F431502

General Info

Members Datasets Scaffolds Average Seq Length
389 240 778 86

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1621116|Ga0436365_1621116_3246_3539
Length 97
Sequence MTFLVQELAQADMTHVTIYTKPYCPYCIRAVSLLEKKGVPFTEVEAAFDPDKRQEMMQRSGRATFPQIFVGDRHIGGCDDMMALDREGKLDPILQAA

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
148 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
168 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
216 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
217 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
218 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
219 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
220 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
221 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
222 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
223 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
224 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
225 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
226 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
227 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
228 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
229 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
230 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
231 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
232 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
233 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
234 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
235 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
239 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
240 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0
Isolates 0.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.05
Nodule 0
Rhizoplane 4.63
Rhizosphere 79.69
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1621116 3300039437 Bacteria 10089
2 Ga0055530_10001755 3300003791 Bacteria 15163
3 Ga0055531_10012537 3300003794 Bacteria 3978
4 Ga0055531_10037112 3300003794 Bacteria 1488
5 Ga0055543_1008207 3300004625 Bacteria 2331
6 Ga0065165_1000728 3300005262 Bacteria 46007
7 Ga0065165_1019524 3300005262 Bacteria 2416
8 Ga0070658_10277952 3300005327 Bacteria 1425
9 Ga0070658_10671947 3300005327 Bacteria 899
10 Ga0070658_11346363 3300005327 Bacteria 620
11 Ga0070683_101496209 3300005329 Bacteria 649
12 Ga0070670_100005196 3300005331 Bacteria 10957
13 Ga0070670_100126711 3300005331 Bacteria 2204
14 Ga0070670_100128520 3300005331 Bacteria 2187
15 Ga0070677_10544499 3300005333 Bacteria 635
16 Ga0070666_10479016 3300005335 Bacteria 901
17 Ga0070666_10660806 3300005335 Bacteria 765
18 Ga0070680_100610380 3300005336 Bacteria 936
19 Ga0070680_101282835 3300005336 Bacteria 634
20 Ga0070682_101709477 3300005337 Bacteria 547
21 Ga0068868_100324107 3300005338 Bacteria 1313
22 Ga0070660_100060195 3300005339 Bacteria 2947
23 Ga0070660_101181131 3300005339 Bacteria 648
24 Ga0070660_101223095 3300005339 Bacteria 637
25 Ga0070691_10040388 3300005341 Bacteria 2205
26 Ga0070661_101864873 3300005344 Bacteria 511
27 Ga0070668_100002214 3300005347 Bacteria 14281
28 Ga0070669_100018548 3300005353 Bacteria 4971
29 Ga0070669_100290603 3300005353 Bacteria 1312
30 Ga0070671_100007293 3300005355 Bacteria 8831
31 Ga0070671_100226673 3300005355 Bacteria 1586
32 Ga0070671_100461176 3300005355 Bacteria 1091
33 Ga0070673_100084701 3300005364 Bacteria 2579
34 Ga0070659_100001782 3300005366 Bacteria 15474
35 Ga0070659_100408495 3300005366 Bacteria 1147
36 Ga0070659_101113270 3300005366 Bacteria 696
37 Ga0070667_100001837 3300005367 Bacteria 18915
38 Ga0070667_100027557 3300005367 Bacteria 4727
39 Ga0070663_101550433 3300005455 Bacteria 590
40 Ga0070678_100257959 3300005456 Bacteria 1465
41 Ga0070662_100224869 3300005457 Bacteria 1499
42 Ga0070681_10022067 3300005458 Bacteria 6388
43 Ga0070681_10230985 3300005458 Bacteria 1764
44 Ga0068867_100567869 3300005459 Bacteria 985
45 Ga0068867_101162611 3300005459 Bacteria 707
46 Ga0070679_100464169 3300005530 Bacteria 1211
47 Ga0070679_100536752 3300005530 Bacteria 1113
48 Ga0070679_100876674 3300005530 Bacteria 841
49 Ga0070679_100881111 3300005530 Bacteria 838
50 Ga0070684_100850574 3300005535 Bacteria 854
51 Ga0068853_102174252 3300005539 Bacteria 538
52 Ga0070686_100652760 3300005544 Bacteria 834
53 Ga0070665_101409437 3300005548 Bacteria 706
54 Ga0070665_101614789 3300005548 Bacteria 656
55 Ga0068855_100036686 3300005563 Bacteria 5832
56 Ga0068855_100107862 3300005563 Bacteria 3199
57 Ga0068855_101151696 3300005563 Bacteria 808
58 Ga0068855_101724610 3300005563 Bacteria 638
59 Ga0068855_102417045 3300005563 Bacteria 524
60 Ga0070664_100052968 3300005564 Bacteria 3439
61 Ga0068857_100685804 3300005577 Bacteria 973
62 Ga0068854_100629330 3300005578 Bacteria 919
63 Ga0068852_100448452 3300005616 Bacteria 1277
64 Ga0068852_100897762 3300005616 Bacteria 903
65 Ga0068852_102626765 3300005616 Bacteria 523
66 Ga0068859_100000093 3300005617 Bacteria 82384
67 Ga0068864_100133647 3300005618 Bacteria 2232
68 Ga0068864_100149545 3300005618 Bacteria 2114
69 Ga0068864_100553000 3300005618 Bacteria 1113
70 Ga0068864_101817299 3300005618 Bacteria 615
71 Ga0068861_100232226 3300005719 Bacteria 1565
72 Ga0068861_100240690 3300005719 Bacteria 1539
73 Ga0068870_11007262 3300005840 Bacteria 594
74 Ga0068863_100002382 3300005841 Bacteria 18687
75 Ga0068863_100016646 3300005841 Bacteria 7055
76 Ga0068863_100069239 3300005841 Bacteria 3337
77 Ga0068863_100501042 3300005841 Bacteria 1196
78 Ga0068858_100001294 3300005842 Bacteria 25828
79 Ga0068858_100678336 3300005842 Bacteria 1002
80 Ga0068860_100002878 3300005843 Bacteria 17857
81 Ga0068860_100006664 3300005843 Bacteria 11599
82 Ga0068860_100998066 3300005843 Bacteria 855
83 Ga0068862_100015428 3300005844 Bacteria 6346
84 Ga0068862_100274832 3300005844 Bacteria 1542
85 Ga0068862_101716789 3300005844 Bacteria 636
86 Ga0075364_10015718 3300006051 Bacteria 4697
87 Ga0075367_10014852 3300006178 Bacteria 4219
88 Ga0068871_100395264 3300006358 Bacteria 1230
89 Ga0097620_100000093 3300006931 Bacteria 82384
90 Ga0105240_10053442 3300009093 Bacteria 5069
91 Ga0105240_10417508 3300009093 Bacteria 1508
92 Ga0105240_10926249 3300009093 Bacteria 936
93 Ga0105247_10034476 3300009101 Bacteria 3082
94 Ga0105247_10929865 3300009101 Bacteria 674
95 Ga0105243_12530162 3300009148 Bacteria 553
96 Ga0105241_10078015 3300009174 Bacteria 2587
97 Ga0105241_10495563 3300009174 Bacteria 1088
98 Ga0105241_11042940 3300009174 Bacteria 767
99 Ga0105241_11455233 3300009174 Bacteria 658
100 Ga0105242_10377581 3300009176 Bacteria 1317
101 Ga0105248_10006026 3300009177 Bacteria 13309
102 Ga0105248_10404767 3300009177 Bacteria 1536
103 Ga0105248_10642322 3300009177 Bacteria 1197
104 Ga0105248_10750882 3300009177 Bacteria 1101
105 Ga0105248_12992472 3300009177 Bacteria 538
106 Ga0105237_10415784 3300009545 Bacteria 1350
107 Ga0105237_11306304 3300009545 Bacteria 732
108 Ga0105238_10733240 3300009551 Bacteria 1001
109 Ga0105238_10740951 3300009551 Bacteria 996
110 Ga0105238_10805492 3300009551 Bacteria 955
111 Ga0105238_10842263 3300009551 Bacteria 934
112 Ga0105238_12405217 3300009551 Bacteria 562
113 Ga0105249_10038397 3300009553 Bacteria 4345
114 Ga0105249_10134038 3300009553 Bacteria 2368
115 Ga0105249_10332166 3300009553 Bacteria 1534
116 Ga0105239_11566872 3300010375 Bacteria 762
117 Ga0105239_13210325 3300010375 Bacteria 532
118 Ga0157373_11291997 3300013100 Bacteria 552
119 Ga0157370_10140496 3300013104 Bacteria 2250
120 Ga0157374_12341637 3300013296 Bacteria 561
121 Ga0163162_10308679 3300013306 Bacteria 1714
122 Ga0163162_10323002 3300013306 Bacteria 1676
123 Ga0163162_10761870 3300013306 Bacteria 1087
124 Ga0163162_11355095 3300013306 Bacteria 809
125 Ga0163162_12988722 3300013306 Bacteria 543
126 Ga0157372_11528058 3300013307 Bacteria 769
127 Ga0157375_10015470 3300013308 Bacteria 6830
128 Ga0157375_11449326 3300013308 Bacteria 809
129 Ga0163163_10000959 3300014325 Bacteria 24491
130 Ga0163163_10237827 3300014325 Bacteria 1871
131 Ga0163163_10473671 3300014325 Bacteria 1313
132 Ga0157377_11778931 3300014745 Bacteria 500
133 Ga0157379_10000552 3300014968 Bacteria 30177
134 Ga0157379_11873613 3300014968 Bacteria 590
135 Ga0157376_12397232 3300014969 Bacteria 567
136 Ga0182007_10068387 3300015262 Bacteria 1164
137 Ga0163161_10222210 3300017792 Bacteria 1463
138 Ga0163161_10724599 3300017792 Bacteria 830
139 Ga0213876_10008380 3300021384 Bacteria 5594
140 Ga0209026_1004590 3300025250 Bacteria 4041
141 Ga0209026_1012524 3300025250 Bacteria 1475
142 Ga0209148_1005740 3300025254 Bacteria 2788
143 Ga0209758_1000431 3300025297 Bacteria 71115
144 Ga0209050_1000098 3300025298 Bacteria 236717
145 Ga0209257_1000221 3300025304 Bacteria 134870
146 Ga0209257_1001130 3300025304 Bacteria 34283
147 Ga0207697_10116879 3300025315 Bacteria 1146
148 Ga0207710_10040438 3300025900 Bacteria 2066
149 Ga0207680_10402954 3300025903 Bacteria 967
150 Ga0207680_10570120 3300025903 Bacteria 809
151 Ga0207643_10294782 3300025908 Bacteria 1008
152 Ga0207705_11159625 3300025909 Bacteria 594
153 Ga0207654_10034035 3300025911 Bacteria 2828
154 Ga0207707_10452720 3300025912 Bacteria 1098
155 Ga0207707_11215747 3300025912 Bacteria 609
156 Ga0207695_10000893 3300025913 Bacteria 54084
157 Ga0207695_10217775 3300025913 Bacteria 1817
158 Ga0207671_10309663 3300025914 Bacteria 1248
159 Ga0207660_10016268 3300025917 Bacteria 4922
160 Ga0207660_10730041 3300025917 Bacteria 808
161 Ga0207660_11444208 3300025917 Bacteria 557
162 Ga0207657_10022101 3300025919 Bacteria 5969
163 Ga0207657_10045905 3300025919 Bacteria 3830
164 Ga0207649_10579013 3300025920 Bacteria 862
165 Ga0207652_10048615 3300025921 Bacteria 3626
166 Ga0207652_10057347 3300025921 Bacteria 3354
167 Ga0207652_10635216 3300025921 Bacteria 955
168 Ga0207652_10779038 3300025921 Bacteria 850
169 Ga0207681_10042596 3300025923 Bacteria 3033
170 Ga0207681_10839501 3300025923 Bacteria 768
171 Ga0207694_10033862 3300025924 Bacteria 3915
172 Ga0207694_10682642 3300025924 Bacteria 866
173 Ga0207650_10046807 3300025925 Bacteria 3186
174 Ga0207650_10179831 3300025925 Bacteria 1685
175 Ga0207650_10692942 3300025925 Bacteria 860
176 Ga0207659_11458027 3300025926 Bacteria 586
177 Ga0207644_10019763 3300025931 Bacteria 4573
178 Ga0207644_10117625 3300025931 Bacteria 2019
179 Ga0207644_11826014 3300025931 Bacteria 508
180 Ga0207690_10003157 3300025932 Bacteria 9898
181 Ga0207690_10404314 3300025932 Bacteria 1089
182 Ga0207690_10665117 3300025932 Bacteria 854
183 Ga0207706_10289551 3300025933 Bacteria 1428
184 Ga0207686_10211346 3300025934 Bacteria 1395
185 Ga0207711_10013458 3300025941 Bacteria 6796
186 Ga0207711_10269926 3300025941 Bacteria 1565
187 Ga0207711_10449590 3300025941 Bacteria 1199
188 Ga0207711_10657355 3300025941 Bacteria 978
189 Ga0207661_10672750 3300025944 Bacteria 952
190 Ga0207661_10968678 3300025944 Bacteria 784
191 Ga0207661_11324071 3300025944 Bacteria 662
192 Ga0207679_10036213 3300025945 Bacteria 3498
193 Ga0207679_10723076 3300025945 Bacteria 904
194 Ga0207667_10062924 3300025949 Bacteria 3878
195 Ga0207667_11659770 3300025949 Bacteria 606
196 Ga0207667_11807391 3300025949 Bacteria 575
197 Ga0207651_10048526 3300025960 Bacteria 2871
198 Ga0207712_10306941 3300025961 Bacteria 1304
199 Ga0207712_10889859 3300025961 Bacteria 786
200 Ga0207668_10001395 3300025972 Bacteria 14242
201 Ga0207668_10011020 3300025972 Bacteria 5482
202 Ga0207668_11845672 3300025972 Bacteria 545
203 Ga0207658_10003660 3300025986 Bacteria 10850
204 Ga0207658_10010520 3300025986 Bacteria 6286
205 Ga0207658_11871547 3300025986 Bacteria 547
206 Ga0207677_10457986 3300026023 Bacteria 1094
207 Ga0207703_10015297 3300026035 Bacteria 5985
208 Ga0207639_11948209 3300026041 Bacteria 548
209 Ga0207639_11980790 3300026041 Bacteria 543
210 Ga0207678_10563139 3300026067 Bacteria 997
211 Ga0207641_10008194 3300026088 Bacteria 8638
212 Ga0207641_10042078 3300026088 Bacteria 3831
213 Ga0207641_10044292 3300026088 Bacteria 3742
214 Ga0207676_10027016 3300026095 Bacteria 4271
215 Ga0207676_10064082 3300026095 Bacteria 2921
216 Ga0207676_10149800 3300026095 Bacteria 2008
217 Ga0207674_10784921 3300026116 Bacteria 919
218 Ga0207674_12165516 3300026116 Bacteria 519
219 Ga0207675_100158180 3300026118 Bacteria 2160
220 Ga0207675_101490808 3300026118 Bacteria 697
221 Ga0207683_10526567 3300026121 Bacteria 1092
222 Ga0207698_10533278 3300026142 Bacteria 1147
223 Ga0207698_10689506 3300026142 Bacteria 1015
224 Ga0207698_11047978 3300026142 Bacteria 827
225 Ga0207698_11464758 3300026142 Bacteria 698
226 Ga0209813_10026991 3300027866 Bacteria 1664
227 Ga0268266_11335257 3300028379 Bacteria 692
228 Ga0268265_10081362 3300028380 Bacteria 2557
229 Ga0268265_10185972 3300028380 Bacteria 1789
230 Ga0268264_10012744 3300028381 Bacteria 6920
231 Ga0268264_10019456 3300028381 Bacteria 5548
232 Ga0268264_12422459 3300028381 Bacteria 531
233 Ga0307517_10021826 3300028786 Bacteria 8058
234 Ga0307517_10033623 3300028786 Bacteria 5879
235 Ga0307515_10000080 3300028794 Bacteria 224941
236 Ga0265338_10186693 3300028800 Bacteria 1575
237 Ga0265338_10526375 3300028800 Bacteria 830
238 Ga0307511_10047899 3300030521 Bacteria 3488
239 Ga0265327_10001920 3300031251 Bacteria 23989
240 Ga0265327_10347517 3300031251 Bacteria 648
241 Ga0307513_10000117 3300031456 Bacteria 110951
242 Ga0307513_10000208 3300031456 Bacteria 84906
243 Ga0307513_10003525 3300031456 Bacteria 21166
244 Ga0307513_10009571 3300031456 Bacteria 12240
245 Ga0307408_101714209 3300031548 Bacteria 599
246 Ga0307508_10756673 3300031616 Bacteria 585
247 Ga0265314_10113209 3300031711 Bacteria 1721
248 Ga0307405_10327553 3300031731 Bacteria 1173
249 Ga0307405_11123967 3300031731 Bacteria 676
250 Ga0307405_12119753 3300031731 Bacteria 505
251 Ga0307413_10786266 3300031824 Bacteria 798
252 Ga0307413_10821386 3300031824 Bacteria 783
253 Ga0307413_11439559 3300031824 Bacteria 607
254 Ga0307410_11016213 3300031852 Bacteria 716
255 Ga0307410_11464824 3300031852 Bacteria 601
256 Ga0307410_12036848 3300031852 Bacteria 513
257 Ga0307406_10195716 3300031901 Bacteria 1484
258 Ga0307406_10768904 3300031901 Bacteria 810
259 Ga0307406_11813304 3300031901 Bacteria 543
260 Ga0307412_10315374 3300031911 Bacteria 1242
261 Ga0307412_10626292 3300031911 Bacteria 915
262 Ga0307412_11069564 3300031911 Bacteria 716
263 Ga0307412_11832303 3300031911 Bacteria 559
264 Ga0307409_101239447 3300031995 Bacteria 770
265 Ga0307416_102868646 3300032002 Bacteria 577
266 Ga0307414_12115800 3300032004 Bacteria 525
267 Ga0307411_11894248 3300032005 Bacteria 555
268 Ga0307411_12035545 3300032005 Bacteria 536
269 Ga0307415_102599252 3300032126 Bacteria 500
270 Ga0307510_10021457 3300033180 Bacteria 7525
271 Ga0307510_10116689 3300033180 Bacteria 2390
272 Ga0373943_0149356 3300035170 Bacteria 1265
273 Ga0373927_0001218 3300035695 Bacteria 19531
274 Ga0373925_0000277 3300037068 Bacteria 53450
275 Ga0373925_1072187 3300037068 Bacteria 663
276 Ga0395905_0776265 3300037471 Bacteria 861
277 Ga0395905_1695107 3300037471 Bacteria 537
278 Ga0395901_0133595 3300038443 Bacteria 2608
279 Ga0395901_0810801 3300038443 Bacteria 924
280 Ga0436360_1085951 3300039438 Bacteria 664
281 Ga0451807_1477896 3300041486 Bacteria 681
282 Ga0450892_005039 3300042130 Bacteria 1083
283 Ga0466972_0346369 3300044658 Bacteria 695
284 Ga0466961_0178364 3300044693 Bacteria 1320
285 Ga0466961_0485494 3300044693 Bacteria 747
286 Ga0453684_0436783 3300044712 Bacteria 1459
287 Ga0466970_0132244 3300044765 Unclassified 1371
288 Ga0466959_0776925 3300045049 Bacteria 641
289 Ga0451576_1818795 3300045051 Bacteria 629
290 Ga0466967_2243338 3300045976 Unclassified 542
291 Ga0495629_0006145 3300046459 Bacteria 8920
292 Ga0495639_0419640 3300046475 Bacteria 677
293 Ga0495583_0020392 3300046506 Bacteria 3435
294 Ga0495583_0023239 3300046506 Bacteria 3141
295 Ga0495606_0589984 3300046507 Bacteria 547
296 Ga0495620_0075667 3300046515 Bacteria 1369
297 Ga0495620_0342184 3300046515 Bacteria 567
298 Ga0495637_0106764 3300046520 Bacteria 1089
299 Ga0495643_0013514 3300046522 Bacteria 4881
300 Ga0495644_0445867 3300046523 Bacteria 515
301 Ga0495663_0240007 3300046525 Bacteria 641
302 Ga0495642_0099218 3300046528 Bacteria 1238
303 Ga0495621_0239569 3300046539 Bacteria 739
304 Ga0495621_0248573 3300046539 Bacteria 726
305 Ga0495597_0017456 3300046542 Bacteria 3377
306 Ga0495622_0001231 3300046557 Bacteria 13143
307 Ga0495668_0327370 3300046616 Bacteria 840
308 Ga0495668_0607775 3300046616 Bacteria 604
309 Ga0495668_0618005 3300046616 Bacteria 599
310 Ga0495611_0151235 3300046648 Bacteria 1083
311 Ga0495611_0448817 3300046648 Bacteria 588
312 Ga0495625_0016321 3300046660 Bacteria 5847
313 Ga0495625_0450990 3300046660 Bacteria 795
314 Ga0495625_0559901 3300046660 Bacteria 691
315 Ga0495659_0230011 3300046664 Bacteria 768
316 Ga0495669_0242557 3300046684 Bacteria 865
317 Ga0495669_0308328 3300046684 Bacteria 763
318 Ga0495624_0341313 3300046690 Bacteria 901
319 Ga0495660_0001489 3300046810 Bacteria 15861
320 Ga0495636_0459321 3300047318 Bacteria 612
321 Ga0495672_0023705 3300047320 Bacteria 3967
322 Ga0495677_0218560 3300047445 Bacteria 742
323 Ga0495681_0185244 3300047470 Bacteria 853
324 Ga0495686_0010886 3300047472 Bacteria 6440
325 Ga0495686_0549289 3300047472 Bacteria 603
326 Ga0495593_0025001 3300047673 Bacteria 3305
327 Ga0496100_0151630 3300048903 Bacteria 1654
328 Ga0496101_1411686 3300048904 Bacteria 543
329 Ga0496101_1609037 3300048904 Bacteria 505
330 Ga0496102_0441216 3300048905 Bacteria 1221
331 Ga0496103_0195031 3300048906 Bacteria 1302
332 Ga0496104_0803129 3300048907 Bacteria 847
333 Ga0496105_0907982 3300048908 Bacteria 663
334 Ga0496106_0117721 3300048909 Bacteria 2074
335 Ga0496107_0123455 3300048910 Bacteria 1908
336 Ga0496108_0216776 3300048911 Bacteria 1662
337 Ga0496109_0001726 3300048912 Bacteria 18234
338 Ga0496110_0503684 3300048913 Bacteria 1102
339 Ga0496112_0202643 3300048915 Bacteria 1943
340 Ga0496113_0117641 3300048916 Bacteria 2075
341 Ga0496114_1305088 3300048917 Bacteria 613
342 Ga0496115_0000546 3300048918 Bacteria 29331
343 Ga0496115_0577140 3300048918 Bacteria 896
344 Ga0496125_0052838 3300048928 Bacteria 3338
345 Ga0495682_0308363 3300049460 Bacteria 558
346 Ga0501034_1154052 3300049571 Bacteria 654
347 Ga0501047_0011333 3300049581 Bacteria 8441
348 Ga0501047_0531810 3300049581 Bacteria 1001
349 Ga0501067_0163144 3300049583 Bacteria 1241
350 Ga0501073_0052161 3300049589 Bacteria 2864
351 Ga0501074_0090064 3300049590 Bacteria 2197
352 Ga0501076_0564191 3300049592 Bacteria 939
353 Ga0501080_0021951 3300049742 Bacteria 5913
354 Ga0501083_0014251 3300049744 Bacteria 5561
355 Ga0501044_0556500 3300049823 Bacteria 1044
356 nmdc:mga03n38_229373_c1 3300050490 Bacteria 973
357 nmdc:mga00v17_1028_c1 3300050491 Bacteria 14886
358 nmdc:mga0k408_572866_c1 3300050493 Bacteria 667
359 nmdc:mga06z11_37284_c1 3300050494 Bacteria 2407
360 nmdc:mga04h51_50110_c1 3300050495 Bacteria 1398
361 nmdc:mga07m45_11217_c1 3300050496 Bacteria 4704
362 nmdc:mga0sz30_459398_c1 3300050516 Bacteria 572
363 Ga0500578_0153623 3300053086 Bacteria 1432
364 Ga0500651_0092538 3300053093 Bacteria 1860
365 Ga0500566_0018116 3300053094 Bacteria 4136
366 Ga0500641_0051628 3300053096 Bacteria 1692
367 Ga0500562_001263 3300053108 Bacteria 6250
368 Ga0500569_003332 3300053109 Bacteria 3271
369 Ga0500591_207355 3300053115 Bacteria 668
370 Ga0500595_013712 3300053119 Bacteria 3099
371 Ga0500595_078308 3300053119 Bacteria 971
372 Ga0500607_213929 3300053121 Bacteria 811
373 Ga0500614_002814 3300053123 Bacteria 3827
374 Ga0500642_0015632 3300053130 Bacteria 2861
375 Ga0500655_017940 3300053133 Bacteria 1313
376 Ga0500658_0128112 3300053134 Bacteria 1130
377 Ga0500559_0074199 3300053136 Bacteria 1536
378 Ga0500577_0179327 3300053142 Bacteria 909
379 Ga0500590_018407 3300053148 Bacteria 3613
380 Ga0500639_188194 3300053163 Bacteria 903
381 Ga0500637_0030508 3300053178 Bacteria 3000
382 Ga0500625_015433 3300053729 Bacteria 3544
383 Ga0500645_048647 3300053730 Bacteria 1241
384 Ga0500596_001964 3300053735 Bacteria 4116
385 Ga0501084_0020309 3300054114 Bacteria 5538
386 Ga0501082_0494958 3300060353 Bacteria 1068
387 2644343645 2643221661 Bacteria 4267604
388 2644368877 2643221666 Bacteria 4265935
389 2928533186 2928531327 Bacteria 5101314
390 Ga0436365_1621116
391 Ga0055530_10001755
392 Ga0055531_10012537
393 Ga0055531_10037112
394 Ga0055543_1008207
395 Ga0065165_1000728
396 Ga0065165_1019524
397 Ga0070658_10277952
398 Ga0070658_10671947
399 Ga0070658_11346363
400 Ga0070683_101496209
401 Ga0070670_100005196
402 Ga0070670_100126711
403 Ga0070670_100128520
404 Ga0070677_10544499
405 Ga0070666_10479016
406 Ga0070666_10660806
407 Ga0070680_100610380
408 Ga0070680_101282835
409 Ga0070682_101709477
410 Ga0068868_100324107
411 Ga0070660_100060195
412 Ga0070660_101181131
413 Ga0070660_101223095
414 Ga0070691_10040388
415 Ga0070661_101864873
416 Ga0070668_100002214
417 Ga0070669_100018548
418 Ga0070669_100290603
419 Ga0070671_100007293
420 Ga0070671_100226673
421 Ga0070671_100461176
422 Ga0070673_100084701
423 Ga0070659_100001782
424 Ga0070659_100408495
425 Ga0070659_101113270
426 Ga0070667_100001837
427 Ga0070667_100027557
428 Ga0070663_101550433
429 Ga0070678_100257959
430 Ga0070662_100224869
431 Ga0070681_10022067
432 Ga0070681_10230985
433 Ga0068867_100567869
434 Ga0068867_101162611
435 Ga0070679_100464169
436 Ga0070679_100536752
437 Ga0070679_100876674
438 Ga0070679_100881111
439 Ga0070684_100850574
440 Ga0068853_102174252
441 Ga0070686_100652760
442 Ga0070665_101409437
443 Ga0070665_101614789
444 Ga0068855_100036686
445 Ga0068855_100107862
446 Ga0068855_101151696
447 Ga0068855_101724610
448 Ga0068855_102417045
449 Ga0070664_100052968
450 Ga0068857_100685804
451 Ga0068854_100629330
452 Ga0068852_100448452
453 Ga0068852_100897762
454 Ga0068852_102626765
455 Ga0068859_100000093
456 Ga0068864_100133647
457 Ga0068864_100149545
458 Ga0068864_100553000
459 Ga0068864_101817299
460 Ga0068861_100232226
461 Ga0068861_100240690
462 Ga0068870_11007262
463 Ga0068863_100002382
464 Ga0068863_100016646
465 Ga0068863_100069239
466 Ga0068863_100501042
467 Ga0068858_100001294
468 Ga0068858_100678336
469 Ga0068860_100002878
470 Ga0068860_100006664
471 Ga0068860_100998066
472 Ga0068862_100015428
473 Ga0068862_100274832
474 Ga0068862_101716789
475 Ga0075364_10015718
476 Ga0075367_10014852
477 Ga0068871_100395264
478 Ga0097620_100000093
479 Ga0105240_10053442
480 Ga0105240_10417508
481 Ga0105240_10926249
482 Ga0105247_10034476
483 Ga0105247_10929865
484 Ga0105243_12530162
485 Ga0105241_10078015
486 Ga0105241_10495563
487 Ga0105241_11042940
488 Ga0105241_11455233
489 Ga0105242_10377581
490 Ga0105248_10006026
491 Ga0105248_10404767
492 Ga0105248_10642322
493 Ga0105248_10750882
494 Ga0105248_12992472
495 Ga0105237_10415784
496 Ga0105237_11306304
497 Ga0105238_10733240
498 Ga0105238_10740951
499 Ga0105238_10805492
500 Ga0105238_10842263
501 Ga0105238_12405217
502 Ga0105249_10038397
503 Ga0105249_10134038
504 Ga0105249_10332166
505 Ga0105239_11566872
506 Ga0105239_13210325
507 Ga0157373_11291997
508 Ga0157370_10140496
509 Ga0157374_12341637
510 Ga0163162_10308679
511 Ga0163162_10323002
512 Ga0163162_10761870
513 Ga0163162_11355095
514 Ga0163162_12988722
515 Ga0157372_11528058
516 Ga0157375_10015470
517 Ga0157375_11449326
518 Ga0163163_10000959
519 Ga0163163_10237827
520 Ga0163163_10473671
521 Ga0157377_11778931
522 Ga0157379_10000552
523 Ga0157379_11873613
524 Ga0157376_12397232
525 Ga0182007_10068387
526 Ga0163161_10222210
527 Ga0163161_10724599
528 Ga0213876_10008380
529 Ga0209026_1004590
530 Ga0209026_1012524
531 Ga0209148_1005740
532 Ga0209758_1000431
533 Ga0209050_1000098
534 Ga0209257_1000221
535 Ga0209257_1001130
536 Ga0207697_10116879
537 Ga0207710_10040438
538 Ga0207680_10402954
539 Ga0207680_10570120
540 Ga0207643_10294782
541 Ga0207705_11159625
542 Ga0207654_10034035
543 Ga0207707_10452720
544 Ga0207707_11215747
545 Ga0207695_10000893
546 Ga0207695_10217775
547 Ga0207671_10309663
548 Ga0207660_10016268
549 Ga0207660_10730041
550 Ga0207660_11444208
551 Ga0207657_10022101
552 Ga0207657_10045905
553 Ga0207649_10579013
554 Ga0207652_10048615
555 Ga0207652_10057347
556 Ga0207652_10635216
557 Ga0207652_10779038
558 Ga0207681_10042596
559 Ga0207681_10839501
560 Ga0207694_10033862
561 Ga0207694_10682642
562 Ga0207650_10046807
563 Ga0207650_10179831
564 Ga0207650_10692942
565 Ga0207659_11458027
566 Ga0207644_10019763
567 Ga0207644_10117625
568 Ga0207644_11826014
569 Ga0207690_10003157
570 Ga0207690_10404314
571 Ga0207690_10665117
572 Ga0207706_10289551
573 Ga0207686_10211346
574 Ga0207711_10013458
575 Ga0207711_10269926
576 Ga0207711_10449590
577 Ga0207711_10657355
578 Ga0207661_10672750
579 Ga0207661_10968678
580 Ga0207661_11324071
581 Ga0207679_10036213
582 Ga0207679_10723076
583 Ga0207667_10062924
584 Ga0207667_11659770
585 Ga0207667_11807391
586 Ga0207651_10048526
587 Ga0207712_10306941
588 Ga0207712_10889859
589 Ga0207668_10001395
590 Ga0207668_10011020
591 Ga0207668_11845672
592 Ga0207658_10003660
593 Ga0207658_10010520
594 Ga0207658_11871547
595 Ga0207677_10457986
596 Ga0207703_10015297
597 Ga0207639_11948209
598 Ga0207639_11980790
599 Ga0207678_10563139
600 Ga0207641_10008194
601 Ga0207641_10042078
602 Ga0207641_10044292
603 Ga0207676_10027016
604 Ga0207676_10064082
605 Ga0207676_10149800
606 Ga0207674_10784921
607 Ga0207674_12165516
608 Ga0207675_100158180
609 Ga0207675_101490808
610 Ga0207683_10526567
611 Ga0207698_10533278
612 Ga0207698_10689506
613 Ga0207698_11047978
614 Ga0207698_11464758
615 Ga0209813_10026991
616 Ga0268266_11335257
617 Ga0268265_10081362
618 Ga0268265_10185972
619 Ga0268264_10012744
620 Ga0268264_10019456
621 Ga0268264_12422459
622 Ga0307517_10021826
623 Ga0307517_10033623
624 Ga0307515_10000080
625 Ga0265338_10186693
626 Ga0265338_10526375
627 Ga0307511_10047899
628 Ga0265327_10001920
629 Ga0265327_10347517
630 Ga0307513_10000117
631 Ga0307513_10000208
632 Ga0307513_10003525
633 Ga0307513_10009571
634 Ga0307408_101714209
635 Ga0307508_10756673
636 Ga0265314_10113209
637 Ga0307405_10327553
638 Ga0307405_11123967
639 Ga0307405_12119753
640 Ga0307413_10786266
641 Ga0307413_10821386
642 Ga0307413_11439559
643 Ga0307410_11016213
644 Ga0307410_11464824
645 Ga0307410_12036848
646 Ga0307406_10195716
647 Ga0307406_10768904
648 Ga0307406_11813304
649 Ga0307412_10315374
650 Ga0307412_10626292
651 Ga0307412_11069564
652 Ga0307412_11832303
653 Ga0307409_101239447
654 Ga0307416_102868646
655 Ga0307414_12115800
656 Ga0307411_11894248
657 Ga0307411_12035545
658 Ga0307415_102599252
659 Ga0307510_10021457
660 Ga0307510_10116689
661 Ga0373943_0149356
662 Ga0373927_0001218
663 Ga0373925_0000277
664 Ga0373925_1072187
665 Ga0395905_0776265
666 Ga0395905_1695107
667 Ga0395901_0133595
668 Ga0395901_0810801
669 Ga0436360_1085951
670 Ga0451807_1477896
671 Ga0450892_005039
672 Ga0466972_0346369
673 Ga0466961_0178364
674 Ga0466961_0485494
675 Ga0453684_0436783
676 Ga0466970_0132244
677 Ga0466959_0776925
678 Ga0451576_1818795
679 Ga0466967_2243338
680 Ga0495629_0006145
681 Ga0495639_0419640
682 Ga0495583_0020392
683 Ga0495583_0023239
684 Ga0495606_0589984
685 Ga0495620_0075667
686 Ga0495620_0342184
687 Ga0495637_0106764
688 Ga0495643_0013514
689 Ga0495644_0445867
690 Ga0495663_0240007
691 Ga0495642_0099218
692 Ga0495621_0239569
693 Ga0495621_0248573
694 Ga0495597_0017456
695 Ga0495622_0001231
696 Ga0495668_0327370
697 Ga0495668_0607775
698 Ga0495668_0618005
699 Ga0495611_0151235
700 Ga0495611_0448817
701 Ga0495625_0016321
702 Ga0495625_0450990
703 Ga0495625_0559901
704 Ga0495659_0230011
705 Ga0495669_0242557
706 Ga0495669_0308328
707 Ga0495624_0341313
708 Ga0495660_0001489
709 Ga0495636_0459321
710 Ga0495672_0023705
711 Ga0495677_0218560
712 Ga0495681_0185244
713 Ga0495686_0010886
714 Ga0495686_0549289
715 Ga0495593_0025001
716 Ga0496100_0151630
717 Ga0496101_1411686
718 Ga0496101_1609037
719 Ga0496102_0441216
720 Ga0496103_0195031
721 Ga0496104_0803129
722 Ga0496105_0907982
723 Ga0496106_0117721
724 Ga0496107_0123455
725 Ga0496108_0216776
726 Ga0496109_0001726
727 Ga0496110_0503684
728 Ga0496112_0202643
729 Ga0496113_0117641
730 Ga0496114_1305088
731 Ga0496115_0000546
732 Ga0496115_0577140
733 Ga0496125_0052838
734 Ga0495682_0308363
735 Ga0501034_1154052
736 Ga0501047_0011333
737 Ga0501047_0531810
738 Ga0501067_0163144
739 Ga0501073_0052161
740 Ga0501074_0090064
741 Ga0501076_0564191
742 Ga0501080_0021951
743 Ga0501083_0014251
744 Ga0501044_0556500
745 nmdc:mga03n38_229373_c1
746 nmdc:mga00v17_1028_c1
747 nmdc:mga0k408_572866_c1
748 nmdc:mga06z11_37284_c1
749 nmdc:mga04h51_50110_c1
750 nmdc:mga07m45_11217_c1
751 nmdc:mga0sz30_459398_c1
752 Ga0500578_0153623
753 Ga0500651_0092538
754 Ga0500566_0018116
755 Ga0500641_0051628
756 Ga0500562_001263
757 Ga0500569_003332
758 Ga0500591_207355
759 Ga0500595_013712
760 Ga0500595_078308
761 Ga0500607_213929
762 Ga0500614_002814
763 Ga0500642_0015632
764 Ga0500655_017940
765 Ga0500658_0128112
766 Ga0500559_0074199
767 Ga0500577_0179327
768 Ga0500590_018407
769 Ga0500639_188194
770 Ga0500637_0030508
771 Ga0500625_015433
772 Ga0500645_048647
773 Ga0500596_001964
774 Ga0501084_0020309
775 Ga0501082_0494958
776 2644343645
777 2644368877
778 2928533186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

16

75

0.99

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

18

84

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tr1-assembly1.cif.gz_A crystal structure of gsh-bound cgrx2/c15s 0.973 3 84
4tr0-assembly2.cif.gz_B crystal structure of gssg-bound cgrx2 0.9723 3 84
4mjb-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a-a79s 0.9662 1 85
4mja-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a-a75i 0.9657 1 84
4mjc-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a - p84r 0.9652 1 84
ID Description Score Start End Superfamily
af_A0A1D6GDU0_1_74_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9738 15 84 3.40.30.10
4tr0B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9717 3 84 3.40.30.10
af_A0A368UIM3_131_233_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9219 2 87 3.40.30.10
af_A0A1D6LVM4_243_327_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9206 3 84 3.40.30.10
af_A0A1D6KSR1_221_307_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9121 1 87 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1Q3KVW2-F1-model_v4 deleted 0.996 3 84
AF-A0A0V2F9N0-F1-model_v4 deleted 0.9959 3 84
AF-A0A3B9GXA8-F1-model_v4 Glutaredoxin 1 0.9954 3 64 GO:0009055
GO:0045454
AF-M5JWE0-F1-model_v4 Glutaredoxin 0.9935 3 84 GO:0005737
GO:0009055
GO:0015038
GO:0045454
AF-A0A2E7BCU7-F1-model_v4 Glutaredoxin 0.9919 1 85 GO:0005737
GO:0015038
GO:0034599
GO:0045454

Map