F431625

General Info

Members Datasets Scaffolds Average Seq Length
390 191 387 437

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100019940|Ga0070683_1000199402
Length 462
Sequence MSSLHLKPATCNLQPAMKLWQKNIESLKEVEKFTVGNDREFDLQLAPFDVLGSIAHAKMLAEVGLLTKDEAQKLSRELKNIYTSIHDSRFTIDETVEDIHSQVEFLLTQKLGDVGKKIHSARSRNDQVLVDIKLFLRNEIEELVKKILPFFELLQSQSEKYKDDLLPGYTHLQLAMPSSFGLWFGAYAESLVDDIITLKAAYDVVNKNPLGSAAGYGSSFPISRTLTTKLLGFETLNYNVVYAQMGRGKSERIVAMALANVADTLSRLSMDACLFLNQNFDFISFPAELTTGSSIMPHKKNPDVFELIRSHGNRIKSLPNEIMLMTTNLPSGYHRDLQLLKEHLFPAFKTIKNCLEMAGLMLSNIEIKKNILADEKYKYLFTVDEVHKLVMQGIPFRDAYTIVGQKVEDGTFAPPPSEEITRGLHEGSVGNLSNEQIKKQMEKVIASFPFTAVHSAVSGLLK

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2914759650 Rhizosphaericola mali Isolate Rhizosphere
3 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
154 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
155 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
156 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
190 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
191 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0
Isolates 0.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0
Rhizoplane 0.77
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 3.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10046607 3300003320 Bacteria 9030
2 rootH2_10216978 3300003320 Bacteria 3235
3 JGI25160J50197_1000376 3300003354 Bacteria 29172
4 Ga0065712_10090935 3300005290 Bacteria 2396
5 Ga0065715_10127698 3300005293 Bacteria 2081
6 Ga0065707_10117759 3300005295 Bacteria 2204
7 Ga0070676_10005918 3300005328 Bacteria 6528
8 Ga0070683_100002536 3300005329 Bacteria 14576
9 Ga0070683_100010174 3300005329 Bacteria 8074
10 Ga0070683_100019940 3300005329 Bacteria 5961
11 Ga0070683_100076332 3300005329 Bacteria 3132
12 Ga0070683_100120760 3300005329 Bacteria 2475
13 Ga0070683_100172058 3300005329 Bacteria 2056
14 Ga0070690_100018071 3300005330 Bacteria 4251
15 Ga0070670_100015951 3300005331 Bacteria 6446
16 Ga0070670_100071955 3300005331 Bacteria 2969
17 Ga0070670_100076846 3300005331 Bacteria 2869
18 Ga0070670_100165474 3300005331 Bacteria 1917
19 Ga0068869_100000827 3300005334 Bacteria 17676
20 Ga0068869_100007930 3300005334 Bacteria 6821
21 Ga0068869_100079486 3300005334 Bacteria 2444
22 Ga0068869_100152936 3300005334 Bacteria 1791
23 Ga0070666_10000323 3300005335 Bacteria 30548
24 Ga0070666_10021310 3300005335 Bacteria 4200
25 Ga0070680_100141301 3300005336 Bacteria 2019
26 Ga0070680_100148844 3300005336 Bacteria 1965
27 Ga0070682_100000039 3300005337 Bacteria 144400
28 Ga0070682_100066319 3300005337 Bacteria 2296
29 Ga0068868_100003336 3300005338 Bacteria 11167
30 Ga0068868_100007843 3300005338 Bacteria 7619
31 Ga0068868_100017573 3300005338 Bacteria 5332
32 Ga0068868_100136165 3300005338 Bacteria 2013
33 Ga0070660_100002764 3300005339 Bacteria 12054
34 Ga0070689_100050420 3300005340 Bacteria 3216
35 Ga0070689_100121494 3300005340 Bacteria 2086
36 Ga0070661_100002636 3300005344 Bacteria 12270
37 Ga0070661_100135391 3300005344 Bacteria 1853
38 Ga0070668_100004850 3300005347 Bacteria 9964
39 Ga0070669_100022615 3300005353 Bacteria 4495
40 Ga0070675_100010179 3300005354 Bacteria 7335
41 Ga0070675_100032180 3300005354 Bacteria 4243
42 Ga0070675_100058264 3300005354 Bacteria 3186
43 Ga0070675_100287358 3300005354 Unclassified 1447
44 Ga0070671_100005531 3300005355 Bacteria 10067
45 Ga0070674_100009316 3300005356 Bacteria 5878
46 Ga0070673_100017710 3300005364 Bacteria 5074
47 Ga0070673_100052074 3300005364 Bacteria 3210
48 Ga0070673_100141003 3300005364 Unclassified 2033
49 Ga0070688_100039955 3300005365 Bacteria 2873
50 Ga0070688_100053059 3300005365 Bacteria 2535
51 Ga0070659_100027782 3300005366 Bacteria 4362
52 Ga0070659_100074542 3300005366 Bacteria 2703
53 Ga0070667_100025990 3300005367 Bacteria 4870
54 Ga0070678_100002885 3300005456 Bacteria 9515
55 Ga0070678_100021447 3300005456 Bacteria 4260
56 Ga0070662_100010552 3300005457 Bacteria 6069
57 Ga0070662_100072138 3300005457 Unclassified 2548
58 Ga0070662_100095207 3300005457 Bacteria 2244
59 Ga0070662_100159779 3300005457 Bacteria 1762
60 Ga0070681_10104078 3300005458 Bacteria 2781
61 Ga0070685_10083650 3300005466 Unclassified 1917
62 Ga0070685_10093187 3300005466 Bacteria 1826
63 Ga0070698_100002644 3300005471 Bacteria 19745
64 Ga0070698_100008254 3300005471 Bacteria 11260
65 Ga0070699_100157147 3300005518 Bacteria 2012
66 Ga0070679_100018050 3300005530 Bacteria 6838
67 Ga0070679_100136887 3300005530 Bacteria 2430
68 Ga0070679_100268792 3300005530 Bacteria 1659
69 Ga0070684_100000097 3300005535 Bacteria 56477
70 Ga0070684_100004583 3300005535 Bacteria 10540
71 Ga0070684_100138458 3300005535 Bacteria 2200
72 Ga0070697_100195137 3300005536 Bacteria 1719
73 Ga0068853_100010492 3300005539 Bacteria 7492
74 Ga0068853_100013848 3300005539 Bacteria 6592
75 Ga0068853_100051958 3300005539 Bacteria 3529
76 Ga0068853_100067510 3300005539 Bacteria 3107
77 Ga0070672_100002698 3300005543 Bacteria 11352
78 Ga0070672_100013153 3300005543 Bacteria 5835
79 Ga0070672_100049912 3300005543 Bacteria 3257
80 Ga0070672_100144054 3300005543 Bacteria 1968
81 Ga0070686_100054956 3300005544 Bacteria 2549
82 Ga0070693_100131926 3300005547 Bacteria 1563
83 Ga0070665_100010164 3300005548 Bacteria 9518
84 Ga0068855_100008654 3300005563 Bacteria 12297
85 Ga0068855_100339577 3300005563 Bacteria 1656
86 Ga0070664_100002153 3300005564 Bacteria 15793
87 Ga0070664_100025602 3300005564 Bacteria 4892
88 Ga0070664_100109106 3300005564 Bacteria 2414
89 Ga0070664_100147385 3300005564 Bacteria 2076
90 Ga0068857_100001948 3300005577 Bacteria 16668
91 Ga0068857_100025391 3300005577 Bacteria 5217
92 Ga0068854_100011495 3300005578 Bacteria 5766
93 Ga0068854_100085413 3300005578 Bacteria 2337
94 Ga0068854_100086010 3300005578 Bacteria 2330
95 Ga0068856_100013119 3300005614 Bacteria 8028
96 Ga0068852_100007001 3300005616 Bacteria 8208
97 Ga0068852_100315376 3300005616 Bacteria 1517
98 Ga0068859_100000106 3300005617 Bacteria 78128
99 Ga0068859_100007461 3300005617 Bacteria 11100
100 Ga0068859_100013598 3300005617 Bacteria 8160
101 Ga0068859_100017266 3300005617 Bacteria 7246
102 Ga0068859_100072344 3300005617 Bacteria 3485
103 Ga0068859_100188649 3300005617 Bacteria 2145
104 Ga0068859_100394044 3300005617 Bacteria 1480
105 Ga0068859_100441080 3300005617 Bacteria 1398
106 Ga0068864_100021891 3300005618 Bacteria 5359
107 Ga0068864_100023396 3300005618 Bacteria 5188
108 Ga0068864_100047498 3300005618 Bacteria 3687
109 Ga0068864_100125955 3300005618 Bacteria 2296
110 Ga0068866_10005336 3300005718 Bacteria 5299
111 Ga0068866_10011364 3300005718 Bacteria 3849
112 Ga0068861_100204696 3300005719 Bacteria 1659
113 Ga0068851_10042676 3300005834 Bacteria 2284
114 Ga0068870_10037347 3300005840 Bacteria 2504
115 Ga0068863_100008926 3300005841 Bacteria 9789
116 Ga0068863_100015218 3300005841 Bacteria 7392
117 Ga0068863_100044635 3300005841 Bacteria 4206
118 Ga0068863_100082768 3300005841 Unclassified 3041
119 Ga0068858_100006822 3300005842 Bacteria 11107
120 Ga0068860_100004286 3300005843 Bacteria 14580
121 Ga0068860_100005770 3300005843 Bacteria 12479
122 Ga0068860_100027668 3300005843 Bacteria 5459
123 Ga0068860_100072596 3300005843 Unclassified 3271
124 Ga0068862_100009607 3300005844 Bacteria 7994
125 Ga0068862_100010565 3300005844 Bacteria 7630
126 Ga0068862_100054443 3300005844 Bacteria 3426
127 Ga0068862_100075095 3300005844 Bacteria 2923
128 Ga0068862_100093907 3300005844 Bacteria 2616
129 Ga0081539_10001169 3300005985 Bacteria 47510
130 Ga0075366_10066842 3300006195 Bacteria 2139
131 Ga0075366_10095718 3300006195 Bacteria 1780
132 Ga0068871_100021314 3300006358 Bacteria 4980
133 Ga0068871_100038096 3300006358 Bacteria 3837
134 Ga0068871_100044561 3300006358 Bacteria 3568
135 Ga0068871_100046702 3300006358 Bacteria 3489
136 Ga0068871_100047840 3300006358 Bacteria 3450
137 Ga0075428_100004442 3300006844 Bacteria 15481
138 Ga0075428_100162076 3300006844 Bacteria 2427
139 Ga0075431_100011013 3300006847 Bacteria 9103
140 Ga0075429_100004992 3300006880 Bacteria 11424
141 Ga0068865_100185382 3300006881 Bacteria 1605
142 Ga0097620_100000106 3300006931 Bacteria 78128
143 Ga0097620_100007461 3300006931 Bacteria 11100
144 Ga0097620_100013598 3300006931 Bacteria 8160
145 Ga0097620_100017266 3300006931 Bacteria 7246
146 Ga0097620_100072341 3300006931 Bacteria 3485
147 Ga0097620_100188669 3300006931 Bacteria 2145
148 Ga0097620_100394053 3300006931 Bacteria 1480
149 Ga0097620_100441050 3300006931 Bacteria 1398
150 Ga0105240_10019288 3300009093 Bacteria 9115
151 Ga0111539_10376871 3300009094 Bacteria 1652
152 Ga0105247_10000918 3300009101 Bacteria 22128
153 Ga0105247_10006091 3300009101 Bacteria 7498
154 Ga0114129_10268537 3300009147 Bacteria 2283
155 Ga0105241_10001462 3300009174 Bacteria 18113
156 Ga0105242_10005938 3300009176 Bacteria 9420
157 Ga0105242_10008165 3300009176 Bacteria 8050
158 Ga0105237_10002321 3300009545 Bacteria 23628
159 Ga0105237_10003093 3300009545 Bacteria 20049
160 Ga0105237_10019088 3300009545 Bacteria 7087
161 Ga0105249_10002137 3300009553 Bacteria 17128
162 Ga0105249_10003042 3300009553 Bacteria 14469
163 Ga0105249_10006302 3300009553 Bacteria 10308
164 Ga0105249_10042119 3300009553 Bacteria 4152
165 Ga0105239_10257595 3300010375 Bacteria 1960
166 Ga0105239_10337804 3300010375 Bacteria 1699
167 Ga0105239_10357709 3300010375 Unclassified 1648
168 Ga0105246_10139552 3300011119 Bacteria 1821
169 Ga0157373_10004894 3300013100 Bacteria 10082
170 Ga0157373_10132335 3300013100 Bacteria 1754
171 Ga0157371_10000232 3300013102 Bacteria 79717
172 Ga0157371_10000741 3300013102 Bacteria 38124
173 Ga0157371_10001331 3300013102 Bacteria 25968
174 Ga0157371_10028986 3300013102 Bacteria 4008
175 Ga0157371_10101752 3300013102 Bacteria 2038
176 Ga0157370_10000242 3300013104 Bacteria 69678
177 Ga0157370_10007303 3300013104 Bacteria 12057
178 Ga0157369_10026498 3300013105 Bacteria 6429
179 Ga0157369_10111129 3300013105 Bacteria 2913
180 Ga0157369_10377583 3300013105 Bacteria 1471
181 Ga0157374_10003727 3300013296 Bacteria 12805
182 Ga0157374_10008894 3300013296 Bacteria 8601
183 Ga0157374_10009845 3300013296 Bacteria 8203
184 Ga0157374_10024479 3300013296 Bacteria 5414
185 Ga0157374_10091145 3300013296 Unclassified 2906
186 Ga0157374_10097937 3300013296 Bacteria 2807
187 Ga0157374_10199219 3300013296 Bacteria 1960
188 Ga0157378_10004824 3300013297 Bacteria 11816
189 Ga0157378_10007368 3300013297 Bacteria 9613
190 Ga0157378_10012137 3300013297 Bacteria 7544
191 Ga0157378_10029970 3300013297 Bacteria 4804
192 Ga0157378_10123277 3300013297 Bacteria 2391
193 Ga0163162_10011449 3300013306 Bacteria 8650
194 Ga0163162_10090199 3300013306 Bacteria 3146
195 Ga0163162_10114349 3300013306 Bacteria 2798
196 Ga0163162_10168785 3300013306 Bacteria 2312
197 Ga0157372_10049053 3300013307 Bacteria 4694
198 Ga0157372_10368672 3300013307 Bacteria 1673
199 Ga0157375_10022829 3300013308 Bacteria 5763
200 Ga0157375_10029302 3300013308 Bacteria 5175
201 Ga0157375_10032468 3300013308 Bacteria 4952
202 Ga0157375_10037235 3300013308 Bacteria 4659
203 Ga0157375_10259438 3300013308 Bacteria 1899
204 Ga0163163_10000088 3300014325 Bacteria 101126
205 Ga0163163_10184986 3300014325 Bacteria 2131
206 Ga0157380_10000796 3300014326 Bacteria 19825
207 Ga0157380_10187723 3300014326 Bacteria 1822
208 Ga0157377_10050276 3300014745 Bacteria 2347
209 Ga0157379_10012914 3300014968 Bacteria 7306
210 Ga0157379_10268299 3300014968 Bacteria 1552
211 Ga0157376_10017122 3300014969 Bacteria 5521
212 Ga0163161_10016307 3300017792 Bacteria 5186
213 Ga0163161_10078942 3300017792 Bacteria 2420
214 Ga0163161_10171362 3300017792 Bacteria 1660
215 Ga0213876_10001773 3300021384 Bacteria 13075
216 Ga0207426_1000026 3300025302 Bacteria 515228
217 Ga0207697_10033506 3300025315 Bacteria 2102
218 Ga0207656_10030515 3300025321 Bacteria 2228
219 Ga0207656_10032152 3300025321 Bacteria 2178
220 Ga0207642_10007453 3300025899 Bacteria 3699
221 Ga0207710_10006684 3300025900 Bacteria 4913
222 Ga0207710_10031166 3300025900 Bacteria 2330
223 Ga0207680_10000958 3300025903 Bacteria 13597
224 Ga0207647_10018132 3300025904 Bacteria 4771
225 Ga0207647_10031308 3300025904 Bacteria 3423
226 Ga0207645_10002278 3300025907 Bacteria 15224
227 Ga0207645_10020715 3300025907 Bacteria 4300
228 Ga0207645_10149973 3300025907 Bacteria 1522
229 Ga0207643_10003128 3300025908 Bacteria 8906
230 Ga0207643_10027820 3300025908 Bacteria 3137
231 Ga0207707_10116130 3300025912 Bacteria 2339
232 Ga0207671_10007498 3300025914 Bacteria 9463
233 Ga0207660_10030214 3300025917 Bacteria 3723
234 Ga0207657_10001653 3300025919 Bacteria 24053
235 Ga0207649_10004075 3300025920 Bacteria 7952
236 Ga0207649_10124094 3300025920 Bacteria 1745
237 Ga0207652_10000029 3300025921 Bacteria 149054
238 Ga0207652_10000115 3300025921 Bacteria 87927
239 Ga0207652_10304572 3300025921 Bacteria 1438
240 Ga0207650_10199863 3300025925 Bacteria 1601
241 Ga0207650_10253989 3300025925 Bacteria 1424
242 Ga0207690_10032510 3300025932 Bacteria 3348
243 Ga0207706_10007006 3300025933 Bacteria 10420
244 Ga0207706_10011137 3300025933 Bacteria 8196
245 Ga0207706_10024985 3300025933 Bacteria 5356
246 Ga0207706_10026625 3300025933 Bacteria 5175
247 Ga0207706_10093681 3300025933 Bacteria 2641
248 Ga0207706_10102844 3300025933 Bacteria 2513
249 Ga0207706_10237140 3300025933 Bacteria 1595
250 Ga0207686_10002663 3300025934 Bacteria 9686
251 Ga0207686_10180315 3300025934 Unclassified 1497
252 Ga0207704_10133735 3300025938 Bacteria 1722
253 Ga0207691_10005078 3300025940 Bacteria 12705
254 Ga0207691_10048807 3300025940 Bacteria 3879
255 Ga0207691_10077859 3300025940 Bacteria 2986
256 Ga0207689_10000360 3300025942 Bacteria 42854
257 Ga0207689_10001010 3300025942 Bacteria 27038
258 Ga0207689_10180421 3300025942 Bacteria 1741
259 Ga0207661_10002590 3300025944 Bacteria 12431
260 Ga0207679_10258024 3300025945 Unclassified 1485
261 Ga0207679_10264564 3300025945 Bacteria 1468
262 Ga0207667_10011285 3300025949 Bacteria 10390
263 Ga0207667_10028760 3300025949 Bacteria 6034
264 Ga0207651_10012195 3300025960 Bacteria 4851
265 Ga0207651_10024667 3300025960 Bacteria 3724
266 Ga0207651_10166919 3300025960 Bacteria 1732
267 Ga0207651_10192843 3300025960 Bacteria 1627
268 Ga0207712_10001164 3300025961 Bacteria 18264
269 Ga0207712_10011368 3300025961 Bacteria 5672
270 Ga0207712_10021922 3300025961 Bacteria 4199
271 Ga0207712_10038507 3300025961 Bacteria 3270
272 Ga0207668_10115548 3300025972 Bacteria 2022
273 Ga0207668_10180729 3300025972 Bacteria 1663
274 Ga0207658_10158847 3300025986 Bacteria 1851
275 Ga0207677_10044038 3300026023 Bacteria 2970
276 Ga0207703_10001922 3300026035 Bacteria 18410
277 Ga0207639_10008635 3300026041 Bacteria 6992
278 Ga0207639_10014729 3300026041 Bacteria 5509
279 Ga0207639_10028699 3300026041 Bacteria 4065
280 Ga0207678_10056356 3300026067 Bacteria 3383
281 Ga0207708_10116732 3300026075 Bacteria 2076
282 Ga0207641_10000082 3300026088 Bacteria 138385
283 Ga0207641_10003172 3300026088 Bacteria 14709
284 Ga0207641_10018346 3300026088 Bacteria 5736
285 Ga0207641_10019559 3300026088 Bacteria 5559
286 Ga0207641_10096906 3300026088 Bacteria 2591
287 Ga0207641_10129905 3300026088 Bacteria 2261
288 Ga0207648_10001709 3300026089 Bacteria 24030
289 Ga0207648_10172377 3300026089 Bacteria 1913
290 Ga0207676_10029977 3300026095 Bacteria 4078
291 Ga0207676_10061484 3300026095 Bacteria 2974
292 Ga0207674_10005014 3300026116 Bacteria 15819
293 Ga0207674_10019675 3300026116 Bacteria 7311
294 Ga0207674_10065358 3300026116 Bacteria 3666
295 Ga0207674_10152656 3300026116 Bacteria 2266
296 Ga0207675_100001037 3300026118 Bacteria 27537
297 Ga0207675_100089254 3300026118 Bacteria 2896
298 Ga0207683_10000974 3300026121 Bacteria 26229
299 Ga0207683_10011575 3300026121 Bacteria 7532
300 Ga0207683_10210993 3300026121 Bacteria 1767
301 Ga0207698_10008386 3300026142 Bacteria 6533
302 Ga0207698_10078465 3300026142 Bacteria 2652
303 Ga0268265_10018798 3300028380 Bacteria 4794
304 Ga0268265_10080130 3300028380 Bacteria 2574
305 Ga0268265_10145638 3300028380 Bacteria 1990
306 Ga0268264_10007283 3300028381 Bacteria 9258
307 Ga0268264_10013367 3300028381 Bacteria 6755
308 Ga0268264_10022683 3300028381 Bacteria 5123
309 Ga0268264_10028427 3300028381 Bacteria 4574
310 Ga0268264_10068669 3300028381 Bacteria 2996
311 Ga0307515_10000001 3300028794 Bacteria 4259510
312 Ga0307515_10000190 3300028794 Bacteria 150300
313 Ga0265327_10000248 3300031251 Bacteria 107284
314 Ga0265327_10000452 3300031251 Bacteria 73846
315 Ga0265327_10006450 3300031251 Bacteria 9375
316 Ga0265327_10029993 3300031251 Bacteria 3083
317 Ga0307513_10059661 3300031456 Bacteria 4049
318 Ga0307509_10043396 3300031507 Bacteria 4866
319 Ga0307509_10117642 3300031507 Bacteria 2644
320 Ga0307408_100110922 3300031548 Unclassified 2107
321 Ga0307508_10004493 3300031616 Bacteria 13606
322 Ga0307407_10052665 3300031903 Unclassified 2339
323 Ga0307415_100012985 3300032126 Bacteria 4843
324 Ga0373947_0026193 3300035725 Bacteria 3406
325 Ga0373937_0009340 3300036401 Bacteria 8516
326 Ga0395899_0017114 3300037312 Bacteria 5523
327 Ga0395899_0064301 3300037312 Bacteria 2697
328 Ga0395899_0107715 3300037312 Bacteria 2005
329 Ga0395900_0002285 3300037418 Bacteria 21289
330 Ga0395900_0052792 3300037418 Bacteria 4184
331 Ga0395900_0241095 3300037418 Bacteria 1813
332 Ga0395898_0004777 3300037466 Bacteria 14740
333 Ga0395898_0040525 3300037466 Bacteria 4605
334 Ga0395898_0046113 3300037466 Bacteria 4281
335 Ga0395905_0114102 3300037471 Bacteria 2539
336 Ga0395901_0002351 3300038443 Bacteria 19230
337 Ga0395901_0063792 3300038443 Bacteria 3835
338 Ga0395901_0216050 3300038443 Bacteria 2005
339 Ga0436365_0079092 3300039437 Bacteria 37171
340 Ga0436365_0575116 3300039437 Bacteria 12036
341 Ga0439439_0020111 3300041406 Bacteria 1659
342 Ga0439461_0012881 3300041410 Bacteria 1571
343 Ga0439449_0037956 3300042007 Bacteria 1792
344 Ga0450894_001519 3300042131 Bacteria 3301
345 Ga0451577_0003822 3300042876 Bacteria 16392
346 Ga0466972_0000001 3300044658 Bacteria 412457
347 Ga0466970_0004272 3300044765 Bacteria 7034
348 Ga0495653_0015741 3300046463 Bacteria 6166
349 Ga0495618_0094667 3300046514 Bacteria 1910
350 Ga0495628_0051288 3300046516 Bacteria 3262
351 Ga0495630_0054590 3300046517 Bacteria 2993
352 Ga0495587_0068745 3300046536 Bacteria 2063
353 Ga0495668_0000257 3300046616 Bacteria 75166
354 Ga0495634_0052833 3300046642 Bacteria 2723
355 Ga0495657_0064243 3300046675 Bacteria 2419
356 Ga0496108_0099847 3300048911 Bacteria 2475
357 Ga0496110_0029754 3300048913 Bacteria 4704
358 Ga0496110_0053529 3300048913 Bacteria 3549
359 Ga0501032_0006571 3300049569 Bacteria 8539
360 Ga0501032_0034121 3300049569 Bacteria 3484
361 Ga0501033_0058342 3300049570 Bacteria 2851
362 Ga0501034_0012481 3300049571 Bacteria 8775
363 Ga0501034_0015240 3300049571 Bacteria 7900
364 Ga0501034_0069327 3300049571 Bacteria 3537
365 Ga0501036_0044598 3300049572 Bacteria 3756
366 Ga0501036_0044824 3300049572 Bacteria 3747
367 Ga0501037_0043532 3300049573 Bacteria 3299
368 Ga0501038_0014165 3300049574 Bacteria 7265
369 Ga0501038_0027154 3300049574 Bacteria 5095
370 Ga0501043_0129450 3300049579 Bacteria 1978
371 Ga0501047_0042863 3300049581 Bacteria 4372
372 Ga0501047_0075412 3300049581 Bacteria 3245
373 Ga0501069_0089211 3300049585 Bacteria 1743
374 Ga0501072_0038926 3300049588 Bacteria 3733
375 Ga0501073_0018558 3300049589 Bacteria 5028
376 Ga0501074_0023054 3300049590 Bacteria 4527
377 Ga0501080_0235473 3300049742 Bacteria 1673
378 Ga0501035_0006054 3300049822 Bacteria 11393
379 Ga0501035_0065626 3300049822 Bacteria 3223
380 Ga0501044_0172224 3300049823 Bacteria 2135
381 nmdc:mga0k408_2685_c1 3300050493 Bacteria 6636
382 nmdc:mga09592_9012_c1 3300050508 Bacteria 8112
383 Ga0500562_000053 3300053108 Bacteria 58984
384 Ga0500568_0000274 3300053139 Bacteria 43327
385 Ga0500616_0006236 3300053153 Bacteria 7865
386 Ga0500622_0003854 3300053156 Bacteria 9746
387 Ga0500611_000004 3300053727 Bacteria 253326

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025315 Ga0207697_10033506 Ga0207697_100335062 372
2 3300048913 Ga0496110_0029754 Ga0496110_0029754_3458_4672 376
3 3300041406 Ga0439439_0020111 Ga0439439_0020111_427_1632 389
4 3300013297 Ga0157378_10007368 Ga0157378_1000736811 394
5 3300005564 Ga0070664_100109106 Ga0070664_1001091062 398
6 3300026121 Ga0207683_10011575 Ga0207683_100115752 398
7 3300013306 Ga0163162_10114349 Ga0163162_101143493 401
8 3300009093 Ga0105240_10019288 Ga0105240_100192884 404
9 3300046514 Ga0495618_0094667 Ga0495618_0094667_10_1296 404
10 3300049742 Ga0501080_0235473 Ga0501080_0235473_302_1555 404
11 3300005840 Ga0068870_10037347 Ga0068870_100373471 407
12 3300005330 Ga0070690_100018071 Ga0070690_1000180714 411
13 3300005331 Ga0070670_100076846 Ga0070670_1000768462 411
14 3300005338 Ga0068868_100136165 Ga0068868_1001361652 411
15 3300005456 Ga0070678_100021447 Ga0070678_1000214474 411
16 3300005457 Ga0070662_100072138 Ga0070662_1000721382 411
17 3300005544 Ga0070686_100054956 Ga0070686_1000549562 411
18 3300005547 Ga0070693_100131926 Ga0070693_1001319261 411
19 3300005578 Ga0068854_100086010 Ga0068854_1000860101 411
20 3300013296 Ga0157374_10008894 Ga0157374_100088944 411
21 3300013308 Ga0157375_10022829 Ga0157375_100228295 411
22 3300014325 Ga0163163_10184986 Ga0163163_101849862 411
23 3300017792 Ga0163161_10016307 Ga0163161_100163073 411
24 3300025925 Ga0207650_10199863 Ga0207650_101998632 411
25 3300025933 Ga0207706_10011137 Ga0207706_100111372 411
26 3300025934 Ga0207686_10180315 Ga0207686_101803151 411
27 3300025960 Ga0207651_10192843 Ga0207651_101928431 411
28 3300005366 Ga0070659_100074542 Ga0070659_1000745422 413
29 3300025932 Ga0207690_10032510 Ga0207690_100325102 413
30 3300049571 Ga0501034_0069327 Ga0501034_0069327_2230_3507 413
31 3300049823 Ga0501044_0172224 Ga0501044_0172224_20_1297 413
32 3300013296 Ga0157374_10097937 Ga0157374_100979372 414
33 3300005329 Ga0070683_100120760 Ga0070683_1001207602 416
34 3300005337 Ga0070682_100066319 Ga0070682_1000663192 416
35 3300005338 Ga0068868_100017573 Ga0068868_1000175736 416
36 3300005339 Ga0070660_100002764 Ga0070660_10000276413 416
37 3300005344 Ga0070661_100135391 Ga0070661_1001353912 416
38 3300005354 Ga0070675_100058264 Ga0070675_1000582644 416
39 3300005366 Ga0070659_100027782 Ga0070659_1000277826 416
40 3300005457 Ga0070662_100010552 Ga0070662_1000105522 416
41 3300005530 Ga0070679_100136887 Ga0070679_1001368872 416
42 3300006358 Ga0068871_100038096 Ga0068871_1000380965 416
43 3300013100 Ga0157373_10132335 Ga0157373_101323351 416
44 3300013105 Ga0157369_10111129 Ga0157369_101111292 416
45 3300013297 Ga0157378_10012137 Ga0157378_100121375 416
46 3300025919 Ga0207657_10001653 Ga0207657_1000165317 416
47 3300025920 Ga0207649_10124094 Ga0207649_101240942 416
48 3300025933 Ga0207706_10024985 Ga0207706_100249852 416
49 3300003320 rootH2_10216978 rootH2_102169783 417
50 3300017792 Ga0163161_10171362 Ga0163161_101713621 417
51 3300026118 Ga0207675_100089254 Ga0207675_1000892542 417
52 3300005985 Ga0081539_10001169 Ga0081539_1000116951 418
53 3300014968 Ga0157379_10268299 Ga0157379_102682991 418
54 3300025933 Ga0207706_10237140 Ga0207706_102371401 418
55 3300042007 Ga0439449_0037956 Ga0439449_0037956_481_1773 418
56 3300005334 Ga0068869_100079486 Ga0068869_1000794862 419
57 3300005577 Ga0068857_100025391 Ga0068857_1000253912 420
58 3300026095 Ga0207676_10061484 Ga0207676_100614842 420
59 3300026116 Ga0207674_10019675 Ga0207674_100196752 420
60 3300031251 Ga0265327_10006450 Ga0265327_100064502 420
61 3300005844 Ga0068862_100093907 Ga0068862_1000939071 421
62 3300013105 Ga0157369_10026498 Ga0157369_100264987 421
63 3300021384 Ga0213876_10001773 Ga0213876_100017734 421
64 3300025961 Ga0207712_10011368 Ga0207712_100113684 421
65 3300026095 Ga0207676_10029977 Ga0207676_100299772 421
66 3300028380 Ga0268265_10080130 Ga0268265_100801301 421
67 3300039437 Ga0436365_0079092 Ga0436365_0079092_22668_24005 421
68 3300035725 Ga0373947_0026193 Ga0373947_0026193_970_2310 422
69 3300036401 Ga0373937_0009340 Ga0373937_0009340_5288_6628 422
70 3300046463 Ga0495653_0015741 Ga0495653_0015741_3935_5275 422
71 3300046516 Ga0495628_0051288 Ga0495628_0051288_1733_3073 422
72 3300046517 Ga0495630_0054590 Ga0495630_0054590_1411_2751 422
73 3300046536 Ga0495587_0068745 Ga0495587_0068745_386_1726 422
74 3300046642 Ga0495634_0052833 Ga0495634_0052833_1127_2467 422
75 3300046675 Ga0495657_0064243 Ga0495657_0064243_264_1604 422
76 3300005329 Ga0070683_100002536 Ga0070683_1000025362 424
77 3300005344 Ga0070661_100002636 Ga0070661_1000026369 424
78 3300005535 Ga0070684_100000097 Ga0070684_10000009714 424
79 3300005539 Ga0068853_100010492 Ga0068853_1000104924 424
80 3300005564 Ga0070664_100002153 Ga0070664_1000021534 424
81 3300005577 Ga0068857_100001948 Ga0068857_10000194815 424
82 3300025920 Ga0207649_10004075 Ga0207649_100040754 424
83 3300025944 Ga0207661_10002590 Ga0207661_100025903 424
84 3300026041 Ga0207639_10008635 Ga0207639_100086352 424
85 3300026116 Ga0207674_10005014 Ga0207674_1000501413 424
86 3300005617 Ga0068859_100072344 Ga0068859_1000723443 426
87 3300006931 Ga0097620_100072341 Ga0097620_1000723413 426
88 3300049588 Ga0501072_0038926 Ga0501072_0038926_1757_3088 426
89 iso_pu_bacteria 2914759650 2914763513 427
90 3300009101 Ga0105247_10000918 Ga0105247_1000091815 428
91 3300025900 Ga0207710_10006684 Ga0207710_100066842 428
92 3300025938 Ga0207704_10133735 Ga0207704_101337352 428
93 3300005329 Ga0070683_100010174 Ga0070683_1000101748 429
94 3300005334 Ga0068869_100000827 Ga0068869_10000082712 429
95 3300005365 Ga0070688_100053059 Ga0070688_1000530592 429
96 3300005457 Ga0070662_100095207 Ga0070662_1000952072 429
97 3300005466 Ga0070685_10083650 Ga0070685_100836501 429
98 3300005466 Ga0070685_10093187 Ga0070685_100931872 429
99 3300005535 Ga0070684_100004583 Ga0070684_1000045835 429
100 3300005543 Ga0070672_100049912 Ga0070672_1000499123 429
101 3300005564 Ga0070664_100147385 Ga0070664_1001473852 429
102 3300005617 Ga0068859_100188649 Ga0068859_1001886492 429
103 3300005617 Ga0068859_100394044 Ga0068859_1003940442 429
104 3300005618 Ga0068864_100047498 Ga0068864_1000474982 429
105 3300005618 Ga0068864_100125955 Ga0068864_1001259552 429
106 3300005841 Ga0068863_100044635 Ga0068863_1000446354 429
107 3300006358 Ga0068871_100044561 Ga0068871_1000445613 429
108 3300006931 Ga0097620_100188669 Ga0097620_1001886692 429
109 3300006931 Ga0097620_100394053 Ga0097620_1003940532 429
110 3300009176 Ga0105242_10005938 Ga0105242_100059386 429
111 3300013296 Ga0157374_10003727 Ga0157374_100037275 429
112 3300013308 Ga0157375_10259438 Ga0157375_102594382 429
113 3300014325 Ga0163163_10000088 Ga0163163_10000088100 429
114 3300014745 Ga0157377_10050276 Ga0157377_100502762 429
115 3300014969 Ga0157376_10017122 Ga0157376_100171224 429
116 3300025904 Ga0207647_10018132 Ga0207647_100181322 429
117 3300025907 Ga0207645_10020715 Ga0207645_100207153 429
118 3300025933 Ga0207706_10007006 Ga0207706_100070066 429
119 3300025934 Ga0207686_10002663 Ga0207686_100026635 429
120 3300025945 Ga0207679_10264564 Ga0207679_102645641 429
121 3300025972 Ga0207668_10115548 Ga0207668_101155482 429
122 3300025986 Ga0207658_10158847 Ga0207658_101588472 429
123 3300026067 Ga0207678_10056356 Ga0207678_100563562 429
124 3300026088 Ga0207641_10003172 Ga0207641_100031729 429
125 3300026088 Ga0207641_10018346 Ga0207641_100183462 429
126 3300048913 Ga0496110_0053529 Ga0496110_0053529_563_1903 429
127 3300005290 Ga0065712_10090935 Ga0065712_100909352 430
128 3300005340 Ga0070689_100050420 Ga0070689_1000504203 430
129 3300005719 Ga0068861_100204696 Ga0068861_1002046962 430
130 3300005843 Ga0068860_100005770 Ga0068860_1000057706 430
131 3300006195 Ga0075366_10066842 Ga0075366_100668421 430
132 3300006195 Ga0075366_10095718 Ga0075366_100957181 430
133 3300025908 Ga0207643_10027820 Ga0207643_100278202 430
134 3300026075 Ga0207708_10116732 Ga0207708_101167323 430
135 3300026116 Ga0207674_10065358 Ga0207674_100653583 430
136 3300028381 Ga0268264_10022683 Ga0268264_100226834 430
137 3300050493 nmdc:mga0k408_2685_c1 nmdc:mga0k408_2685_c1_402_1733 430
138 3300005295 Ga0065707_10117759 Ga0065707_101177591 431
139 3300005328 Ga0070676_10005918 Ga0070676_100059185 431
140 3300005329 Ga0070683_100019940 Ga0070683_1000199402 431
141 3300005329 Ga0070683_100076332 Ga0070683_1000763321 431
142 3300005331 Ga0070670_100015951 Ga0070670_1000159512 431
143 3300005331 Ga0070670_100071955 Ga0070670_1000719553 431
144 3300005331 Ga0070670_100165474 Ga0070670_1001654742 431
145 3300005334 Ga0068869_100007930 Ga0068869_1000079306 431
146 3300005334 Ga0068869_100152936 Ga0068869_1001529362 431
147 3300005335 Ga0070666_10000323 Ga0070666_1000032322 431
148 3300005335 Ga0070666_10021310 Ga0070666_100213103 431
149 3300005336 Ga0070680_100141301 Ga0070680_1001413012 431
150 3300005336 Ga0070680_100148844 Ga0070680_1001488442 431
151 3300005338 Ga0068868_100003336 Ga0068868_1000033364 431
152 3300005340 Ga0070689_100121494 Ga0070689_1001214942 431
153 3300005347 Ga0070668_100004850 Ga0070668_1000048503 431
154 3300005354 Ga0070675_100032180 Ga0070675_1000321802 431
155 3300005354 Ga0070675_100287358 Ga0070675_1002873581 431
156 3300005355 Ga0070671_100005531 Ga0070671_1000055318 431
157 3300005356 Ga0070674_100009316 Ga0070674_1000093164 431
158 3300005364 Ga0070673_100052074 Ga0070673_1000520743 431
159 3300005365 Ga0070688_100039955 Ga0070688_1000399552 431
160 3300005367 Ga0070667_100025990 Ga0070667_1000259903 431
161 3300005456 Ga0070678_100002885 Ga0070678_1000028858 431
162 3300005458 Ga0070681_10104078 Ga0070681_101040782 431
163 3300005471 Ga0070698_100002644 Ga0070698_1000026449 431
164 3300005471 Ga0070698_100008254 Ga0070698_1000082544 431
165 3300005518 Ga0070699_100157147 Ga0070699_1001571472 431
166 3300005530 Ga0070679_100018050 Ga0070679_1000180502 431
167 3300005530 Ga0070679_100268792 Ga0070679_1002687921 431
168 3300005536 Ga0070697_100195137 Ga0070697_1001951372 431
169 3300005539 Ga0068853_100051958 Ga0068853_1000519583 431
170 3300005539 Ga0068853_100067510 Ga0068853_1000675102 431
171 3300005543 Ga0070672_100002698 Ga0070672_1000026985 431
172 3300005543 Ga0070672_100144054 Ga0070672_1001440542 431
173 3300005548 Ga0070665_100010164 Ga0070665_1000101644 431
174 3300005563 Ga0068855_100008654 Ga0068855_10000865410 431
175 3300005563 Ga0068855_100339577 Ga0068855_1003395771 431
176 3300005564 Ga0070664_100025602 Ga0070664_1000256024 431
177 3300005578 Ga0068854_100085413 Ga0068854_1000854131 431
178 3300005614 Ga0068856_100013119 Ga0068856_1000131195 431
179 3300005616 Ga0068852_100007001 Ga0068852_1000070017 431
180 3300005616 Ga0068852_100315376 Ga0068852_1003153762 431
181 3300005617 Ga0068859_100000106 Ga0068859_10000010655 431
182 3300005617 Ga0068859_100007461 Ga0068859_1000074612 431
183 3300005617 Ga0068859_100013598 Ga0068859_1000135985 431
184 3300005617 Ga0068859_100017266 Ga0068859_1000172664 431
185 3300005617 Ga0068859_100441080 Ga0068859_1004410801 431
186 3300005618 Ga0068864_100021891 Ga0068864_1000218915 431
187 3300005618 Ga0068864_100023396 Ga0068864_1000233964 431
188 3300005718 Ga0068866_10005336 Ga0068866_100053363 431
189 3300005718 Ga0068866_10011364 Ga0068866_100113644 431
190 3300005834 Ga0068851_10042676 Ga0068851_100426762 431
191 3300005841 Ga0068863_100015218 Ga0068863_1000152184 431
192 3300005841 Ga0068863_100082768 Ga0068863_1000827684 431
193 3300005842 Ga0068858_100006822 Ga0068858_10000682211 431
194 3300005843 Ga0068860_100004286 Ga0068860_1000042864 431
195 3300005843 Ga0068860_100027668 Ga0068860_1000276684 431
196 3300005843 Ga0068860_100072596 Ga0068860_1000725963 431
197 3300005844 Ga0068862_100009607 Ga0068862_1000096072 431
198 3300005844 Ga0068862_100075095 Ga0068862_1000750952 431
199 3300006358 Ga0068871_100021314 Ga0068871_1000213145 431
200 3300006358 Ga0068871_100046702 Ga0068871_1000467022 431
201 3300006358 Ga0068871_100047840 Ga0068871_1000478403 431
202 3300006844 Ga0075428_100162076 Ga0075428_1001620762 431
203 3300006847 Ga0075431_100011013 Ga0075431_1000110136 431
204 3300006881 Ga0068865_100185382 Ga0068865_1001853821 431
205 3300006931 Ga0097620_100000106 Ga0097620_10000010655 431
206 3300006931 Ga0097620_100007461 Ga0097620_1000074612 431
207 3300006931 Ga0097620_100013598 Ga0097620_1000135985 431
208 3300006931 Ga0097620_100017266 Ga0097620_1000172664 431
209 3300006931 Ga0097620_100441050 Ga0097620_1004410501 431
210 3300009094 Ga0111539_10376871 Ga0111539_103768712 431
211 3300009101 Ga0105247_10006091 Ga0105247_100060911 431
212 3300009147 Ga0114129_10268537 Ga0114129_102685371 431
213 3300009174 Ga0105241_10001462 Ga0105241_1000146213 431
214 3300009545 Ga0105237_10003093 Ga0105237_1000309314 431
215 3300009545 Ga0105237_10019088 Ga0105237_100190882 431
216 3300009553 Ga0105249_10002137 Ga0105249_1000213716 431
217 3300009553 Ga0105249_10003042 Ga0105249_100030424 431
218 3300009553 Ga0105249_10042119 Ga0105249_100421194 431
219 3300010375 Ga0105239_10257595 Ga0105239_102575952 431
220 3300010375 Ga0105239_10337804 Ga0105239_103378042 431
221 3300013100 Ga0157373_10004894 Ga0157373_100048947 431
222 3300013102 Ga0157371_10000232 Ga0157371_1000023268 431
223 3300013102 Ga0157371_10000741 Ga0157371_1000074130 431
224 3300013102 Ga0157371_10001331 Ga0157371_100013313 431
225 3300013102 Ga0157371_10028986 Ga0157371_100289863 431
226 3300013102 Ga0157371_10101752 Ga0157371_101017522 431
227 3300013104 Ga0157370_10000242 Ga0157370_1000024256 431
228 3300013104 Ga0157370_10007303 Ga0157370_1000730311 431
229 3300013105 Ga0157369_10377583 Ga0157369_103775831 431
230 3300013296 Ga0157374_10009845 Ga0157374_100098452 431
231 3300013296 Ga0157374_10024479 Ga0157374_100244793 431
232 3300013296 Ga0157374_10199219 Ga0157374_101992193 431
233 3300013297 Ga0157378_10004824 Ga0157378_1000482410 431
234 3300013297 Ga0157378_10029970 Ga0157378_100299705 431
235 3300013297 Ga0157378_10123277 Ga0157378_101232772 431
236 3300013306 Ga0163162_10011449 Ga0163162_1001144910 431
237 3300013306 Ga0163162_10090199 Ga0163162_100901993 431
238 3300013306 Ga0163162_10168785 Ga0163162_101687852 431
239 3300013307 Ga0157372_10049053 Ga0157372_100490534 431
240 3300013307 Ga0157372_10368672 Ga0157372_103686722 431
241 3300013308 Ga0157375_10032468 Ga0157375_100324684 431
242 3300014326 Ga0157380_10187723 Ga0157380_101877232 431
243 3300014968 Ga0157379_10012914 Ga0157379_100129144 431
244 3300017792 Ga0163161_10078942 Ga0163161_100789422 431
245 3300025321 Ga0207656_10030515 Ga0207656_100305152 431
246 3300025321 Ga0207656_10032152 Ga0207656_100321522 431
247 3300025899 Ga0207642_10007453 Ga0207642_100074533 431
248 3300025900 Ga0207710_10031166 Ga0207710_100311662 431
249 3300025903 Ga0207680_10000958 Ga0207680_100009589 431
250 3300025904 Ga0207647_10031308 Ga0207647_100313082 431
251 3300025907 Ga0207645_10002278 Ga0207645_1000227811 431
252 3300025907 Ga0207645_10149973 Ga0207645_101499732 431
253 3300025908 Ga0207643_10003128 Ga0207643_100031284 431
254 3300025912 Ga0207707_10116130 Ga0207707_101161302 431
255 3300025914 Ga0207671_10007498 Ga0207671_100074984 431
256 3300025917 Ga0207660_10030214 Ga0207660_100302143 431
257 3300025921 Ga0207652_10000029 Ga0207652_1000002961 431
258 3300025921 Ga0207652_10000115 Ga0207652_1000011570 431
259 3300025921 Ga0207652_10304572 Ga0207652_103045721 431
260 3300025933 Ga0207706_10093681 Ga0207706_100936812 431
261 3300025940 Ga0207691_10005078 Ga0207691_100050783 431
262 3300025940 Ga0207691_10048807 Ga0207691_100488071 431
263 3300025940 Ga0207691_10077859 Ga0207691_100778592 431
264 3300025942 Ga0207689_10000360 Ga0207689_1000036023 431
265 3300025942 Ga0207689_10001010 Ga0207689_1000101022 431
266 3300025945 Ga0207679_10258024 Ga0207679_102580241 431
267 3300025949 Ga0207667_10011285 Ga0207667_100112852 431
268 3300025949 Ga0207667_10028760 Ga0207667_100287605 431
269 3300025960 Ga0207651_10012195 Ga0207651_100121952 431
270 3300025960 Ga0207651_10024667 Ga0207651_100246672 431
271 3300025961 Ga0207712_10001164 Ga0207712_100011642 431
272 3300025961 Ga0207712_10038507 Ga0207712_100385073 431
273 3300025972 Ga0207668_10180729 Ga0207668_101807291 431
274 3300026023 Ga0207677_10044038 Ga0207677_100440382 431
275 3300026035 Ga0207703_10001922 Ga0207703_1000192212 431
276 3300026041 Ga0207639_10014729 Ga0207639_100147292 431
277 3300026088 Ga0207641_10000082 Ga0207641_10000082109 431
278 3300026088 Ga0207641_10096906 Ga0207641_100969062 431
279 3300026088 Ga0207641_10129905 Ga0207641_101299052 431
280 3300026089 Ga0207648_10001709 Ga0207648_100017098 431
281 3300026121 Ga0207683_10000974 Ga0207683_100009747 431
282 3300026121 Ga0207683_10210993 Ga0207683_102109931 431
283 3300026142 Ga0207698_10008386 Ga0207698_100083863 431
284 3300026142 Ga0207698_10078465 Ga0207698_100784652 431
285 3300028380 Ga0268265_10018798 Ga0268265_100187982 431
286 3300028381 Ga0268264_10007283 Ga0268264_100072833 431
287 3300028381 Ga0268264_10013367 Ga0268264_100133672 431
288 3300028381 Ga0268264_10028427 Ga0268264_100284272 431
289 3300028381 Ga0268264_10068669 Ga0268264_100686691 431
290 3300028794 Ga0307515_10000001 Ga0307515_100000011214 431
291 3300028794 Ga0307515_10000190 Ga0307515_1000019033 431
292 3300031251 Ga0265327_10000248 Ga0265327_1000024847 431
293 3300031456 Ga0307513_10059661 Ga0307513_100596612 431
294 3300031507 Ga0307509_10043396 Ga0307509_100433962 431
295 3300031507 Ga0307509_10117642 Ga0307509_101176422 431
296 3300031616 Ga0307508_10004493 Ga0307508_100044932 431
297 3300037312 Ga0395899_0017114 Ga0395899_0017114_28_1359 431
298 3300037312 Ga0395899_0064301 Ga0395899_0064301_274_1605 431
299 3300037312 Ga0395899_0107715 Ga0395899_0107715_496_1827 431
300 3300037418 Ga0395900_0002285 Ga0395900_0002285_3207_4538 431
301 3300037418 Ga0395900_0052792 Ga0395900_0052792_2650_3981 431
302 3300037418 Ga0395900_0241095 Ga0395900_0241095_212_1543 431
303 3300037466 Ga0395898_0004777 Ga0395898_0004777_10192_11523 431
304 3300037466 Ga0395898_0040525 Ga0395898_0040525_143_1474 431
305 3300037466 Ga0395898_0046113 Ga0395898_0046113_118_1449 431
306 3300037471 Ga0395905_0114102 Ga0395905_0114102_510_1841 431
307 3300038443 Ga0395901_0002351 Ga0395901_0002351_11330_12661 431
308 3300038443 Ga0395901_0063792 Ga0395901_0063792_637_1968 431
309 3300038443 Ga0395901_0216050 Ga0395901_0216050_496_1827 431
310 3300039437 Ga0436365_0575116 Ga0436365_0575116_8761_10092 431
311 3300041410 Ga0439461_0012881 Ga0439461_0012881_38_1369 431
312 3300042131 Ga0450894_001519 Ga0450894_001519_454_1785 431
313 3300042876 Ga0451577_0003822 Ga0451577_0003822_669_2000 431
314 3300046616 Ga0495668_0000257 Ga0495668_0000257_18900_20231 431
315 3300048911 Ga0496108_0099847 Ga0496108_0099847_557_1888 431
316 3300049569 Ga0501032_0006571 Ga0501032_0006571_1550_2881 431
317 3300049569 Ga0501032_0034121 Ga0501032_0034121_31_1401 431
318 3300049570 Ga0501033_0058342 Ga0501033_0058342_811_2142 431
319 3300049571 Ga0501034_0012481 Ga0501034_0012481_7294_8625 431
320 3300049571 Ga0501034_0015240 Ga0501034_0015240_5340_6671 431
321 3300049572 Ga0501036_0044598 Ga0501036_0044598_1975_3345 431
322 3300049572 Ga0501036_0044824 Ga0501036_0044824_741_2072 431
323 3300049573 Ga0501037_0043532 Ga0501037_0043532_1295_2626 431
324 3300049574 Ga0501038_0014165 Ga0501038_0014165_1834_3165 431
325 3300049574 Ga0501038_0027154 Ga0501038_0027154_3567_4937 431
326 3300049579 Ga0501043_0129450 Ga0501043_0129450_11_1342 431
327 3300049581 Ga0501047_0042863 Ga0501047_0042863_2064_3395 431
328 3300049581 Ga0501047_0075412 Ga0501047_0075412_1065_2396 431
329 3300049589 Ga0501073_0018558 Ga0501073_0018558_1398_2729 431
330 3300049590 Ga0501074_0023054 Ga0501074_0023054_1776_3107 431
331 3300049822 Ga0501035_0006054 Ga0501035_0006054_8550_9881 431
332 3300049822 Ga0501035_0065626 Ga0501035_0065626_866_2236 431
333 3300053139 Ga0500568_0000274 Ga0500568_0000274_2652_3983 431
334 3300053153 Ga0500616_0006236 Ga0500616_0006236_6474_7820 431
335 3300003354 JGI25160J50197_1000376 JGI25160J50197_10003769 432
336 3300005337 Ga0070682_100000039 Ga0070682_10000003914 432
337 3300005539 Ga0068853_100013848 Ga0068853_1000138487 432
338 3300005841 Ga0068863_100008926 Ga0068863_1000089265 432
339 3300009553 Ga0105249_10006302 Ga0105249_100063027 432
340 3300025302 Ga0207426_1000026 Ga0207426_1000026433 432
341 3300026041 Ga0207639_10028699 Ga0207639_100286994 432
342 3300026088 Ga0207641_10019559 Ga0207641_100195595 432
343 3300031251 Ga0265327_10029993 Ga0265327_100299933 432
344 3300005293 Ga0065715_10127698 Ga0065715_101276982 433
345 3300005353 Ga0070669_100022615 Ga0070669_1000226152 433
346 3300005354 Ga0070675_100010179 Ga0070675_1000101797 433
347 3300005364 Ga0070673_100017710 Ga0070673_1000177103 433
348 3300005457 Ga0070662_100159779 Ga0070662_1001597792 433
349 3300005543 Ga0070672_100013153 Ga0070672_1000131535 433
350 3300005844 Ga0068862_100010565 Ga0068862_1000105651 433
351 3300013308 Ga0157375_10029302 Ga0157375_100293023 433
352 3300014326 Ga0157380_10000796 Ga0157380_1000079612 433
353 3300025933 Ga0207706_10102844 Ga0207706_101028443 433
354 3300025960 Ga0207651_10166919 Ga0207651_101669192 433
355 3300025961 Ga0207712_10021922 Ga0207712_100219223 433
356 3300026116 Ga0207674_10152656 Ga0207674_101526562 433
357 3300026118 Ga0207675_100001037 Ga0207675_1000010377 433
358 3300031548 Ga0307408_100110922 Ga0307408_1001109222 433
359 3300031903 Ga0307407_10052665 Ga0307407_100526654 433
360 3300032126 Ga0307415_100012985 Ga0307415_1000129853 433
361 3300044658 Ga0466972_0000001 Ga0466972_0000001_217251_218591 433
362 3300044765 Ga0466970_0004272 Ga0466970_0004272_1335_2675 433
363 3300005338 Ga0068868_100007843 Ga0068868_1000078437 434
364 3300005364 Ga0070673_100141003 Ga0070673_1001410032 434
365 3300005578 Ga0068854_100011495 Ga0068854_1000114953 434
366 3300010375 Ga0105239_10357709 Ga0105239_103577092 434
367 3300013296 Ga0157374_10091145 Ga0157374_100911452 434
368 3300013308 Ga0157375_10037235 Ga0157375_100372354 434
369 3300025933 Ga0207706_10026625 Ga0207706_100266254 434
370 3300025942 Ga0207689_10180421 Ga0207689_101804212 434
371 3300026089 Ga0207648_10172377 Ga0207648_101723772 434
372 3300049585 Ga0501069_0089211 Ga0501069_0089211_207_1580 434
373 3300053727 Ga0500611_000004 Ga0500611_000004_184982_186322 434
374 iso_pu_bacteria 2818991444 2819585923 435
375 iso_pu_bacteria 2929154850 2929159314 435
376 3300005844 Ga0068862_100054443 Ga0068862_1000544432 436
377 3300006844 Ga0075428_100004442 Ga0075428_1000044425 436
378 3300006880 Ga0075429_100004992 Ga0075429_1000049926 436
379 3300009176 Ga0105242_10008165 Ga0105242_100081657 436
380 3300011119 Ga0105246_10139552 Ga0105246_101395522 436
381 3300028380 Ga0268265_10145638 Ga0268265_101456382 436
382 3300050508 nmdc:mga09592_9012_c1 nmdc:mga09592_9012_c1_2754_4103 436
383 3300005329 Ga0070683_100172058 Ga0070683_1001720582 437
384 3300005535 Ga0070684_100138458 Ga0070684_1001384582 437
385 3300025925 Ga0207650_10253989 Ga0207650_102539891 437
386 3300031251 Ga0265327_10000452 Ga0265327_1000045238 438
387 3300009545 Ga0105237_10002321 Ga0105237_1000232113 439
388 3300053108 Ga0500562_000053 Ga0500562_000053_52010_53383 439
389 3300053156 Ga0500622_0003854 Ga0500622_0003854_108_1481 439
390 3300003320 rootH2_10046607 rootH2_100466078 440

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00206

Lyase_1

Lyase

14

316

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iem-assembly1.cif.gz_B argininosuccinate lyase from mycobacterium tuberculosis 0.8828 24 424
6iem-assembly1.cif.gz_C argininosuccinate lyase from mycobacterium tuberculosis 0.8813 24 424
6ig5-assembly1.cif.gz_A crystal structure of argininosuccinate lyase from mycobacterium tuberculosis 0.8785 24 424
6ien-assembly1.cif.gz_A substrate/product bound argininosuccinate lyase from mycobacterium tuberculosis 0.8768 26 424
6iem-assembly2.cif.gz_G argininosuccinate lyase from mycobacterium tuberculosis 0.8686 14 424
ID Description Score Start End Superfamily
af_I1JV68_161_409_1.20.200.10 Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) 0.9205 102 347 1.20.200.10
af_Q2FZU2_109_364_1.20.200.10 Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) 0.9041 102 352 1.20.200.10
af_I1JV68_161_409_1.20.200.10 Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) 0.9031 102 347 1.20.200.10
af_Q2FZU2_109_364_1.20.200.10 Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) 0.8809 102 352 1.20.200.10
af_Q2FZU2_109_446_1.20.200.10 Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) 0.8753 102 407 1.20.200.10
ID Description Score Start End GO Terms
AF-A0A1T5H2T0-F1-model_v4 Argininosuccinate lyase (EC 4.3.2.1) 0.9436 26 439 GO:0004056
GO:0005829
GO:0006526
GO:0042450
AF-A0A1T5H2T0-F1-model_v4 Argininosuccinate lyase (EC 4.3.2.1) 0.9284 26 439 GO:0004056
GO:0005829
GO:0006526
GO:0042450
AF-A0A7Y2AT48-F1-model_v4 Argininosuccinate lyase 0.9183 154 419 GO:0004056
GO:0005829
GO:0042450
AF-F6GPH7-F1-model_v4 argininosuccinate lyase (EC 4.3.2.1) 0.9145 81 203 GO:0004056
GO:0005829
GO:0006099
GO:0006526
GO:0042450
AF-A0A7Y2AT48-F1-model_v4 Argininosuccinate lyase 0.9118 154 419 GO:0004056
GO:0005829
GO:0042450

Feature Viewer

pLDDT pTM Quality
84.95 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map