 2819585923 | 435 |
| 375 | iso_pu_bacteria | 2929154850 | 2929159314 | 435 |
| 376 | 3300005844 | Ga0068862_100054443 | Ga0068862_1000544432 | 436 |
| 377 | 3300006844 | Ga0075428_100004442 | Ga0075428_1000044425 | 436 |
| 378 | 3300006880 | Ga0075429_100004992 | Ga0075429_1000049926 | 436 |
| 379 | 3300009176 | Ga0105242_10008165 | Ga0105242_100081657 | 436 |
| 380 | 3300011119 | Ga0105246_10139552 | Ga0105246_101395522 | 436 |
| 381 | 3300028380 | Ga0268265_10145638 | Ga0268265_101456382 | 436 |
| 382 | 3300050508 | nmdc:mga09592_9012_c1 | nmdc:mga09592_9012_c1_2754_4103 | 436 |
| 383 | 3300005329 | Ga0070683_100172058 | Ga0070683_1001720582 | 437 |
| 384 | 3300005535 | Ga0070684_100138458 | Ga0070684_1001384582 | 437 |
| 385 | 3300025925 | Ga0207650_10253989 | Ga0207650_102539891 | 437 |
| 386 | 3300031251 | Ga0265327_10000452 | Ga0265327_1000045238 | 438 |
| 387 | 3300009545 | Ga0105237_10002321 | Ga0105237_1000232113 | 439 |
| 388 | 3300053108 | Ga0500562_000053 | Ga0500562_000053_52010_53383 | 439 |
| 389 | 3300053156 | Ga0500622_0003854 | Ga0500622_0003854_108_1481 | 439 |
| 390 | 3300003320 | rootH2_10046607 | rootH2_100466078 | 440 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6iem-assembly1.cif.gz_B | argininosuccinate lyase from mycobacterium tuberculosis | 0.8828 | 24 | 424 |
| 6iem-assembly1.cif.gz_C | argininosuccinate lyase from mycobacterium tuberculosis | 0.8813 | 24 | 424 |
| 6ig5-assembly1.cif.gz_A | crystal structure of argininosuccinate lyase from mycobacterium tuberculosis | 0.8785 | 24 | 424 |
| 6ien-assembly1.cif.gz_A | substrate/product bound argininosuccinate lyase from mycobacterium tuberculosis | 0.8768 | 26 | 424 |
| 6iem-assembly2.cif.gz_G | argininosuccinate lyase from mycobacterium tuberculosis | 0.8686 | 14 | 424 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1JV68_161_409_1.20.200.10 | Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) | 0.9205 | 102 | 347 | 1.20.200.10 |
| af_Q2FZU2_109_364_1.20.200.10 | Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) | 0.9041 | 102 | 352 | 1.20.200.10 |
| af_I1JV68_161_409_1.20.200.10 | Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) | 0.9031 | 102 | 347 | 1.20.200.10 |
| af_Q2FZU2_109_364_1.20.200.10 | Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) | 0.8809 | 102 | 352 | 1.20.200.10 |
| af_Q2FZU2_109_446_1.20.200.10 | Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) | 0.8753 | 102 | 407 | 1.20.200.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1T5H2T0-F1-model_v4 | Argininosuccinate lyase (EC 4.3.2.1) | 0.9436 | 26 | 439 |
GO:0004056
GO:0005829 GO:0006526 GO:0042450 |
| AF-A0A1T5H2T0-F1-model_v4 | Argininosuccinate lyase (EC 4.3.2.1) | 0.9284 | 26 | 439 |
GO:0004056
GO:0005829 GO:0006526 GO:0042450 |
| AF-A0A7Y2AT48-F1-model_v4 | Argininosuccinate lyase | 0.9183 | 154 | 419 |
GO:0004056
GO:0005829 GO:0042450 |
| AF-F6GPH7-F1-model_v4 | argininosuccinate lyase (EC 4.3.2.1) | 0.9145 | 81 | 203 |
GO:0004056
GO:0005829 GO:0006099 GO:0006526 GO:0042450 |
| AF-A0A7Y2AT48-F1-model_v4 | Argininosuccinate lyase | 0.9118 | 154 | 419 |
GO:0004056
GO:0005829 GO:0042450 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar