F431510

General Info

Members Datasets Scaffolds Average Seq Length
389 197 778 353

Family's Representative Sequence

Representative Sequence 3300042005|Ga0439448_0000229|Ga0439448_0000229_8071_9318
Length 415
Sequence MTVQEKDGERHAERAADGQAAAMVAHLSGSSLAYPCGDRNIRSCCTKARFCALLHILSKFCITILMSSPRNVGVLGASGYAGAELLRLLARHPDLDVAWAAGDSSAGQPLVSRYPGLRAAYGDLTFCSVDEGLEKGADVLFCALPHGRAAQIAPRALATAGLVVDLSADFRLRDPSAYPTWYGAEHPFPDQLATWPYGLPELHREELRGATRVAVPGCYPTAALLALAPLVAAGLAATEGIVVDAKSGLSGAGRSLTDGNLFVQANENVGPYKVGTHRHTPEIEQELALAAGAPVTVTFTPHLVPASRGLLATCYATLAPAAGDEELAGCYAAAYGEEPFIDLLDPGQGWPATRAVVTTNRVQVAAAADRRAGRVXXXXAIDNLVKGAAGQAVQCANLALGLEETAGLELVPPGP

Samples

Sample ID Description Type Environment
1 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
89 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
90 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
102 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
103 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
104 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
105 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
106 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
107 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
108 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
109 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
110 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
111 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
155 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
156 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
157 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
158 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
159 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
160 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
166 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
190 2508501039 Frankia saprophytica CN3 Isolate Nodule
191 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
192 2687453737 Frankia sp. BMG5.36 Isolate Nodule
193 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
194 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
195 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
196 8002784119 Frankia sp. AgB1.9 Isolate Nodule
197 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 0.26
Isolates 2.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.83
Nodule 1.29
Rhizoplane 1.03
Rhizosphere 91.52
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439448_0000229 3300042005 Bacteria 11932
2 JGI25407J50210_10002413 3300003373 Bacteria 4393
3 JGI25407J50210_10006856 3300003373 Bacteria 2845
4 JGI25407J50210_10015157 3300003373 Bacteria 1989
5 Ga0070658_10092655 3300005327 Bacteria 2491
6 Ga0070683_100009287 3300005329 Bacteria 8404
7 Ga0070683_100083268 3300005329 Bacteria 2996
8 Ga0070680_100121103 3300005336 Bacteria 2184
9 Ga0070691_10005178 3300005341 Bacteria 5927
10 Ga0070661_100057196 3300005344 Bacteria 2858
11 Ga0070714_100132017 3300005435 Bacteria 2232
12 Ga0070713_100015080 3300005436 Bacteria 5759
13 Ga0070708_100003397 3300005445 Bacteria 12470
14 Ga0070708_100080185 3300005445 Bacteria 2954
15 Ga0070662_100003713 3300005457 Bacteria 9549
16 Ga0070706_100000133 3300005467 Bacteria 92343
17 Ga0070706_100043203 3300005467 Bacteria 4164
18 Ga0070707_100240314 3300005468 Bacteria 1763
19 Ga0070698_100002782 3300005471 Bacteria 19251
20 Ga0070698_100026304 3300005471 Bacteria 6058
21 Ga0070698_100059634 3300005471 Bacteria 3853
22 Ga0070698_100289085 3300005471 Bacteria 1570
23 Ga0070699_100036607 3300005518 Bacteria 4245
24 Ga0070699_100222873 3300005518 Bacteria 1681
25 Ga0070684_100004333 3300005535 Bacteria 10783
26 Ga0070684_100064585 3300005535 Bacteria 3211
27 Ga0068855_100145551 3300005563 Bacteria 2698
28 Ga0068855_100489468 3300005563 Bacteria 1338
29 Ga0068857_100000377 3300005577 Bacteria 31241
30 Ga0068856_100001262 3300005614 Bacteria 26636
31 Ga0068859_100002262 3300005617 Bacteria 19531
32 Ga0068859_100025324 3300005617 Bacteria 5952
33 Ga0068858_100007480 3300005842 Bacteria 10560
34 Ga0068862_100000021 3300005844 Bacteria 218035
35 Ga0081455_10001638 3300005937 Bacteria 27270
36 Ga0081455_10001905 3300005937 Bacteria 25082
37 Ga0081455_10003532 3300005937 Bacteria 17936
38 Ga0081455_10091060 3300005937 Bacteria 2471
39 Ga0081455_10161219 3300005937 Bacteria 1719
40 Ga0081538_10000348 3300005981 Bacteria 52698
41 Ga0081538_10000483 3300005981 Bacteria 44726
42 Ga0081538_10002387 3300005981 Bacteria 18443
43 Ga0081538_10002990 3300005981 Bacteria 16112
44 Ga0081538_10003392 3300005981 Bacteria 15076
45 Ga0081538_10003428 3300005981 Bacteria 14995
46 Ga0081538_10003514 3300005981 Bacteria 14770
47 Ga0081538_10008022 3300005981 Bacteria 9027
48 Ga0081538_10014690 3300005981 Bacteria 6113
49 Ga0081538_10028611 3300005981 Bacteria 3828
50 Ga0081538_10045981 3300005981 Bacteria 2699
51 Ga0081538_10049134 3300005981 Bacteria 2562
52 Ga0081540_1078348 3300005983 Bacteria 1498
53 Ga0081539_10001752 3300005985 Bacteria 34618
54 Ga0081539_10085491 3300005985 Bacteria 1645
55 Ga0081539_10093211 3300005985 Bacteria 1552
56 Ga0075365_10009918 3300006038 Bacteria 5514
57 Ga0075365_10220478 3300006038 Bacteria 1330
58 Ga0075363_100026868 3300006048 Bacteria 2948
59 Ga0075364_10011140 3300006051 Bacteria 5459
60 Ga0075362_10110563 3300006177 Bacteria 1293
61 Ga0075428_100023203 3300006844 Bacteria 6863
62 Ga0075428_100029755 3300006844 Bacteria 6042
63 Ga0075428_100110389 3300006844 Bacteria 2996
64 Ga0075428_100299980 3300006844 Bacteria 1727
65 Ga0075430_100015041 3300006846 Bacteria 6586
66 Ga0075430_100219444 3300006846 Bacteria 1578
67 Ga0075430_100223297 3300006846 Bacteria 1563
68 Ga0075431_100023263 3300006847 Bacteria 6339
69 Ga0075431_100097772 3300006847 Bacteria 3031
70 Ga0075431_100113564 3300006847 Bacteria 2796
71 Ga0075431_100144723 3300006847 Bacteria 2449
72 Ga0075433_10294375 3300006852 Bacteria 1438
73 Ga0075434_100001003 3300006871 Bacteria 22920
74 Ga0075434_100058582 3300006871 Bacteria 3828
75 Ga0075429_100030103 3300006880 Bacteria 4716
76 Ga0075429_100032044 3300006880 Bacteria 4569
77 Ga0075429_100088570 3300006880 Bacteria 2698
78 Ga0075436_100020927 3300006914 Bacteria 4486
79 Ga0097620_100002262 3300006931 Bacteria 19531
80 Ga0097620_100025324 3300006931 Bacteria 5952
81 Ga0075435_100000651 3300007076 Bacteria 21343
82 Ga0075435_100029002 3300007076 Bacteria 4343
83 Ga0111539_10001958 3300009094 Bacteria 27479
84 Ga0111539_10010953 3300009094 Bacteria 11414
85 Ga0111539_10108726 3300009094 Bacteria 3254
86 Ga0111539_10194724 3300009094 Bacteria 2364
87 Ga0111539_10233754 3300009094 Bacteria 2140
88 Ga0111539_10509313 3300009094 Bacteria 1402
89 Ga0105245_10006854 3300009098 Bacteria 9992
90 Ga0114129_10052943 3300009147 Bacteria 5695
91 Ga0114129_10055129 3300009147 Bacteria 5572
92 Ga0114129_10148216 3300009147 Bacteria 3213
93 Ga0114129_10172336 3300009147 Bacteria 2949
94 Ga0114129_10264639 3300009147 Bacteria 2303
95 Ga0114129_10337257 3300009147 Bacteria 2000
96 Ga0114129_10363189 3300009147 Bacteria 1915
97 Ga0105248_10008126 3300009177 Bacteria 11521
98 Ga0105238_10098346 3300009551 Bacteria 2910
99 Ga0105249_10058469 3300009553 Bacteria 3533
100 Ga0105249_10060547 3300009553 Bacteria 3473
101 Ga0157369_10037838 3300013105 Bacteria 5280
102 Ga0163162_10056608 3300013306 Bacteria 3949
103 Ga0163163_10003743 3300014325 Bacteria 12948
104 Ga0206354_11296694 3300020081 Bacteria 2956
105 Ga0213876_10009986 3300021384 Bacteria 5101
106 Ga0213876_10085235 3300021384 Bacteria 1672
107 Ga0207684_10000431 3300025910 Bacteria 55647
108 Ga0207684_10019830 3300025910 Bacteria 5750
109 Ga0207684_10178581 3300025910 Bacteria 1830
110 Ga0207707_10315334 3300025912 Bacteria 1351
111 Ga0207707_10368804 3300025912 Bacteria 1236
112 Ga0207652_10140089 3300025921 Bacteria 2162
113 Ga0207652_10238746 3300025921 Bacteria 1638
114 Ga0207687_10001526 3300025927 Bacteria 15874
115 Ga0207700_10019033 3300025928 Bacteria 4630
116 Ga0207664_10022086 3300025929 Bacteria 4744
117 Ga0207706_10002964 3300025933 Bacteria 16377
118 Ga0207711_10004436 3300025941 Bacteria 11961
119 Ga0207661_10002661 3300025944 Bacteria 12295
120 Ga0207667_10270600 3300025949 Bacteria 1737
121 Ga0207712_10023720 3300025961 Bacteria 4053
122 Ga0207668_10378452 3300025972 Bacteria 1191
123 Ga0207678_10002354 3300026067 Bacteria 17155
124 Ga0207702_10000489 3300026078 Bacteria 44584
125 Ga0207674_10000612 3300026116 Bacteria 46825
126 Ga0207675_100000608 3300026118 Bacteria 34919
127 Ga0209974_10020198 3300027876 Bacteria 2208
128 Ga0207428_10001246 3300027907 Bacteria 27282
129 Ga0207428_10003089 3300027907 Bacteria 16386
130 Ga0268265_10000034 3300028380 Bacteria 218695
131 Ga0307515_10021795 3300028794 Bacteria 11336
132 Ga0307515_10224059 3300028794 Bacteria 1690
133 Ga0265327_10003608 3300031251 Bacteria 14581
134 Ga0265316_10132120 3300031344 Bacteria 1880
135 Ga0307513_10052299 3300031456 Bacteria 4399
136 Ga0307408_100005593 3300031548 Bacteria 8402
137 Ga0307408_100093577 3300031548 Bacteria 2274
138 Ga0316578_10036555 3300031728 Bacteria 2826
139 Ga0307516_10032588 3300031730 Bacteria 5246
140 Ga0307405_10002436 3300031731 Bacteria 8201
141 Ga0307405_10004843 3300031731 Bacteria 6422
142 Ga0307405_10072796 3300031731 Bacteria 2216
143 Ga0307405_10235339 3300031731 Bacteria 1353
144 Ga0307413_10018737 3300031824 Bacteria 3639
145 Ga0307413_10024157 3300031824 Bacteria 3309
146 Ga0307413_10075504 3300031824 Bacteria 2140
147 Ga0307413_10107330 3300031824 Bacteria 1860
148 Ga0307410_10029278 3300031852 Bacteria 3505
149 Ga0307410_10162580 3300031852 Bacteria 1674
150 Ga0307406_10001445 3300031901 Bacteria 13130
151 Ga0307406_10024722 3300031901 Bacteria 3590
152 Ga0307406_10028602 3300031901 Bacteria 3369
153 Ga0307406_10045372 3300031901 Bacteria 2759
154 Ga0307407_10000611 3300031903 Bacteria 11393
155 Ga0307407_10019857 3300031903 Bacteria 3429
156 Ga0307407_10028789 3300031903 Bacteria 2975
157 Ga0307407_10073699 3300031903 Bacteria 2041
158 Ga0307407_10094282 3300031903 Bacteria 1842
159 Ga0307412_10006002 3300031911 Bacteria 6846
160 Ga0307412_10013991 3300031911 Bacteria 4723
161 Ga0307409_100000716 3300031995 Bacteria 14804
162 Ga0307409_100019621 3300031995 Bacteria 4583
163 Ga0307409_100022730 3300031995 Bacteria 4327
164 Ga0307409_100110599 3300031995 Bacteria 2303
165 Ga0307409_100258283 3300031995 Bacteria 1597
166 Ga0307416_100007500 3300032002 Bacteria 6944
167 Ga0307416_100014079 3300032002 Bacteria 5462
168 Ga0307416_100015141 3300032002 Bacteria 5313
169 Ga0307416_100030299 3300032002 Bacteria 4057
170 Ga0307416_100115334 3300032002 Bacteria 2378
171 Ga0307416_100127389 3300032002 Bacteria 2283
172 Ga0307416_100155740 3300032002 Bacteria 2103
173 Ga0307414_10021155 3300032004 Bacteria 4074
174 Ga0307411_10008051 3300032005 Bacteria 5430
175 Ga0307411_10060810 3300032005 Bacteria 2511
176 Ga0307411_10063766 3300032005 Bacteria 2464
177 Ga0307415_100000571 3300032126 Bacteria 16178
178 Ga0307415_100001139 3300032126 Bacteria 12416
179 Ga0307415_100002152 3300032126 Bacteria 9763
180 Ga0307415_100006420 3300032126 Bacteria 6339
181 Ga0307415_100013736 3300032126 Bacteria 4736
182 Ga0307415_100058379 3300032126 Bacteria 2656
183 Ga0307415_100146439 3300032126 Bacteria 1811
184 Ga0307415_100159529 3300032126 Bacteria 1746
185 Ga0307415_100192993 3300032126 Bacteria 1609
186 Ga0307415_100262484 3300032126 Bacteria 1410
187 Ga0373930_0007173 3300034816 Bacteria 1910
188 Ga0373932_0001195 3300035112 Bacteria 7432
189 Ga0373932_0012815 3300035112 Bacteria 2072
190 Ga0373931_0000001 3300035691 Bacteria 634029
191 Ga0373931_0000019 3300035691 Bacteria 186534
192 Ga0373947_0025791 3300035725 Bacteria 3429
193 Ga0373937_0014953 3300036401 Bacteria 6855
194 Ga0316582_0017672 3300036647 Bacteria 4132
195 Ga0395899_0056009 3300037312 Bacteria 2915
196 Ga0395905_0226810 3300037471 Bacteria 1747
197 Ga0395905_0468371 3300037471 Bacteria 1159
198 Ga0395901_0131295 3300038443 Bacteria 2632
199 Ga0395901_0184167 3300038443 Bacteria 2190
200 Ga0400483_095142 3300039062 Bacteria 1425
201 Ga0436365_0335276 3300039437 Bacteria 15633
202 Ga0436365_1853199 3300039437 Bacteria 4406
203 Ga0436362_0131236 3300039453 Bacteria 9544
204 Ga0436362_0801506 3300039453 Bacteria 1510
205 Ga0436362_0917221 3300039453 Bacteria 1419
206 Ga0451853_2763930 3300041512 Bacteria 1962
207 Ga0439443_004221 3300042003 Bacteria 1859
208 Ga0439443_010118 3300042003 Bacteria 1363
209 Ga0439448_0006943 3300042005 Bacteria 3266
210 Ga0439450_002446 3300042008 Bacteria 2921
211 Ga0439451_023169 3300042009 Bacteria 1251
212 Ga0439455_0008128 3300042012 Bacteria 2242
213 Ga0439463_000233 3300042016 Bacteria 15428
214 Ga0439463_008388 3300042016 Bacteria 2548
215 Ga0439463_008770 3300042016 Bacteria 2490
216 Ga0450905_002581 3300042142 Bacteria 2333
217 Ga0439464_0006632 3300042439 Bacteria 3020
218 Ga0439460_0011713 3300042461 Bacteria 2265
219 Ga0439460_0020383 3300042461 Bacteria 1802
220 Ga0450916_000406 3300042530 Bacteria 3660
221 Ga0439440_0000049 3300042993 Bacteria 14931
222 Ga0453683_0024996 3300044673 Bacteria 3796
223 Ga0451576_0005575 3300045051 Bacteria 15725
224 Ga0495651_0044796 3300046462 Bacteria 3428
225 Ga0495653_0073923 3300046463 Bacteria 2542
226 Ga0495639_0052647 3300046475 Bacteria 1854
227 Ga0495583_0087598 3300046506 Bacteria 1345
228 Ga0495608_0011225 3300046511 Bacteria 6235
229 Ga0495631_0063771 3300046518 Bacteria 1596
230 Ga0495667_0013643 3300046559 Bacteria 5493
231 Ga0495656_0086726 3300046615 Bacteria 1424
232 Ga0495635_0134387 3300046663 Bacteria 1686
233 Ga0495657_0002077 3300046675 Bacteria 17014
234 Ga0495623_0003724 3300046679 Bacteria 10052
235 Ga0495600_0006417 3300046809 Bacteria 7159
236 Ga0495674_0045958 3300047319 Bacteria 3877
237 Ga0495672_0006428 3300047320 Bacteria 9104
238 Ga0495675_0136560 3300047444 Bacteria 1522
239 Ga0496102_0037963 3300048905 Bacteria 4345
240 Ga0496102_0142527 3300048905 Bacteria 2247
241 Ga0496112_0006060 3300048915 Bacteria 10563
242 Ga0496115_0139226 3300048918 Bacteria 2002
243 Ga0496121_0028696 3300048924 Bacteria 5174
244 Ga0501293_001774 3300049516 Bacteria 1622
245 Ga0501031_0000371 3300049568 Bacteria 26311
246 Ga0501031_0000395 3300049568 Bacteria 25501
247 Ga0501033_0002791 3300049570 Bacteria 14640
248 Ga0501033_0056410 3300049570 Bacteria 2903
249 Ga0501033_0065171 3300049570 Bacteria 2680
250 Ga0501036_0000784 3300049572 Bacteria 23531
251 Ga0501036_0005590 3300049572 Bacteria 10198
252 Ga0501037_0006484 3300049573 Bacteria 8558
253 Ga0501037_0066534 3300049573 Bacteria 2625
254 Ga0501038_0002071 3300049574 Bacteria 18568
255 Ga0501038_0009863 3300049574 Bacteria 8741
256 Ga0501038_0075489 3300049574 Bacteria 2849
257 Ga0501039_0001465 3300049575 Bacteria 17353
258 Ga0501039_0002303 3300049575 Bacteria 14171
259 Ga0501039_0004662 3300049575 Bacteria 10368
260 Ga0501040_0000353 3300049576 Bacteria 26979
261 Ga0501040_0000463 3300049576 Bacteria 24102
262 Ga0501040_0024073 3300049576 Bacteria 4085
263 Ga0501040_0046568 3300049576 Bacteria 2960
264 Ga0501041_0001111 3300049577 Bacteria 14750
265 Ga0501041_0003585 3300049577 Bacteria 8926
266 Ga0501041_0063713 3300049577 Bacteria 2257
267 Ga0501041_0099040 3300049577 Bacteria 1803
268 Ga0501042_0005116 3300049578 Bacteria 8416
269 Ga0501042_0010552 3300049578 Bacteria 6200
270 Ga0501042_0020441 3300049578 Bacteria 4608
271 Ga0501042_0177670 3300049578 Bacteria 1535
272 Ga0501043_0027980 3300049579 Bacteria 4424
273 Ga0501043_0049023 3300049579 Bacteria 3320
274 Ga0501043_0051303 3300049579 Bacteria 3241
275 Ga0501046_0000497 3300049580 Bacteria 39185
276 Ga0501046_0000980 3300049580 Bacteria 27880
277 Ga0501046_0099583 3300049580 Bacteria 2231
278 Ga0501047_0008000 3300049581 Bacteria 9970
279 Ga0501047_0113241 3300049581 Bacteria 2595
280 Ga0501048_0002222 3300049582 Bacteria 14781
281 Ga0501048_0002550 3300049582 Bacteria 13936
282 Ga0501048_0109101 3300049582 Bacteria 1954
283 Ga0501068_0114844 3300049584 Bacteria 1676
284 Ga0501071_0001514 3300049587 Bacteria 13516
285 Ga0501071_0022224 3300049587 Bacteria 4421
286 Ga0501071_0027977 3300049587 Bacteria 3969
287 Ga0501071_0070566 3300049587 Bacteria 2545
288 Ga0501072_0000624 3300049588 Bacteria 25425
289 Ga0501072_0016693 3300049588 Bacteria 5640
290 Ga0501072_0026943 3300049588 Bacteria 4485
291 Ga0501072_0080571 3300049588 Bacteria 2580
292 Ga0501073_0101807 3300049589 Bacteria 1995
293 Ga0501073_0106288 3300049589 Bacteria 1948
294 Ga0501074_0001029 3300049590 Bacteria 18142
295 Ga0501074_0003362 3300049590 Bacteria 11334
296 Ga0501074_0004741 3300049590 Bacteria 9749
297 Ga0501074_0167762 3300049590 Bacteria 1567
298 Ga0501075_0000374 3300049591 Bacteria 25760
299 Ga0501075_0001860 3300049591 Bacteria 13929
300 Ga0501075_0011475 3300049591 Bacteria 6271
301 Ga0501075_0050378 3300049591 Bacteria 3130
302 Ga0501076_0000889 3300049592 Bacteria 19433
303 Ga0501076_0000976 3300049592 Bacteria 18735
304 Ga0501076_0009969 3300049592 Bacteria 7024
305 Ga0501076_0079716 3300049592 Bacteria 2627
306 Ga0501076_0236494 3300049592 Unclassified 1494
307 Ga0501077_0000790 3300049593 Bacteria 19157
308 Ga0501077_0004068 3300049593 Bacteria 8829
309 Ga0501077_0014309 3300049593 Bacteria 4984
310 Ga0501206_000361 3300049653 Bacteria 5399
311 Ga0501235_001680 3300049669 Bacteria 4744
312 Ga0501248_000705 3300049678 Bacteria 1901
313 Ga0501249_000454 3300049679 Bacteria 10204
314 Ga0501251_000026 3300049681 Bacteria 12018
315 Ga0501261_005973 3300049690 Unclassified 1543
316 Ga0501221_016704 3300049704 Unclassified 1392
317 Ga0501079_0000353 3300049741 Bacteria 29399
318 Ga0501079_0002473 3300049741 Bacteria 13418
319 Ga0501079_0059767 3300049741 Bacteria 2940
320 Ga0501080_0037280 3300049742 Bacteria 4540
321 Ga0501080_0095533 3300049742 Bacteria 2760
322 Ga0501081_0001844 3300049743 Bacteria 13143
323 Ga0501081_0005560 3300049743 Bacteria 8138
324 Ga0501081_0040218 3300049743 Bacteria 3201
325 Ga0501083_0099488 3300049744 Bacteria 1918
326 Ga0501264_000887 3300049761 Bacteria 3828
327 Ga0501271_000678 3300049768 Bacteria 2908
328 Ga0501035_0008853 3300049822 Bacteria 9365
329 Ga0501044_0002701 3300049823 Bacteria 20159
330 Ga0501044_0252509 3300049823 Bacteria 1704
331 Ga0501045_0000935 3300049824 Bacteria 19079
332 Ga0501045_0001284 3300049824 Bacteria 16672
333 Ga0501045_0003077 3300049824 Bacteria 11410
334 Ga0501045_0004345 3300049824 Bacteria 9767
335 nmdc:mga00v17_18085_c1 3300050491 Bacteria 4000
336 nmdc:mga0yw44_1308_c1 3300050492 Bacteria 9832
337 nmdc:mga0yw44_96354_c1 3300050492 Bacteria 1878
338 nmdc:mga05p37_117791_c1 3300050507 Bacteria 3263
339 nmdc:mga05p37_200067_c1 3300050507 Bacteria 2420
340 nmdc:mga05p37_25670_c1 3300050507 Bacteria 7167
341 nmdc:mga05p37_36370_c1 3300050507 Bacteria 6041
342 nmdc:mga09592_10923_c1 3300050508 Bacteria 7390
343 nmdc:mga09592_13556_c1 3300050508 Bacteria 6658
344 nmdc:mga09592_207416_c1 3300050508 Bacteria 1697
345 nmdc:mga0qj67_151181_c1 3300050509 Bacteria 1884
346 nmdc:mga0qj67_224260_c1 3300050509 Bacteria 1526
347 nmdc:mga0qj67_66223_c1 3300050509 Bacteria 2877
348 nmdc:mga06r32_114702_c1 3300050510 Bacteria 2653
349 nmdc:mga06r32_165726_c1 3300050510 Bacteria 2193
350 nmdc:mga06r32_179765_c1 3300050510 Bacteria 2101
351 nmdc:mga06r32_42154_c1 3300050510 Bacteria 4339
352 nmdc:mga08y16_1351_c1 3300050511 Bacteria 24476
353 nmdc:mga08y16_222613_c1 3300050511 Bacteria 1953
354 nmdc:mga08y16_449852_c1 3300050511 Bacteria 1313
355 nmdc:mga0n895_12397_c1 3300050512 Bacteria 7647
356 nmdc:mga0n895_12701_c1 3300050512 Bacteria 7563
357 nmdc:mga0rr50_202923_c1 3300050513 Bacteria 1630
358 nmdc:mga08x19_31327_c1 3300050514 Bacteria 3345
359 nmdc:mga0a205_23755_c1 3300050515 Bacteria 5817
360 nmdc:mga0a205_374_c1 3300050515 Bacteria 33860
361 nmdc:mga0a205_4984_c1 3300050515 Bacteria 11945
362 Ga0495601_0035939 3300053077 Bacteria 3094
363 Ga0495595_0013650 3300053084 Bacteria 3434
364 Ga0495619_0109202 3300053085 Bacteria 1889
365 Ga0500566_0005354 3300053094 Bacteria 7628
366 Ga0500616_0003515 3300053153 Bacteria 11899
367 Ga0500616_0027996 3300053153 Bacteria 3109
368 Ga0501084_0001830 3300054114 Bacteria 16956
369 Ga0501084_0002286 3300054114 Bacteria 15388
370 Ga0501084_0005380 3300054114 Bacteria 10493
371 Ga0501084_0008030 3300054114 Bacteria 8689
372 Ga0501084_0020618 3300054114 Bacteria 5497
373 Ga0501084_0153675 3300054114 Bacteria 1940
374 Ga0590075_001789 3300059424 Bacteria 5259
375 Ga0501082_0000150 3300060353 Bacteria 58294
376 Ga0501082_0001064 3300060353 Bacteria 24326
377 Ga0501082_0086460 3300060353 Bacteria 2704
378 Ga0530510_0000575 3300061734 Bacteria 23685
379 Ga0530510_0002416 3300061734 Bacteria 12865
380 Ga0530510_0007154 3300061734 Bacteria 7764
381 Ga0530510_0010121 3300061734 Bacteria 6611
382 2508678202 2508501039 Bacteria 9978592
383 2676201703 2675902999 Bacteria 9438463
384 2689956228 2687453737 Bacteria 11203906
385 2774846279 2773857921 Bacteria 9435764
386 2861527637 2861520306 Bacteria 8348283
387 2899363060 2899359706 Bacteria 10940472
388 8002788587 8002784119 Bacteria 9788632
389 8057568523 8057568493 Bacteria 7221719
390 Ga0439448_0000229
391 JGI25407J50210_10002413
392 JGI25407J50210_10006856
393 JGI25407J50210_10015157
394 Ga0070658_10092655
395 Ga0070683_100009287
396 Ga0070683_100083268
397 Ga0070680_100121103
398 Ga0070691_10005178
399 Ga0070661_100057196
400 Ga0070714_100132017
401 Ga0070713_100015080
402 Ga0070708_100003397
403 Ga0070708_100080185
404 Ga0070662_100003713
405 Ga0070706_100000133
406 Ga0070706_100043203
407 Ga0070707_100240314
408 Ga0070698_100002782
409 Ga0070698_100026304
410 Ga0070698_100059634
411 Ga0070698_100289085
412 Ga0070699_100036607
413 Ga0070699_100222873
414 Ga0070684_100004333
415 Ga0070684_100064585
416 Ga0068855_100145551
417 Ga0068855_100489468
418 Ga0068857_100000377
419 Ga0068856_100001262
420 Ga0068859_100002262
421 Ga0068859_100025324
422 Ga0068858_100007480
423 Ga0068862_100000021
424 Ga0081455_10001638
425 Ga0081455_10001905
426 Ga0081455_10003532
427 Ga0081455_10091060
428 Ga0081455_10161219
429 Ga0081538_10000348
430 Ga0081538_10000483
431 Ga0081538_10002387
432 Ga0081538_10002990
433 Ga0081538_10003392
434 Ga0081538_10003428
435 Ga0081538_10003514
436 Ga0081538_10008022
437 Ga0081538_10014690
438 Ga0081538_10028611
439 Ga0081538_10045981
440 Ga0081538_10049134
441 Ga0081540_1078348
442 Ga0081539_10001752
443 Ga0081539_10085491
444 Ga0081539_10093211
445 Ga0075365_10009918
446 Ga0075365_10220478
447 Ga0075363_100026868
448 Ga0075364_10011140
449 Ga0075362_10110563
450 Ga0075428_100023203
451 Ga0075428_100029755
452 Ga0075428_100110389
453 Ga0075428_100299980
454 Ga0075430_100015041
455 Ga0075430_100219444
456 Ga0075430_100223297
457 Ga0075431_100023263
458 Ga0075431_100097772
459 Ga0075431_100113564
460 Ga0075431_100144723
461 Ga0075433_10294375
462 Ga0075434_100001003
463 Ga0075434_100058582
464 Ga0075429_100030103
465 Ga0075429_100032044
466 Ga0075429_100088570
467 Ga0075436_100020927
468 Ga0097620_100002262
469 Ga0097620_100025324
470 Ga0075435_100000651
471 Ga0075435_100029002
472 Ga0111539_10001958
473 Ga0111539_10010953
474 Ga0111539_10108726
475 Ga0111539_10194724
476 Ga0111539_10233754
477 Ga0111539_10509313
478 Ga0105245_10006854
479 Ga0114129_10052943
480 Ga0114129_10055129
481 Ga0114129_10148216
482 Ga0114129_10172336
483 Ga0114129_10264639
484 Ga0114129_10337257
485 Ga0114129_10363189
486 Ga0105248_10008126
487 Ga0105238_10098346
488 Ga0105249_10058469
489 Ga0105249_10060547
490 Ga0157369_10037838
491 Ga0163162_10056608
492 Ga0163163_10003743
493 Ga0206354_11296694
494 Ga0213876_10009986
495 Ga0213876_10085235
496 Ga0207684_10000431
497 Ga0207684_10019830
498 Ga0207684_10178581
499 Ga0207707_10315334
500 Ga0207707_10368804
501 Ga0207652_10140089
502 Ga0207652_10238746
503 Ga0207687_10001526
504 Ga0207700_10019033
505 Ga0207664_10022086
506 Ga0207706_10002964
507 Ga0207711_10004436
508 Ga0207661_10002661
509 Ga0207667_10270600
510 Ga0207712_10023720
511 Ga0207668_10378452
512 Ga0207678_10002354
513 Ga0207702_10000489
514 Ga0207674_10000612
515 Ga0207675_100000608
516 Ga0209974_10020198
517 Ga0207428_10001246
518 Ga0207428_10003089
519 Ga0268265_10000034
520 Ga0307515_10021795
521 Ga0307515_10224059
522 Ga0265327_10003608
523 Ga0265316_10132120
524 Ga0307513_10052299
525 Ga0307408_100005593
526 Ga0307408_100093577
527 Ga0316578_10036555
528 Ga0307516_10032588
529 Ga0307405_10002436
530 Ga0307405_10004843
531 Ga0307405_10072796
532 Ga0307405_10235339
533 Ga0307413_10018737
534 Ga0307413_10024157
535 Ga0307413_10075504
536 Ga0307413_10107330
537 Ga0307410_10029278
538 Ga0307410_10162580
539 Ga0307406_10001445
540 Ga0307406_10024722
541 Ga0307406_10028602
542 Ga0307406_10045372
543 Ga0307407_10000611
544 Ga0307407_10019857
545 Ga0307407_10028789
546 Ga0307407_10073699
547 Ga0307407_10094282
548 Ga0307412_10006002
549 Ga0307412_10013991
550 Ga0307409_100000716
551 Ga0307409_100019621
552 Ga0307409_100022730
553 Ga0307409_100110599
554 Ga0307409_100258283
555 Ga0307416_100007500
556 Ga0307416_100014079
557 Ga0307416_100015141
558 Ga0307416_100030299
559 Ga0307416_100115334
560 Ga0307416_100127389
561 Ga0307416_100155740
562 Ga0307414_10021155
563 Ga0307411_10008051
564 Ga0307411_10060810
565 Ga0307411_10063766
566 Ga0307415_100000571
567 Ga0307415_100001139
568 Ga0307415_100002152
569 Ga0307415_100006420
570 Ga0307415_100013736
571 Ga0307415_100058379
572 Ga0307415_100146439
573 Ga0307415_100159529
574 Ga0307415_100192993
575 Ga0307415_100262484
576 Ga0373930_0007173
577 Ga0373932_0001195
578 Ga0373932_0012815
579 Ga0373931_0000001
580 Ga0373931_0000019
581 Ga0373947_0025791
582 Ga0373937_0014953
583 Ga0316582_0017672
584 Ga0395899_0056009
585 Ga0395905_0226810
586 Ga0395905_0468371
587 Ga0395901_0131295
588 Ga0395901_0184167
589 Ga0400483_095142
590 Ga0436365_0335276
591 Ga0436365_1853199
592 Ga0436362_0131236
593 Ga0436362_0801506
594 Ga0436362_0917221
595 Ga0451853_2763930
596 Ga0439443_004221
597 Ga0439443_010118
598 Ga0439448_0006943
599 Ga0439450_002446
600 Ga0439451_023169
601 Ga0439455_0008128
602 Ga0439463_000233
603 Ga0439463_008388
604 Ga0439463_008770
605 Ga0450905_002581
606 Ga0439464_0006632
607 Ga0439460_0011713
608 Ga0439460_0020383
609 Ga0450916_000406
610 Ga0439440_0000049
611 Ga0453683_0024996
612 Ga0451576_0005575
613 Ga0495651_0044796
614 Ga0495653_0073923
615 Ga0495639_0052647
616 Ga0495583_0087598
617 Ga0495608_0011225
618 Ga0495631_0063771
619 Ga0495667_0013643
620 Ga0495656_0086726
621 Ga0495635_0134387
622 Ga0495657_0002077
623 Ga0495623_0003724
624 Ga0495600_0006417
625 Ga0495674_0045958
626 Ga0495672_0006428
627 Ga0495675_0136560
628 Ga0496102_0037963
629 Ga0496102_0142527
630 Ga0496112_0006060
631 Ga0496115_0139226
632 Ga0496121_0028696
633 Ga0501293_001774
634 Ga0501031_0000371
635 Ga0501031_0000395
636 Ga0501033_0002791
637 Ga0501033_0056410
638 Ga0501033_0065171
639 Ga0501036_0000784
640 Ga0501036_0005590
641 Ga0501037_0006484
642 Ga0501037_0066534
643 Ga0501038_0002071
644 Ga0501038_0009863
645 Ga0501038_0075489
646 Ga0501039_0001465
647 Ga0501039_0002303
648 Ga0501039_0004662
649 Ga0501040_0000353
650 Ga0501040_0000463
651 Ga0501040_0024073
652 Ga0501040_0046568
653 Ga0501041_0001111
654 Ga0501041_0003585
655 Ga0501041_0063713
656 Ga0501041_0099040
657 Ga0501042_0005116
658 Ga0501042_0010552
659 Ga0501042_0020441
660 Ga0501042_0177670
661 Ga0501043_0027980
662 Ga0501043_0049023
663 Ga0501043_0051303
664 Ga0501046_0000497
665 Ga0501046_0000980
666 Ga0501046_0099583
667 Ga0501047_0008000
668 Ga0501047_0113241
669 Ga0501048_0002222
670 Ga0501048_0002550
671 Ga0501048_0109101
672 Ga0501068_0114844
673 Ga0501071_0001514
674 Ga0501071_0022224
675 Ga0501071_0027977
676 Ga0501071_0070566
677 Ga0501072_0000624
678 Ga0501072_0016693
679 Ga0501072_0026943
680 Ga0501072_0080571
681 Ga0501073_0101807
682 Ga0501073_0106288
683 Ga0501074_0001029
684 Ga0501074_0003362
685 Ga0501074_0004741
686 Ga0501074_0167762
687 Ga0501075_0000374
688 Ga0501075_0001860
689 Ga0501075_0011475
690 Ga0501075_0050378
691 Ga0501076_0000889
692 Ga0501076_0000976
693 Ga0501076_0009969
694 Ga0501076_0079716
695 Ga0501076_0236494
696 Ga0501077_0000790
697 Ga0501077_0004068
698 Ga0501077_0014309
699 Ga0501206_000361
700 Ga0501235_001680
701 Ga0501248_000705
702 Ga0501249_000454
703 Ga0501251_000026
704 Ga0501261_005973
705 Ga0501221_016704
706 Ga0501079_0000353
707 Ga0501079_0002473
708 Ga0501079_0059767
709 Ga0501080_0037280
710 Ga0501080_0095533
711 Ga0501081_0001844
712 Ga0501081_0005560
713 Ga0501081_0040218
714 Ga0501083_0099488
715 Ga0501264_000887
716 Ga0501271_000678
717 Ga0501035_0008853
718 Ga0501044_0002701
719 Ga0501044_0252509
720 Ga0501045_0000935
721 Ga0501045_0001284
722 Ga0501045_0003077
723 Ga0501045_0004345
724 nmdc:mga00v17_18085_c1
725 nmdc:mga0yw44_1308_c1
726 nmdc:mga0yw44_96354_c1
727 nmdc:mga05p37_117791_c1
728 nmdc:mga05p37_200067_c1
729 nmdc:mga05p37_25670_c1
730 nmdc:mga05p37_36370_c1
731 nmdc:mga09592_10923_c1
732 nmdc:mga09592_13556_c1
733 nmdc:mga09592_207416_c1
734 nmdc:mga0qj67_151181_c1
735 nmdc:mga0qj67_224260_c1
736 nmdc:mga0qj67_66223_c1
737 nmdc:mga06r32_114702_c1
738 nmdc:mga06r32_165726_c1
739 nmdc:mga06r32_179765_c1
740 nmdc:mga06r32_42154_c1
741 nmdc:mga08y16_1351_c1
742 nmdc:mga08y16_222613_c1
743 nmdc:mga08y16_449852_c1
744 nmdc:mga0n895_12397_c1
745 nmdc:mga0n895_12701_c1
746 nmdc:mga0rr50_202923_c1
747 nmdc:mga08x19_31327_c1
748 nmdc:mga0a205_23755_c1
749 nmdc:mga0a205_374_c1
750 nmdc:mga0a205_4984_c1
751 Ga0495601_0035939
752 Ga0495595_0013650
753 Ga0495619_0109202
754 Ga0500566_0005354
755 Ga0500616_0003515
756 Ga0500616_0027996
757 Ga0501084_0001830
758 Ga0501084_0002286
759 Ga0501084_0005380
760 Ga0501084_0008030
761 Ga0501084_0020618
762 Ga0501084_0153675
763 Ga0590075_001789
764 Ga0501082_0000150
765 Ga0501082_0001064
766 Ga0501082_0086460
767 Ga0530510_0000575
768 Ga0530510_0002416
769 Ga0530510_0007154
770 Ga0530510_0010121
771 2508678202
772 2676201703
773 2689956228
774 2774846279
775 2861527637
776 2899363060
777 8002788587
778 8057568523

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

218

383

0.99

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

71

210

0.97

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

227

386

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8afv-assembly1.cif.gz_A daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.9454 3 337
1vkn-assembly1.cif.gz_D crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution 0.9434 1 345
1vkn-assembly1.cif.gz_C crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution 0.943 1 345
1vkn-assembly1.cif.gz_B crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution 0.942 1 345
1vkn-assembly1.cif.gz_D crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution 0.9407 1 345
ID Description Score Start End Superfamily
2cvoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9286 2 147 3.40.50.720
1vknD02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9234 148 313 3.30.360.10
1vknA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9187 1 147 3.40.50.720
1vknD02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9177 148 313 3.30.360.10
af_I1KL32_193_359_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9122 148 313 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A7X7D8W6-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9909 209 345
AF-A0A381TIW2-F1-model_v4 Semialdehyde dehydrogenase NAD-binding domain-containing protein 0.9894 1 116 GO:0006526
GO:0016620
GO:0051287
AF-A0A7X7D8W6-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9837 209 345
AF-A0A381TIW2-F1-model_v4 Semialdehyde dehydrogenase NAD-binding domain-containing protein 0.981 1 116 GO:0006526
GO:0016620
GO:0051287
AF-A0A7V9KGD5-F1-model_v4 Semialdehyde dehydrogenase NAD-binding domain-containing protein 0.9771 1 169 GO:0008652
GO:0016620
GO:0051287

Map