F431441

General Info

Members Datasets Scaffolds Average Seq Length
389 229 350 358

Family's Representative Sequence

Representative Sequence 3300025292|Ga0209676_1014854|Ga0209676_10148543
Length 395
Sequence MTLATTSIHAPLIIDVAGTKLGDADRRRIAHPLVGGVIHFARNWQDRAQMTALNAELKAIRPDLLICVDHEGGRVQRFRTDGFTRLPSMRALGELWMRDAMRATQAATATGQVLAAELRACGIDFSFAPVLDLDYGGSSVIGDRSFHRDPRVVALLAKSVMHGMLQMGMRHCGKHFPGHGFVKADSHVEIPVDRRSLKTILADDARPYDWLAGTLTAVMPAHVIYPKVDRRPAGFSSRWLNEILRSRLSFDGAIFSDDLSMEAGRYIDGELLSFADAALAALDAGCDLAMLCNQSIGDGRPLDELLDGVAAAVRAGRWQERDSAAGAAAGVAFGGLERARGVRRVPRRSGSAGEGQTRAAARQQRLTSRYGAAHRRSPPESRCVRYSRTSNSSRW

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
8 2643221672 Variovorax sp. Root434 Isolate Unclassified
9 2643221683 Variovorax sp. Root473 Isolate Unclassified
10 2738541277 Variovorax sp. GV051 Isolate Unclassified
11 2738541307 Variovorax sp. GV008 Isolate Unclassified
12 2738543019 Variovorax sp. GV040 Isolate Unclassified
13 2818991446 Variovorax sp. 1180 Isolate Unclassified
14 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
15 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
16 2842677519 Variovorax sp. R-72495 Isolate Unclassified
17 2842733646 Variovorax sp. R-72446 Isolate Unclassified
18 2842747753 Variovorax sp. R-72060 Isolate Unclassified
19 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
20 2885198086 Variovorax sp. 679 Isolate Unclassified
21 2885211737 Variovorax sp. 553 Isolate Unclassified
22 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
23 2899924645 Variovorax sp. 369 Isolate Unclassified
24 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
25 2904456579 Variovorax sp. 2002 Isolate Unclassified
26 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
27 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
28 2928037797 Variovorax sp. 1126 Isolate Unclassified
29 2928044640 Variovorax sp. 1128 Isolate Unclassified
30 2928051484 Variovorax sp. 1133 Isolate Unclassified
31 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
32 2928070936 Variovorax gossypii 1167 Isolate Unclassified
33 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
34 2929520902 Variovorax beijingensis 502 Isolate Unclassified
35 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
36 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
37 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
38 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
39 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
40 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
41 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
42 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
43 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
44 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
45 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
46 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
47 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
48 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
49 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
50 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
51 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
52 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
53 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
54 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
55 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
56 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
57 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
58 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
83 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
103 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
108 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
111 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
112 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
141 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
157 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
158 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
159 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
160 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
161 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
162 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
163 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
164 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
165 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
166 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
167 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
168 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
169 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
170 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
171 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
172 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
174 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
185 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
217 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
218 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
219 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
220 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
221 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
222 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
223 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
224 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
225 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
226 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
227 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
228 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
229 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.97
Metatranscriptomes 0
Isolates 10.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 43.7
Nodule 1.03
Rhizoplane 4.63
Rhizosphere 37.28
Stem 0
Stem Tuber 0
Unclassified 13.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10030674 3300001979 Bacteria 1745
2 JGI25156J39149_1000031 3300002705 Bacteria 124983
3 JGI25154J39366_1000049 3300002738 Bacteria 124995
4 JGI25157J39369_1000041 3300002741 Bacteria 124982
5 JGI25150J39212_1002131 3300002774 Bacteria 5115
6 JGI25159J45721_1002209 3300002987 Bacteria 7541
7 JGI25159J45721_1002672 3300002987 Bacteria 6637
8 JGI25151J46595_10002462 3300003187 Bacteria 11106
9 JGI25151J46595_10003194 3300003187 Bacteria 9182
10 JGI25151J46595_10010100 3300003187 Bacteria 4416
11 JGI25151J46595_10016610 3300003187 Bacteria 3215
12 JGI25151J46595_10037325 3300003187 Bacteria 1823
13 JGI25153J46596_10007251 3300003215 Bacteria 5484
14 rootH1_10135574 3300003316 Bacteria 2546
15 JGI25160J50197_1000474 3300003354 Bacteria 24439
16 JGI25161J50226_1000042 3300003374 Bacteria 123841
17 Ga0055535_1000318 3300003761 Bacteria 48605
18 Ga0055542_1000022 3300003762 Bacteria 302315
19 Ga0055526_1002416 3300003771 Bacteria 12653
20 Ga0055526_1012079 3300003771 Bacteria 3809
21 Ga0055537_1000881 3300003773 Bacteria 14293
22 Ga0055537_1001282 3300003773 Bacteria 10429
23 Ga0055524_1000228 3300003775 Bacteria 59742
24 Ga0055536_1004327 3300003781 Bacteria 7304
25 Ga0055536_1005720 3300003781 Bacteria 5994
26 Ga0055534_1000614 3300003784 Bacteria 18415
27 Ga0055534_1000826 3300003784 Bacteria 14293
28 Ga0055534_1001568 3300003784 Bacteria 8899
29 Ga0055534_1002108 3300003784 Bacteria 7140
30 Ga0055534_1002420 3300003784 Bacteria 6471
31 Ga0055534_1003870 3300003784 Bacteria 4561
32 Ga0055528_1003173 3300003790 Bacteria 8409
33 Ga0055528_1003272 3300003790 Bacteria 8244
34 Ga0055530_10000666 3300003791 Bacteria 29345
35 Ga0055530_10003702 3300003791 Bacteria 8514
36 Ga0055530_10018989 3300003791 Bacteria 2097
37 Ga0055530_10021435 3300003791 Bacteria 1905
38 Ga0055540_1000010 3300003792 Bacteria 290865
39 Ga0055540_1002475 3300003792 Bacteria 9708
40 Ga0055540_1004023 3300003792 Bacteria 6845
41 Ga0055540_1004376 3300003792 Bacteria 6402
42 Ga0055531_10001737 3300003794 Bacteria 15595
43 Ga0055531_10005022 3300003794 Bacteria 7843
44 Ga0055531_10006333 3300003794 Bacteria 6738
45 Ga0055531_10010242 3300003794 Bacteria 4686
46 Ga0055543_1001010 3300004625 Bacteria 12544
47 Ga0055543_1001710 3300004625 Bacteria 8275
48 Ga0055543_1001757 3300004625 Bacteria 8100
49 Ga0065165_1004672 3300005262 Bacteria 8275
50 Ga0065165_1007916 3300005262 Bacteria 5099
51 Ga0065165_1010309 3300005262 Bacteria 4057
52 Ga0065165_1017351 3300005262 Bacteria 2656
53 Ga0065714_10005438 3300005288 Bacteria 4585
54 Ga0065704_10094233 3300005289 Bacteria 2554
55 Ga0070671_100038741 3300005355 Bacteria 3956
56 Ga0070674_100159535 3300005356 Bacteria 1710
57 Ga0070667_100009333 3300005367 Bacteria 8134
58 Ga0070678_100102135 3300005456 Bacteria 2224
59 Ga0070678_100207618 3300005456 Bacteria 1621
60 Ga0070662_100067998 3300005457 Bacteria 2617
61 Ga0068853_100018186 3300005539 Bacteria 5813
62 Ga0068853_100101997 3300005539 Bacteria 2539
63 Ga0070665_100021214 3300005548 Bacteria 6530
64 Ga0070664_100019897 3300005564 Bacteria 5525
65 Ga0068857_100117751 3300005577 Bacteria 2390
66 Ga0068862_100422515 3300005844 Bacteria 1251
67 Ga0075365_10007752 3300006038 Bacteria 6044
68 Ga0075364_10005777 3300006051 Bacteria 7217
69 Ga0075364_10028222 3300006051 Bacteria 3591
70 Ga0075432_10006436 3300006058 Bacteria 3997
71 Ga0075362_10035774 3300006177 Bacteria 2169
72 Ga0075366_10003770 3300006195 Bacteria 8056
73 Ga0075366_10009816 3300006195 Bacteria 5354
74 Ga0075366_10017214 3300006195 Bacteria 4157
75 Ga0075366_10056338 3300006195 Bacteria 2335
76 Ga0075370_10005803 3300006353 Bacteria 6170
77 Ga0075370_10008221 3300006353 Bacteria 5356
78 Ga0075370_10015981 3300006353 Bacteria 4031
79 Ga0075370_10074890 3300006353 Bacteria 1940
80 Ga0079104_1014228 3300006946 Bacteria 2408
81 Ga0099826_10003829 3300006948 Bacteria 10360
82 Ga0105244_10005123 3300009036 Bacteria 8792
83 Ga0105240_10161843 3300009093 Bacteria 2658
84 Ga0105245_10119123 3300009098 Bacteria 2464
85 Ga0105245_10280927 3300009098 Bacteria 1627
86 Ga0114129_10522284 3300009147 Bacteria 1548
87 Ga0105243_10002687 3300009148 Bacteria 14776
88 Ga0105243_10003440 3300009148 Bacteria 12807
89 Ga0105243_10057263 3300009148 Bacteria 3103
90 Ga0105237_10026693 3300009545 Bacteria 5902
91 Ga0105238_10110847 3300009551 Bacteria 2725
92 Ga0105239_10196613 3300010375 Bacteria 2258
93 Ga0157373_10015854 3300013100 Bacteria 5501
94 Ga0157369_10098552 3300013105 Bacteria 3117
95 Ga0157378_10070169 3300013297 Bacteria 3145
96 Ga0157375_10205806 3300013308 Bacteria 2124
97 Ga0182008_10003502 3300014497 Bacteria 9467
98 Ga0182008_10004612 3300014497 Bacteria 8023
99 Ga0182008_10009910 3300014497 Bacteria 5123
100 Ga0182008_10039407 3300014497 Bacteria 2361
101 Ga0182006_1003497 3300015261 Bacteria 8011
102 Ga0182007_10001359 3300015262 Bacteria 13193
103 Ga0182007_10007788 3300015262 Bacteria 4453
104 Ga0183362_10001 3300015683 Bacteria 2046624
105 Ga0163161_10001107 3300017792 Bacteria 20364
106 Ga0163161_10014906 3300017792 Bacteria 5415
107 Ga0163161_10017287 3300017792 Bacteria 5047
108 Ga0213872_10000339 3300021361 Bacteria 39618
109 Ga0209435_100014 3300025206 Bacteria 322129
110 Ga0209672_101114 3300025228 Bacteria 11298
111 Ga0209147_103059 3300025229 Bacteria 3528
112 Ga0209258_100009 3300025242 Bacteria 996276
113 Ga0207425_1000798 3300025245 Bacteria 16022
114 Ga0207425_1001905 3300025245 Bacteria 7922
115 Ga0207425_1002594 3300025245 Bacteria 6268
116 Ga0209646_1000001 3300025246 Bacteria 3092932
117 Ga0209026_1000073 3300025250 Bacteria 205399
118 Ga0209148_1000007 3300025254 Bacteria 1592273
119 Ga0209759_1000013 3300025256 Bacteria 399300
120 Ga0209129_1000024 3300025258 Bacteria 417268
121 Ga0209129_1000085 3300025258 Bacteria 181765
122 Ga0209129_1000783 3300025258 Bacteria 20092
123 Ga0209565_1000046 3300025263 Bacteria 226073
124 Ga0209565_1000518 3300025263 Bacteria 27559
125 Ga0209565_1000824 3300025263 Bacteria 17629
126 Ga0209565_1001635 3300025263 Bacteria 9430
127 Ga0209565_1002940 3300025263 Bacteria 5800
128 Ga0209673_1000008 3300025273 Bacteria 626013
129 Ga0209673_1000053 3300025273 Bacteria 279449
130 Ga0209673_1000288 3300025273 Bacteria 94017
131 Ga0209673_1003947 3300025273 Bacteria 8289
132 Ga0209130_1000216 3300025284 Bacteria 75536
133 Ga0209130_1000283 3300025284 Bacteria 62554
134 Ga0209130_1000578 3300025284 Bacteria 35635
135 Ga0209130_1000963 3300025284 Bacteria 22711
136 Ga0209675_1000010 3300025291 Bacteria 541927
137 Ga0209675_1000400 3300025291 Bacteria 35775
138 Ga0209675_1003009 3300025291 Bacteria 8289
139 Ga0209675_1003161 3300025291 Bacteria 8001
140 Ga0209675_1003275 3300025291 Bacteria 7796
141 Ga0209675_1006494 3300025291 Bacteria 4673
142 Ga0209676_1000007 3300025292 Bacteria 1029371
143 Ga0209676_1000108 3300025292 Bacteria 221168
144 Ga0209676_1001037 3300025292 Bacteria 32207
145 Ga0209676_1001793 3300025292 Bacteria 18020
146 Ga0209676_1004495 3300025292 Bacteria 7747
147 Ga0209676_1009475 3300025292 Bacteria 4195
148 Ga0209676_1013656 3300025292 Bacteria 3108
149 Ga0209676_1014854 3300025292 Bacteria 2901
150 Ga0209025_1000122 3300025294 Bacteria 206064
151 Ga0209025_1001124 3300025294 Bacteria 38313
152 Ga0209025_1001282 3300025294 Bacteria 34517
153 Ga0209025_1002450 3300025294 Bacteria 19609
154 Ga0209025_1003658 3300025294 Bacteria 14243
155 Ga0209025_1040474 3300025294 Bacteria 2015
156 Ga0209564_1000472 3300025295 Bacteria 67352
157 Ga0209564_1000481 3300025295 Bacteria 66411
158 Ga0209564_1001825 3300025295 Bacteria 19536
159 Ga0209564_1001908 3300025295 Bacteria 18637
160 Ga0209564_1026383 3300025295 Bacteria 1921
161 Ga0209758_1000049 3300025297 Bacteria 345104
162 Ga0209050_1000002 3300025298 Bacteria 1792849
163 Ga0209050_1000003 3300025298 Bacteria 1609245
164 Ga0209050_1001046 3300025298 Bacteria 34171
165 Ga0209050_1004265 3300025298 Bacteria 9817
166 Ga0209050_1006360 3300025298 Bacteria 7019
167 Ga0209050_1017089 3300025298 Bacteria 2918
168 Ga0209256_1000001 3300025299 Bacteria 2166974
169 Ga0209256_1000098 3300025299 Bacteria 204152
170 Ga0209256_1000464 3300025299 Bacteria 61298
171 Ga0207426_1000038 3300025302 Bacteria 441522
172 Ga0207426_1000053 3300025302 Bacteria 384818
173 Ga0207426_1000817 3300025302 Bacteria 33418
174 Ga0207426_1002019 3300025302 Bacteria 14310
175 Ga0209051_1000002 3300025303 Bacteria 1631846
176 Ga0209051_1000003 3300025303 Bacteria 1609245
177 Ga0209051_1000590 3300025303 Bacteria 42835
178 Ga0209051_1000939 3300025303 Bacteria 28775
179 Ga0209051_1000976 3300025303 Bacteria 27866
180 Ga0209051_1006689 3300025303 Bacteria 6448
181 Ga0209051_1010982 3300025303 Bacteria 4516
182 Ga0209257_1000002 3300025304 Bacteria 1767052
183 Ga0209257_1000020 3300025304 Bacteria 773356
184 Ga0209257_1001281 3300025304 Bacteria 30768
185 Ga0209257_1005717 3300025304 Bacteria 8532
186 Ga0209257_1005969 3300025304 Bacteria 8167
187 Ga0209257_1006887 3300025304 Bacteria 7126
188 Ga0209257_1009647 3300025304 Bacteria 5106
189 Ga0207655_1001943 3300025728 Bacteria 17680
190 Ga0207695_10241384 3300025913 Bacteria 1708
191 Ga0207690_10051373 3300025932 Bacteria 2757
192 Ga0207706_10010163 3300025933 Bacteria 8614
193 Ga0207709_10001107 3300025935 Bacteria 19740
194 Ga0207709_10011461 3300025935 Bacteria 4891
195 Ga0207709_10015578 3300025935 Bacteria 4216
196 Ga0207669_10123691 3300025937 Bacteria 1762
197 Ga0207669_10196924 3300025937 Bacteria 1459
198 Ga0207679_10147833 3300025945 Bacteria 1908
199 Ga0207648_10120456 3300026089 Bacteria 2307
200 Ga0207648_10192532 3300026089 Bacteria 1808
201 Ga0207674_10276408 3300026116 Bacteria 1627
202 Ga0207683_10119317 3300026121 Bacteria 2367
203 Ga0207683_10131272 3300026121 Bacteria 2253
204 Ga0209282_1009841 3300027666 Bacteria 6040
205 Ga0268266_10044876 3300028379 Bacteria 3779
206 Ga0268266_10064290 3300028379 Bacteria 3169
207 Ga0268265_10403302 3300028380 Bacteria 1264
208 Ga0307517_10114587 3300028786 Bacteria 2028
209 Ga0307515_10000084 3300028794 Bacteria 221434
210 Ga0307515_10000265 3300028794 Bacteria 129554
211 Ga0316180_1048297 3300030736 Bacteria 1845
212 Ga0316182_1037537 3300030745 Bacteria 4374
213 Ga0265327_10002000 3300031251 Bacteria 23042
214 Ga0265327_10050233 3300031251 Bacteria 2183
215 Ga0307513_10000008 3300031456 Bacteria 442128
216 Ga0307513_10000011 3300031456 Bacteria 354929
217 Ga0307513_10002929 3300031456 Bacteria 23340
218 Ga0307513_10016692 3300031456 Bacteria 8839
219 Ga0307513_10068505 3300031456 Bacteria 3717
220 Ga0307509_10095708 3300031507 Bacteria 3024
221 Ga0307408_100013576 3300031548 Bacteria 5408
222 Ga0307408_100107655 3300031548 Bacteria 2135
223 Ga0307514_10000319 3300031649 Bacteria 115327
224 Ga0307516_10010004 3300031730 Bacteria 10501
225 Ga0307516_10048869 3300031730 Bacteria 4161
226 Ga0307405_10036413 3300031731 Bacteria 2948
227 Ga0307413_10228699 3300031824 Bacteria 1364
228 Ga0307406_10045251 3300031901 Bacteria 2762
229 Ga0307412_10019540 3300031911 Bacteria 4105
230 Ga0307412_10038663 3300031911 Bacteria 3074
231 Ga0307412_10047437 3300031911 Bacteria 2822
232 Ga0307412_10144395 3300031911 Bacteria 1747
233 Ga0307414_10177305 3300032004 Bacteria 1710
234 Ga0307414_10201427 3300032004 Bacteria 1619
235 Ga0307411_10068916 3300032005 Bacteria 2386
236 Ga0395905_0132193 3300037471 Bacteria 2347
237 Ga0395905_0291677 3300037471 Bacteria 1518
238 Ga0436361_0265063 3300039447 Bacteria 36678
239 Ga0436361_0820841 3300039447 Bacteria 4374
240 Ga0439436_0000941 3300041404 Bacteria 8019
241 Ga0439436_0004681 3300041404 Bacteria 4197
242 Ga0439439_0011822 3300041406 Bacteria 2105
243 Ga0439447_014914 3300041407 Bacteria 2168
244 Ga0439461_0010217 3300041410 Bacteria 1719
245 Ga0439465_0000881 3300041413 Bacteria 9486
246 Ga0451791_1071272 3300041451 Bacteria 1795
247 Ga0439431_0000136 3300041997 Bacteria 13215
248 Ga0439431_0054424 3300041997 Bacteria 1044
249 Ga0439433_0000676 3300041999 Bacteria 6577
250 Ga0439442_001616 3300042002 Bacteria 4416
251 Ga0439442_002772 3300042002 Bacteria 3440
252 Ga0439445_0002354 3300042004 Bacteria 4200
253 Ga0439432_001610 3300042006 Bacteria 8457
254 Ga0439449_0001881 3300042007 Bacteria 8268
255 Ga0439449_0003921 3300042007 Bacteria 5769
256 Ga0439449_0036263 3300042007 Bacteria 1834
257 Ga0439452_001605 3300042010 Bacteria 8930
258 Ga0439457_001194 3300042014 Bacteria 7822
259 Ga0439462_0007945 3300042015 Bacteria 2665
260 Ga0439462_0017002 3300042015 Bacteria 1883
261 Ga0450890_003457 3300042127 Bacteria 2096
262 Ga0450899_001703 3300042135 Bacteria 2432
263 Ga0439446_0007098 3300042156 Bacteria 2937
264 Ga0450908_000659 3300042184 Bacteria 6623
265 Ga0450908_003584 3300042184 Bacteria 3023
266 Ga0439434_0001604 3300042435 Bacteria 6530
267 Ga0439434_0002408 3300042435 Bacteria 5436
268 Ga0439434_0012076 3300042435 Bacteria 2554
269 Ga0450918_006579 3300042531 Bacteria 2067
270 Ga0451577_0007326 3300042876 Bacteria 10858
271 Ga0451577_0033651 3300042876 Bacteria 4621
272 Ga0451577_0048478 3300042876 Bacteria 3795
273 Ga0451577_0069544 3300042876 Bacteria 3139
274 Ga0466965_0048162 3300044683 Bacteria 2111
275 Ga0453684_0001396 3300044712 Bacteria 69884
276 Ga0466968_0015412 3300044735 Bacteria 3029
277 Ga0451576_0075029 3300045051 Bacteria 3519
278 Ga0495590_0020123 3300046457 Bacteria 2372
279 Ga0495639_0004258 3300046475 Bacteria 6140
280 Ga0495620_0008213 3300046515 Bacteria 5613
281 Ga0495637_0003393 3300046520 Bacteria 8456
282 Ga0495663_0004089 3300046525 Bacteria 4131
283 Ga0495654_0002245 3300046530 Bacteria 12513
284 Ga0495625_0000870 3300046660 Bacteria 41078
285 Ga0495625_0051456 3300046660 Bacteria 2953
286 Ga0495588_0062231 3300046674 Bacteria 1934
287 Ga0495670_0021930 3300046691 Bacteria 3153
288 Ga0495670_0024675 3300046691 Bacteria 2972
289 Ga0495671_0002650 3300046692 Bacteria 11246
290 Ga0496100_0009445 3300048903 Bacteria 5483
291 Ga0496101_0006461 3300048904 Bacteria 7545
292 Ga0496102_0010766 3300048905 Bacteria 7878
293 Ga0496102_0093120 3300048905 Bacteria 2791
294 Ga0496102_0254974 3300048905 Bacteria 1654
295 Ga0496103_0033763 3300048906 Bacteria 3126
296 Ga0496104_0022206 3300048907 Bacteria 5828
297 Ga0496105_0004127 3300048908 Bacteria 10888
298 Ga0496107_0075914 3300048910 Bacteria 2447
299 Ga0496108_0281626 3300048911 Bacteria 1447
300 Ga0496110_0066009 3300048913 Bacteria 3199
301 Ga0496111_0041538 3300048914 Bacteria 3300
302 Ga0496114_0051490 3300048917 Bacteria 3428
303 Ga0496114_0369516 3300048917 Bacteria 1269
304 Ga0496117_0011404 3300048920 Bacteria 7961
305 Ga0496118_0011891 3300048921 Bacteria 8428
306 Ga0496118_0019444 3300048921 Bacteria 6070
307 Ga0496121_0053687 3300048924 Bacteria 3374
308 Ga0496122_0000998 3300048925 Bacteria 50283
309 Ga0496122_0022445 3300048925 Bacteria 5610
310 Ga0496123_0000045 3300048926 Bacteria 249294
311 Ga0496123_0020616 3300048926 Bacteria 5152
312 Ga0496124_0038908 3300048927 Bacteria 4126
313 Ga0496124_0202267 3300048927 Bacteria 1509
314 Ga0496125_0012583 3300048928 Bacteria 8383
315 Ga0496125_0128661 3300048928 Bacteria 1788
316 Ga0501035_0046871 3300049822 Bacteria 3885
317 nmdc:mga03683_4753_c1 3300050489 Bacteria 4531
318 nmdc:mga03683_5261_c1 3300050489 Bacteria 3148
319 nmdc:mga03683_8148_c1 3300050489 Bacteria 3671
320 nmdc:mga03n38_6656_c1 3300050490 Bacteria 4034
321 nmdc:mga00v17_207518_c1 3300050491 Bacteria 1267
322 nmdc:mga0yw44_4790_c1 3300050492 Bacteria 6272
323 nmdc:mga0k408_131449_c1 3300050493 Bacteria 1486
324 nmdc:mga0k408_142075_c1 3300050493 Bacteria 1428
325 nmdc:mga0k408_16726_c1 3300050493 Bacteria 4076
326 nmdc:mga0k408_43625_c1 3300050493 Bacteria 2585
327 nmdc:mga07m45_113976_c1 3300050496 Bacteria 1558
328 nmdc:mga07m45_30562_c1 3300050496 Bacteria 2984
329 nmdc:mga07m45_32216_c1 3300050496 Bacteria 2908
330 nmdc:mga07m45_53053_c1 3300050496 Bacteria 2291
331 nmdc:mga07m45_7630_c1 3300050496 Bacteria 5535
332 nmdc:mga07m45_9617_c1 3300050496 Bacteria 5024
333 nmdc:mga0sz30_8443_c1 3300050516 Bacteria 3890
334 Ga0500610_0002946 3300053079 Bacteria 6407
335 Ga0500644_0054010 3300053088 Bacteria 1389
336 Ga0500646_0022185 3300053090 Bacteria 1697
337 Ga0500566_0071939 3300053094 Bacteria 1940
338 Ga0500641_0062964 3300053096 Bacteria 1548
339 Ga0500593_000173 3300053117 Bacteria 26150
340 Ga0500593_001116 3300053117 Bacteria 9668
341 Ga0500593_001229 3300053117 Bacteria 9284
342 Ga0500607_001787 3300053121 Bacteria 18576
343 Ga0500618_004835 3300053125 Bacteria 4209
344 Ga0500559_0004716 3300053136 Bacteria 6416
345 Ga0500559_0011229 3300053136 Bacteria 3828
346 Ga0500559_0028097 3300053136 Bacteria 2402
347 Ga0500590_004451 3300053148 Bacteria 6617
348 Ga0500645_000326 3300053730 Bacteria 33814
349 Ga0500645_022939 3300053730 Bacteria 1915
350 Ga0500661_003878 3300055283 Bacteria 2804

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041997 Ga0439431_0054424 Ga0439431_0054424_61_1017 308
2 3300048917 Ga0496114_0369516 Ga0496114_0369516_14_979 321
3 3300048911 Ga0496108_0281626 Ga0496108_0281626_460_1434 324
4 3300026089 Ga0207648_10120456 Ga0207648_101204563 330
5 iso_pu_bacteria 2887375801 2887381270 335
6 3300050491 nmdc:mga00v17_207518_c1 nmdc:mga00v17_207518_c1_175_1233 342
7 3300039447 Ga0436361_0820841 Ga0436361_0820841_997_2037 345
8 3300046691 Ga0495670_0021930 Ga0495670_0021930_1404_2447 345
9 3300044735 Ga0466968_0015412 Ga0466968_0015412_1660_2703 346
10 3300042184 Ga0450908_003584 Ga0450908_003584_542_1591 347
11 iso_pu_bacteria 2511231002 2511244145 348
12 3300025292 Ga0209676_1014854 Ga0209676_10148543 349
13 3300005548 Ga0070665_100021214 Ga0070665_1000212142 350
14 3300025937 Ga0207669_10196924 Ga0207669_101969242 350
15 3300028379 Ga0268266_10044876 Ga0268266_100448762 350
16 iso_pu_bacteria 2643221683 2644464546 350
17 3300042876 Ga0451577_0033651 Ga0451577_0033651_2266_3321 351
18 iso_pu_bacteria 2842733646 2842734315 351
19 iso_pu_bacteria 2842747753 2842749434 351
20 3300002705 JGI25156J39149_1000031 JGI25156J39149_100003132 352
21 3300002738 JGI25154J39366_1000049 JGI25154J39366_100004981 352
22 3300002741 JGI25157J39369_1000041 JGI25157J39369_100004181 352
23 3300002774 JGI25150J39212_1002131 JGI25150J39212_10021315 352
24 3300002987 JGI25159J45721_1002672 JGI25159J45721_10026728 352
25 3300003187 JGI25151J46595_10010100 JGI25151J46595_100101003 352
26 3300003187 JGI25151J46595_10016610 JGI25151J46595_100166104 352
27 3300003187 JGI25151J46595_10037325 JGI25151J46595_100373252 352
28 3300003354 JGI25160J50197_1000474 JGI25160J50197_10004748 352
29 3300003374 JGI25161J50226_1000042 JGI25161J50226_100004247 352
30 3300003771 Ga0055526_1002416 Ga0055526_10024169 352
31 3300003771 Ga0055526_1012079 Ga0055526_10120793 352
32 3300003773 Ga0055537_1001282 Ga0055537_10012829 352
33 3300003775 Ga0055524_1000228 Ga0055524_10002289 352
34 3300003784 Ga0055534_1001568 Ga0055534_10015682 352
35 3300003784 Ga0055534_1003870 Ga0055534_10038702 352
36 3300003790 Ga0055528_1003173 Ga0055528_10031737 352
37 3300003791 Ga0055530_10000666 Ga0055530_100006669 352
38 3300003791 Ga0055530_10018989 Ga0055530_100189892 352
39 3300003792 Ga0055540_1000010 Ga0055540_100001055 352
40 3300003794 Ga0055531_10001737 Ga0055531_1000173716 352
41 3300004625 Ga0055543_1001010 Ga0055543_10010105 352
42 3300005262 Ga0065165_1007916 Ga0065165_10079165 352
43 3300005262 Ga0065165_1010309 Ga0065165_10103095 352
44 3300005262 Ga0065165_1017351 Ga0065165_10173513 352
45 3300005539 Ga0068853_100101997 Ga0068853_1001019972 352
46 3300006051 Ga0075364_10005777 Ga0075364_100057772 352
47 3300006195 Ga0075366_10003770 Ga0075366_100037702 352
48 3300006195 Ga0075366_10056338 Ga0075366_100563383 352
49 3300006946 Ga0079104_1014228 Ga0079104_10142281 352
50 3300009147 Ga0114129_10522284 Ga0114129_105222841 352
51 3300025206 Ga0209435_100014 Ga0209435_10001481 352
52 3300025245 Ga0207425_1001905 Ga0207425_10019056 352
53 3300025246 Ga0209646_1000001 Ga0209646_100000182 352
54 3300025250 Ga0209026_1000073 Ga0209026_100007381 352
55 3300025256 Ga0209759_1000013 Ga0209759_100001382 352
56 3300025263 Ga0209565_1000824 Ga0209565_100082410 352
57 3300025263 Ga0209565_1001635 Ga0209565_10016357 352
58 3300025273 Ga0209673_1000008 Ga0209673_1000008472 352
59 3300025284 Ga0209130_1000216 Ga0209130_100021629 352
60 3300025284 Ga0209130_1000578 Ga0209130_10005789 352
61 3300025291 Ga0209675_1000400 Ga0209675_100040031 352
62 3300025291 Ga0209675_1006494 Ga0209675_10064943 352
63 3300025292 Ga0209676_1000007 Ga0209676_100000781 352
64 3300025292 Ga0209676_1009475 Ga0209676_10094754 352
65 3300025294 Ga0209025_1002450 Ga0209025_10024505 352
66 3300025294 Ga0209025_1003658 Ga0209025_10036589 352
67 3300025295 Ga0209564_1001825 Ga0209564_100182510 352
68 3300025295 Ga0209564_1001908 Ga0209564_100190813 352
69 3300025295 Ga0209564_1026383 Ga0209564_10263833 352
70 3300025298 Ga0209050_1000003 Ga0209050_10000031427 352
71 3300025298 Ga0209050_1004265 Ga0209050_10042653 352
72 3300025299 Ga0209256_1000001 Ga0209256_10000011429 352
73 3300025302 Ga0207426_1000817 Ga0207426_100081716 352
74 3300025302 Ga0207426_1002019 Ga0207426_10020199 352
75 3300025303 Ga0209051_1000003 Ga0209051_10000031427 352
76 3300025304 Ga0209257_1000020 Ga0209257_100002081 352
77 3300025304 Ga0209257_1009647 Ga0209257_10096474 352
78 3300028794 Ga0307515_10000084 Ga0307515_10000084104 352
79 3300031456 Ga0307513_10000008 Ga0307513_10000008402 352
80 3300031456 Ga0307513_10000011 Ga0307513_10000011359 352
81 3300031456 Ga0307513_10002929 Ga0307513_100029299 352
82 3300031456 Ga0307513_10016692 Ga0307513_100166927 352
83 3300031548 Ga0307408_100013576 Ga0307408_1000135763 352
84 3300031649 Ga0307514_10000319 Ga0307514_1000031958 352
85 3300031730 Ga0307516_10010004 Ga0307516_1001000413 352
86 3300031730 Ga0307516_10048869 Ga0307516_100488692 352
87 3300031911 Ga0307412_10144395 Ga0307412_101443953 352
88 3300037471 Ga0395905_0132193 Ga0395905_0132193_497_1555 352
89 3300041451 Ga0451791_1071272 Ga0451791_1071272_207_1265 352
90 3300042007 Ga0439449_0003921 Ga0439449_0003921_2537_3598 352
91 3300042876 Ga0451577_0048478 Ga0451577_0048478_1296_2354 352
92 3300042876 Ga0451577_0069544 Ga0451577_0069544_1367_2425 352
93 3300044712 Ga0453684_0001396 Ga0453684_0001396_67543_68601 352
94 3300045051 Ga0451576_0075029 Ga0451576_0075029_1297_2355 352
95 3300046530 Ga0495654_0002245 Ga0495654_0002245_6760_7818 352
96 3300049822 Ga0501035_0046871 Ga0501035_0046871_2344_3402 352
97 3300050493 nmdc:mga0k408_131449_c1 nmdc:mga0k408_131449_c1_327_1388 352
98 3300050493 nmdc:mga0k408_142075_c1 nmdc:mga0k408_142075_c1_271_1329 352
99 3300053088 Ga0500644_0054010 Ga0500644_0054010_268_1326 352
100 3300053094 Ga0500566_0071939 Ga0500566_0071939_181_1239 352
101 3300053096 Ga0500641_0062964 Ga0500641_0062964_293_1351 352
102 3300053117 Ga0500593_001116 Ga0500593_001116_8488_9546 352
103 3300053148 Ga0500590_004451 Ga0500590_004451_638_1696 352
104 3300053730 Ga0500645_000326 Ga0500645_000326_4186_5244 352
105 3300053730 Ga0500645_022939 Ga0500645_022939_455_1513 352
106 3300055283 Ga0500661_003878 Ga0500661_003878_866_1924 352
107 iso_pu_bacteria 2885192300 2885197901 352
108 3300003187 JGI25151J46595_10003194 JGI25151J46595_100031949 353
109 3300005355 Ga0070671_100038741 Ga0070671_1000387412 353
110 3300005456 Ga0070678_100207618 Ga0070678_1002076182 353
111 3300005844 Ga0068862_100422515 Ga0068862_1004225151 353
112 3300009098 Ga0105245_10280927 Ga0105245_102809272 353
113 3300013297 Ga0157378_10070169 Ga0157378_100701693 353
114 3300013308 Ga0157375_10205806 Ga0157375_102058062 353
115 3300025258 Ga0209129_1000783 Ga0209129_100078313 353
116 3300025294 Ga0209025_1001282 Ga0209025_100128230 353
117 3300028379 Ga0268266_10064290 Ga0268266_100642902 353
118 3300028786 Ga0307517_10114587 Ga0307517_101145872 353
119 3300031507 Ga0307509_10095708 Ga0307509_100957082 353
120 3300042876 Ga0451577_0007326 Ga0451577_0007326_9012_10073 353
121 3300050493 nmdc:mga0k408_43625_c1 nmdc:mga0k408_43625_c1_1374_2468 353
122 iso_pu_bacteria 2643221628 2644162403 353
123 iso_pu_bacteria 2842677519 2842682308 353
124 iso_pu_bacteria 2904449895 2904450512 353
125 iso_pu_bacteria 2904456579 2904456664 353
126 iso_pu_bacteria 2919462493 2919462949 353
127 iso_pu_bacteria 2929520902 2929521227 353
128 iso_pu_bacteria 2945945610 2945949247 353
129 iso_pu_bacteria 2945972063 2945973291 353
130 iso_pu_bacteria 2945984333 2945990950 353
131 iso_pu_bacteria 2954767861 2954768612 353
132 3300003781 Ga0055536_1004327 Ga0055536_10043273 354
133 3300003792 Ga0055540_1004023 Ga0055540_10040239 354
134 3300006177 Ga0075362_10035774 Ga0075362_100357741 354
135 3300006195 Ga0075366_10009816 Ga0075366_100098164 354
136 3300006353 Ga0075370_10074890 Ga0075370_100748903 354
137 3300009148 Ga0105243_10002687 Ga0105243_100026877 354
138 3300009148 Ga0105243_10057263 Ga0105243_100572632 354
139 3300025292 Ga0209676_1001037 Ga0209676_100103730 354
140 3300025303 Ga0209051_1000590 Ga0209051_100059030 354
141 3300025304 Ga0209257_1006887 Ga0209257_10068879 354
142 3300025935 Ga0207709_10001107 Ga0207709_1000110715 354
143 3300025935 Ga0207709_10015578 Ga0207709_100155783 354
144 3300028380 Ga0268265_10403302 Ga0268265_104033022 354
145 3300031731 Ga0307405_10036413 Ga0307405_100364132 354
146 3300037471 Ga0395905_0291677 Ga0395905_0291677_198_1262 354
147 3300046457 Ga0495590_0020123 Ga0495590_0020123_118_1182 354
148 3300050493 nmdc:mga0k408_16726_c1 nmdc:mga0k408_16726_c1_1230_2297 354
149 3300050496 nmdc:mga07m45_30562_c1 nmdc:mga07m45_30562_c1_253_1320 354
150 3300050496 nmdc:mga07m45_7630_c1 nmdc:mga07m45_7630_c1_1972_3066 354
151 iso_pu_bacteria 2513020051 2513227807 354
152 iso_pu_bacteria 2599185214 2599625450 354
153 iso_pu_bacteria 2599185226 2599673463 354
154 iso_pu_bacteria 2599185227 2599683133 354
155 iso_pu_bacteria 2599185229 2599695379 354
156 iso_pu_bacteria 2643221672 2644396421 354
157 iso_pu_bacteria 2738541277 2738719063 354
158 iso_pu_bacteria 2738543019 2739281825 354
159 iso_pu_bacteria 2818991446 2819599554 354
160 iso_pu_bacteria 2899924645 2899927816 354
161 iso_pu_bacteria 2904541872 2904544492 354
162 iso_pu_bacteria 2928037797 2928041906 354
163 iso_pu_bacteria 2928044640 2928049470 354
164 iso_pu_bacteria 2928051484 2928051854 354
165 iso_pu_bacteria 2928064002 2928065453 354
166 iso_pu_bacteria 2928070936 2928072910 354
167 iso_pu_bacteria 2929160207 2929161938 354
168 iso_pu_bacteria 2945909444 2945913653 354
169 3300005356 Ga0070674_100159535 Ga0070674_1001595352 355
170 3300005367 Ga0070667_100009333 Ga0070667_1000093334 355
171 3300005456 Ga0070678_100102135 Ga0070678_1001021353 355
172 3300014497 Ga0182008_10009910 Ga0182008_100099103 355
173 3300015262 Ga0182007_10007788 Ga0182007_100077883 355
174 3300015683 Ga0183362_10001 Ga0183362_1000170 355
175 3300017792 Ga0163161_10017287 Ga0163161_100172875 355
176 3300025937 Ga0207669_10123691 Ga0207669_101236912 355
177 3300026121 Ga0207683_10119317 Ga0207683_101193173 355
178 3300026121 Ga0207683_10131272 Ga0207683_101312722 355
179 3300031251 Ga0265327_10002000 Ga0265327_1000200014 355
180 3300031251 Ga0265327_10050233 Ga0265327_100502333 355
181 3300046475 Ga0495639_0004258 Ga0495639_0004258_2803_3870 355
182 3300046525 Ga0495663_0004089 Ga0495663_0004089_228_1301 355
183 3300048903 Ga0496100_0009445 Ga0496100_0009445_648_1715 355
184 3300048905 Ga0496102_0093120 Ga0496102_0093120_601_1668 355
185 3300048905 Ga0496102_0254974 Ga0496102_0254974_208_1278 355
186 3300048906 Ga0496103_0033763 Ga0496103_0033763_1793_2860 355
187 3300048907 Ga0496104_0022206 Ga0496104_0022206_836_1903 355
188 3300048908 Ga0496105_0004127 Ga0496105_0004127_6699_7766 355
189 3300048910 Ga0496107_0075914 Ga0496107_0075914_329_1396 355
190 3300048913 Ga0496110_0066009 Ga0496110_0066009_187_1254 355
191 3300048914 Ga0496111_0041538 Ga0496111_0041538_2220_3287 355
192 3300048917 Ga0496114_0051490 Ga0496114_0051490_116_1183 355
193 3300048925 Ga0496122_0000998 Ga0496122_0000998_25046_26116 355
194 3300048926 Ga0496123_0000045 Ga0496123_0000045_24984_26054 355
195 3300048927 Ga0496124_0202267 Ga0496124_0202267_219_1289 355
196 3300053090 Ga0500646_0022185 Ga0500646_0022185_96_1166 355
197 3300053136 Ga0500559_0004716 Ga0500559_0004716_1937_3007 355
198 3300053136 Ga0500559_0028097 Ga0500559_0028097_737_1807 355
199 iso_pu_bacteria 2831265667 2831271173 355
200 iso_pu_bacteria 2838054893 2838055761 355
201 3300003784 Ga0055534_1000614 Ga0055534_100061420 356
202 3300006353 Ga0075370_10015981 Ga0075370_100159815 356
203 3300014497 Ga0182008_10003502 Ga0182008_100035029 356
204 3300014497 Ga0182008_10039407 Ga0182008_100394074 356
205 3300025291 Ga0209675_1003161 Ga0209675_10031619 356
206 3300025292 Ga0209676_1013656 Ga0209676_10136563 356
207 3300025294 Ga0209025_1040474 Ga0209025_10404743 356
208 3300025298 Ga0209050_1017089 Ga0209050_10170893 356
209 3300025303 Ga0209051_1010982 Ga0209051_10109826 356
210 3300025304 Ga0209257_1005717 Ga0209257_10057174 356
211 3300026116 Ga0207674_10276408 Ga0207674_102764081 356
212 3300028794 Ga0307515_10000265 Ga0307515_1000026587 356
213 3300031456 Ga0307513_10068505 Ga0307513_100685053 356
214 3300041404 Ga0439436_0000941 Ga0439436_0000941_5041_6117 356
215 3300041406 Ga0439439_0011822 Ga0439439_0011822_60_1136 356
216 3300041407 Ga0439447_014914 Ga0439447_014914_1009_2085 356
217 3300041410 Ga0439461_0010217 Ga0439461_0010217_164_1240 356
218 3300041413 Ga0439465_0000881 Ga0439465_0000881_822_1898 356
219 3300041997 Ga0439431_0000136 Ga0439431_0000136_2629_3705 356
220 3300041999 Ga0439433_0000676 Ga0439433_0000676_1071_2147 356
221 3300042002 Ga0439442_002772 Ga0439442_002772_575_1651 356
222 3300042004 Ga0439445_0002354 Ga0439445_0002354_2824_3900 356
223 3300042006 Ga0439432_001610 Ga0439432_001610_5372_6448 356
224 3300042007 Ga0439449_0001881 Ga0439449_0001881_4871_5947 356
225 3300042007 Ga0439449_0036263 Ga0439449_0036263_310_1386 356
226 3300042010 Ga0439452_001605 Ga0439452_001605_5441_6517 356
227 3300042014 Ga0439457_001194 Ga0439457_001194_4948_6024 356
228 3300042015 Ga0439462_0007945 Ga0439462_0007945_240_1316 356
229 3300042015 Ga0439462_0017002 Ga0439462_0017002_358_1434 356
230 3300042127 Ga0450890_003457 Ga0450890_003457_16_1110 356
231 3300042135 Ga0450899_001703 Ga0450899_001703_879_1955 356
232 3300042156 Ga0439446_0007098 Ga0439446_0007098_1146_2222 356
233 3300042435 Ga0439434_0001604 Ga0439434_0001604_5103_6179 356
234 3300042435 Ga0439434_0002408 Ga0439434_0002408_2860_3936 356
235 3300044683 Ga0466965_0048162 Ga0466965_0048162_38_1117 356
236 3300046515 Ga0495620_0008213 Ga0495620_0008213_3181_4254 356
237 3300046520 Ga0495637_0003393 Ga0495637_0003393_596_1672 356
238 3300046660 Ga0495625_0051456 Ga0495625_0051456_1848_2924 356
239 3300046674 Ga0495588_0062231 Ga0495588_0062231_586_1665 356
240 3300046691 Ga0495670_0024675 Ga0495670_0024675_785_1861 356
241 3300046692 Ga0495671_0002650 Ga0495671_0002650_4998_6071 356
242 3300048905 Ga0496102_0010766 Ga0496102_0010766_2027_3097 356
243 3300050489 nmdc:mga03683_8148_c1 nmdc:mga03683_8148_c1_1361_2437 356
244 3300050490 nmdc:mga03n38_6656_c1 nmdc:mga03n38_6656_c1_919_1995 356
245 3300050496 nmdc:mga07m45_9617_c1 nmdc:mga07m45_9617_c1_1474_2550 356
246 3300053079 Ga0500610_0002946 Ga0500610_0002946_1227_2303 356
247 3300053117 Ga0500593_000173 Ga0500593_000173_19871_20944 356
248 3300053117 Ga0500593_001229 Ga0500593_001229_2272_3342 356
249 3300053121 Ga0500607_001787 Ga0500607_001787_12959_14035 356
250 iso_pu_bacteria 2738541307 2738880086 356
251 3300003773 Ga0055537_1000881 Ga0055537_100088110 357
252 3300003784 Ga0055534_1000826 Ga0055534_10008269 357
253 3300003790 Ga0055528_1003272 Ga0055528_10032724 357
254 3300003792 Ga0055540_1002475 Ga0055540_10024759 357
255 3300005288 Ga0065714_10005438 Ga0065714_100054385 357
256 3300005289 Ga0065704_10094233 Ga0065704_100942331 357
257 3300006038 Ga0075365_10007752 Ga0075365_100077528 357
258 3300006051 Ga0075364_10028222 Ga0075364_100282224 357
259 3300006058 Ga0075432_10006436 Ga0075432_100064363 357
260 3300006195 Ga0075366_10017214 Ga0075366_100172145 357
261 3300006353 Ga0075370_10005803 Ga0075370_100058037 357
262 3300006948 Ga0099826_10003829 Ga0099826_100038299 357
263 3300013100 Ga0157373_10015854 Ga0157373_100158544 357
264 3300014497 Ga0182008_10004612 Ga0182008_100046123 357
265 3300017792 Ga0163161_10001107 Ga0163161_100011078 357
266 3300017792 Ga0163161_10014906 Ga0163161_100149065 357
267 3300025263 Ga0209565_1000046 Ga0209565_100004633 357
268 3300025273 Ga0209673_1000053 Ga0209673_100005345 357
269 3300025291 Ga0209675_1000010 Ga0209675_1000010326 357
270 3300025303 Ga0209051_1000939 Ga0209051_10009394 357
271 3300026089 Ga0207648_10192532 Ga0207648_101925323 357
272 3300027666 Ga0209282_1009841 Ga0209282_10098412 357
273 3300030736 Ga0316180_1048297 Ga0316180_10482972 357
274 3300030745 Ga0316182_1037537 Ga0316182_10375374 357
275 3300031548 Ga0307408_100107655 Ga0307408_1001076553 357
276 3300031824 Ga0307413_10228699 Ga0307413_102286992 357
277 3300031901 Ga0307406_10045251 Ga0307406_100452512 357
278 3300031911 Ga0307412_10019540 Ga0307412_100195403 357
279 3300031911 Ga0307412_10047437 Ga0307412_100474373 357
280 3300032004 Ga0307414_10177305 Ga0307414_101773052 357
281 3300032004 Ga0307414_10201427 Ga0307414_102014272 357
282 3300032005 Ga0307411_10068916 Ga0307411_100689163 357
283 3300041404 Ga0439436_0004681 Ga0439436_0004681_1073_2176 357
284 3300042002 Ga0439442_001616 Ga0439442_001616_1015_2118 357
285 3300042184 Ga0450908_000659 Ga0450908_000659_2487_3590 357
286 3300042435 Ga0439434_0012076 Ga0439434_0012076_800_1903 357
287 3300042531 Ga0450918_006579 Ga0450918_006579_333_1436 357
288 3300046660 Ga0495625_0000870 Ga0495625_0000870_25701_26804 357
289 3300050489 nmdc:mga03683_4753_c1 nmdc:mga03683_4753_c1_1821_2924 357
290 3300050489 nmdc:mga03683_5261_c1 nmdc:mga03683_5261_c1_730_1836 357
291 3300050492 nmdc:mga0yw44_4790_c1 nmdc:mga0yw44_4790_c1_3199_4305 357
292 3300050496 nmdc:mga07m45_113976_c1 nmdc:mga07m45_113976_c1_230_1303 357
293 3300050496 nmdc:mga07m45_32216_c1 nmdc:mga07m45_32216_c1_1238_2341 357
294 3300050516 nmdc:mga0sz30_8443_c1 nmdc:mga0sz30_8443_c1_1182_2285 357
295 iso_pu_bacteria 2885198086 2885200688 357
296 iso_pu_bacteria 2885211737 2885214529 357
297 3300002987 JGI25159J45721_1002209 JGI25159J45721_10022095 358
298 3300003187 JGI25151J46595_10002462 JGI25151J46595_100024629 358
299 3300003316 rootH1_10135574 rootH1_101355742 358
300 3300003761 Ga0055535_1000318 Ga0055535_100031821 358
301 3300003762 Ga0055542_1000022 Ga0055542_100002221 358
302 3300003781 Ga0055536_1005720 Ga0055536_10057205 358
303 3300003784 Ga0055534_1002420 Ga0055534_10024203 358
304 3300003791 Ga0055530_10021435 Ga0055530_100214352 358
305 3300003792 Ga0055540_1004376 Ga0055540_10043763 358
306 3300003794 Ga0055531_10006333 Ga0055531_100063333 358
307 3300003794 Ga0055531_10010242 Ga0055531_100102422 358
308 3300004625 Ga0055543_1001710 Ga0055543_10017105 358
309 3300005262 Ga0065165_1004672 Ga0065165_10046725 358
310 3300005457 Ga0070662_100067998 Ga0070662_1000679983 358
311 3300005564 Ga0070664_100019897 Ga0070664_1000198975 358
312 3300005577 Ga0068857_100117751 Ga0068857_1001177511 358
313 3300006353 Ga0075370_10008221 Ga0075370_100082213 358
314 3300009036 Ga0105244_10005123 Ga0105244_100051233 358
315 3300009093 Ga0105240_10161843 Ga0105240_101618432 358
316 3300009098 Ga0105245_10119123 Ga0105245_101191232 358
317 3300009148 Ga0105243_10003440 Ga0105243_100034409 358
318 3300009545 Ga0105237_10026693 Ga0105237_100266931 358
319 3300009551 Ga0105238_10110847 Ga0105238_101108473 358
320 3300010375 Ga0105239_10196613 Ga0105239_101966131 358
321 3300013105 Ga0157369_10098552 Ga0157369_100985523 358
322 3300015261 Ga0182006_1003497 Ga0182006_10034974 358
323 3300015262 Ga0182007_10001359 Ga0182007_100013596 358
324 3300025228 Ga0209672_101114 Ga0209672_10111410 358
325 3300025229 Ga0209147_103059 Ga0209147_1030594 358
326 3300025242 Ga0209258_100009 Ga0209258_100009684 358
327 3300025245 Ga0207425_1000798 Ga0207425_10007989 358
328 3300025254 Ga0209148_1000007 Ga0209148_1000007684 358
329 3300025258 Ga0209129_1000024 Ga0209129_1000024392 358
330 3300025258 Ga0209129_1000085 Ga0209129_1000085173 358
331 3300025263 Ga0209565_1000518 Ga0209565_10005185 358
332 3300025273 Ga0209673_1003947 Ga0209673_10039475 358
333 3300025284 Ga0209130_1000283 Ga0209130_100028337 358
334 3300025291 Ga0209675_1003009 Ga0209675_10030095 358
335 3300025292 Ga0209676_1001793 Ga0209676_100179315 358
336 3300025292 Ga0209676_1004495 Ga0209676_10044956 358
337 3300025294 Ga0209025_1000122 Ga0209025_1000122172 358
338 3300025294 Ga0209025_1001124 Ga0209025_100112416 358
339 3300025295 Ga0209564_1000481 Ga0209564_100048156 358
340 3300025297 Ga0209758_1000049 Ga0209758_1000049311 358
341 3300025298 Ga0209050_1001046 Ga0209050_100104615 358
342 3300025298 Ga0209050_1006360 Ga0209050_10063608 358
343 3300025299 Ga0209256_1000464 Ga0209256_100046436 358
344 3300025302 Ga0207426_1000053 Ga0207426_1000053347 358
345 3300025303 Ga0209051_1000976 Ga0209051_100097624 358
346 3300025303 Ga0209051_1006689 Ga0209051_10066895 358
347 3300025304 Ga0209257_1001281 Ga0209257_100128130 358
348 3300025304 Ga0209257_1005969 Ga0209257_10059695 358
349 3300025728 Ga0207655_1001943 Ga0207655_10019437 358
350 3300025913 Ga0207695_10241384 Ga0207695_102413842 358
351 3300025932 Ga0207690_10051373 Ga0207690_100513734 358
352 3300025933 Ga0207706_10010163 Ga0207706_100101633 358
353 3300025935 Ga0207709_10011461 Ga0207709_100114613 358
354 3300025945 Ga0207679_10147833 Ga0207679_101478331 358
355 3300031911 Ga0307412_10038663 Ga0307412_100386633 358
356 3300048904 Ga0496101_0006461 Ga0496101_0006461_4781_5875 358
357 3300048920 Ga0496117_0011404 Ga0496117_0011404_4863_5960 358
358 3300048921 Ga0496118_0019444 Ga0496118_0019444_2238_3332 358
359 3300048924 Ga0496121_0053687 Ga0496121_0053687_267_1364 358
360 3300048927 Ga0496124_0038908 Ga0496124_0038908_307_1401 358
361 3300048928 Ga0496125_0012583 Ga0496125_0012583_4530_5624 358
362 3300048928 Ga0496125_0128661 Ga0496125_0128661_177_1265 358
363 3300050496 nmdc:mga07m45_53053_c1 nmdc:mga07m45_53053_c1_94_1188 358
364 3300053125 Ga0500618_004835 Ga0500618_004835_1838_2926 358
365 3300053136 Ga0500559_0011229 Ga0500559_0011229_415_1494 358
366 3300003215 JGI25153J46596_10007251 JGI25153J46596_100072516 359
367 3300003784 Ga0055534_1002108 Ga0055534_10021086 359
368 3300003791 Ga0055530_10003702 Ga0055530_100037027 359
369 3300003794 Ga0055531_10005022 Ga0055531_100050223 359
370 3300004625 Ga0055543_1001757 Ga0055543_10017576 359
371 3300005539 Ga0068853_100018186 Ga0068853_1000181864 359
372 3300025245 Ga0207425_1002594 Ga0207425_10025943 359
373 3300025263 Ga0209565_1002940 Ga0209565_10029404 359
374 3300025273 Ga0209673_1000288 Ga0209673_10002887 359
375 3300025284 Ga0209130_1000963 Ga0209130_100096311 359
376 3300025291 Ga0209675_1003275 Ga0209675_10032755 359
377 3300025292 Ga0209676_1000108 Ga0209676_100010830 359
378 3300025295 Ga0209564_1000472 Ga0209564_10004727 359
379 3300025298 Ga0209050_1000002 Ga0209050_1000002288 359
380 3300025299 Ga0209256_1000098 Ga0209256_100009821 359
381 3300025302 Ga0207426_1000038 Ga0207426_100003821 359
382 3300025303 Ga0209051_1000002 Ga0209051_100000256 359
383 3300025304 Ga0209257_1000002 Ga0209257_1000002197 359
384 3300048921 Ga0496118_0011891 Ga0496118_0011891_5304_6404 359
385 3300048925 Ga0496122_0022445 Ga0496122_0022445_2417_3517 360
386 3300048926 Ga0496123_0020616 Ga0496123_0020616_2003_3103 360
387 3300021361 Ga0213872_10000339 Ga0213872_1000033921 369
388 3300039447 Ga0436361_0265063 Ga0436361_0265063_11521_12636 369
389 3300001979 JGI24740J21852_10030674 JGI24740J21852_100306742 370

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00933

Glyco_hydro_3

Glycosyl hydrolase family 3 N terminal domain

8

327

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5utp-assembly2.cif.gz_B crystal structure of burkholderia cenocepacia family 3 glycoside hydrolase (nagz) bound to n-ethylbutyryl-pugnac 0.9712 22 368
4gnv-assembly1.cif.gz_B crystal structure of beta-hexosaminidase 1 from burkholderia cenocepacia j2315 with bound n-acetyl-d-glucosamine 0.9708 22 368
5utq-assembly2.cif.gz_B crystal structure of burkholderia cenocepacia family 3 glycoside hydrolase (nagz) bound to pugnac 0.9706 22 369
5utr-assembly2.cif.gz_B crystal structure of burkholderia cenocepacia family 3 glycoside hydrolase (nagz) bound to (3s,4r,5r,6s)-3-butyryl-4,5,6-trihydroxyazepane 0.9701 22 369
4gnv-assembly1.cif.gz_A crystal structure of beta-hexosaminidase 1 from burkholderia cenocepacia j2315 with bound n-acetyl-d-glucosamine 0.9669 22 369
ID Description Score Start End Superfamily
4gnvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.9669 22 369 3.20.20.300
4gnvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.9445 22 369 3.20.20.300
5g3rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.9367 22 367 3.20.20.300
2oxnA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.9075 23 369 3.20.20.300
5g3rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase, family 3, N-terminal domain 0.9042 22 367 3.20.20.300
ID Description Score Start End GO Terms
AF-A0A4V1UI10-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) 0.9859 127 370 GO:0005975
GO:0009254
GO:0016231
AF-A0A4V1UI10-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) 0.978 127 370 GO:0005975
GO:0009254
GO:0016231
AF-A0A433BHB4-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) 0.9762 59 370 GO:0005975
GO:0009254
GO:0016231
AF-A0A3E1R836-F1-model_v4 Beta-hexosaminidase (EC 3.2.1.52) (Beta-N-acetylhexosaminidase) (N-acetyl-beta-glucosaminidase) 0.9738 20 370 GO:0005737
GO:0005975
GO:0008360
GO:0009252
GO:0009254
GO:0016231
GO:0051301
GO:0071555
AF-F0G918-F1-model_v4 Beta-hexosaminidase (EC 3.2.1.52) (Beta-N-acetylhexosaminidase) (N-acetyl-beta-glucosaminidase) 0.97 27 369 GO:0005737
GO:0005975
GO:0008360
GO:0009252
GO:0009254
GO:0016231
GO:0051301
GO:0071555

Feature Viewer

pLDDT pTM Quality
86.02 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map