F431396

General Info

Members Datasets Scaffolds Average Seq Length
389 250 778 151

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10001794|Ga0105240_1000179413
Length 172
Sequence LQVIAYQVNHCAHPQLLIGGWTMKPVPEGWARVCPAVFYEDASKAIDWLCRAFGFEVQLKIEGEGGRIEHSELRFGEGLVMVSQAGGSSERKKPLPTRSPRAVGGVNTQMLALFVDDADSHCARARAAGGKIHDEPTTNDYGDDYWADRTYRVEDPEGHHWWFMQRVRTGGR

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
185 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
186 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
187 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
188 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
189 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
190 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
191 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
192 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
195 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
196 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
197 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
243 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
244 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
245 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
247 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 0
Rhizoplane 4.63
Rhizosphere 90.49
Stem 0
Stem Tuber 0
Unclassified 13.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10001794 3300009093 Bacteria 36131
2 JGI24737J22298_10163043 3300001990 Bacteria 658
3 JGI24749J21850_1017216 3300002076 Bacteria 1017
4 rootH2_10231588 3300003320 Unclassified 1801
5 rootH1_10207350 3300003323 Unclassified 3261
6 JGI25404J52841_10072195 3300003659 Bacteria 721
7 Ga0058860_10732615 3300004801 Unclassified 625
8 Ga0065704_10072298 3300005289 Bacteria 8785
9 Ga0065715_10101557 3300005293 Bacteria 3156
10 Ga0070658_10001909 3300005327 Bacteria 17592
11 Ga0070676_10613670 3300005328 Bacteria 786
12 Ga0070683_100042023 3300005329 Bacteria 4209
13 Ga0070690_100000245 3300005330 Bacteria 27972
14 Ga0070670_100056960 3300005331 Bacteria 3355
15 Ga0070670_101003682 3300005331 Bacteria 759
16 Ga0070670_101113632 3300005331 Unclassified 720
17 Ga0070677_10000065 3300005333 Bacteria 33290
18 Ga0070677_10078721 3300005333 Bacteria 1405
19 Ga0068869_100028014 3300005334 Bacteria 3932
20 Ga0068869_101434183 3300005334 Bacteria 612
21 Ga0068869_101705378 3300005334 Unclassified 562
22 Ga0070680_100297676 3300005336 Bacteria 1368
23 Ga0070682_100004766 3300005337 Bacteria 7542
24 Ga0070682_100159544 3300005337 Bacteria 1556
25 Ga0070682_100250120 3300005337 Unclassified 1277
26 Ga0070682_100614798 3300005337 Unclassified 860
27 Ga0068868_100033933 3300005338 Bacteria 3936
28 Ga0068868_100346969 3300005338 Unclassified 1271
29 Ga0070660_100001727 3300005339 Bacteria 14984
30 Ga0070689_100022099 3300005340 Bacteria 4747
31 Ga0070689_100275480 3300005340 Bacteria 1394
32 Ga0070689_100327951 3300005340 Bacteria 1280
33 Ga0070689_102246637 3300005340 Bacteria 500
34 Ga0070691_10159708 3300005341 Bacteria 1161
35 Ga0070687_100000121 3300005343 Bacteria 26702
36 Ga0070687_100550754 3300005343 Bacteria 785
37 Ga0070668_100015566 3300005347 Bacteria 5685
38 Ga0070669_100005655 3300005353 Bacteria 9030
39 Ga0070669_100329750 3300005353 Bacteria 1234
40 Ga0070669_101077175 3300005353 Bacteria 692
41 Ga0070675_100026385 3300005354 Bacteria 4662
42 Ga0070671_100138883 3300005355 Bacteria 2050
43 Ga0070671_100393453 3300005355 Bacteria 1185
44 Ga0070671_100474435 3300005355 Unclassified 1074
45 Ga0070674_100009991 3300005356 Bacteria 5715
46 Ga0070673_100651451 3300005364 Bacteria 964
47 Ga0070688_100000751 3300005365 Bacteria 15988
48 Ga0070688_100264201 3300005365 Unclassified 1230
49 Ga0070688_100554929 3300005365 Bacteria 874
50 Ga0070659_100002473 3300005366 Bacteria 13117
51 Ga0070659_100494431 3300005366 Bacteria 1042
52 Ga0070667_100053694 3300005367 Bacteria 3401
53 Ga0070667_100450014 3300005367 Bacteria 1177
54 Ga0070701_10009212 3300005438 Bacteria 4317
55 Ga0070711_100348731 3300005439 Bacteria 1190
56 Ga0070705_100001864 3300005440 Bacteria 10866
57 Ga0070705_100130374 3300005440 Bacteria 1639
58 Ga0070700_100005808 3300005441 Bacteria 6550
59 Ga0070694_100027778 3300005444 Bacteria 3678
60 Ga0070663_100023501 3300005455 Bacteria 4132
61 Ga0070678_100005934 3300005456 Bacteria 7106
62 Ga0070678_100726742 3300005456 Unclassified 896
63 Ga0070681_11481107 3300005458 Bacteria 603
64 Ga0068867_100001116 3300005459 Bacteria 18372
65 Ga0068867_100198969 3300005459 Bacteria 1603
66 Ga0068867_100896658 3300005459 Bacteria 798
67 Ga0070685_10000339 3300005466 Bacteria 28730
68 Ga0070706_100279155 3300005467 Bacteria 1559
69 Ga0070698_100055793 3300005471 Bacteria 4004
70 Ga0070698_101212089 3300005471 Unclassified 704
71 Ga0070699_100658828 3300005518 Unclassified 956
72 Ga0070679_100144306 3300005530 Bacteria 2359
73 Ga0070684_100029696 3300005535 Bacteria 4636
74 Ga0070697_100817103 3300005536 Unclassified 825
75 Ga0068853_100005141 3300005539 Bacteria 10231
76 Ga0070672_100021954 3300005543 Bacteria 4679
77 Ga0070672_100514752 3300005543 Bacteria 1036
78 Ga0070672_101350777 3300005543 Unclassified 637
79 Ga0070686_100000321 3300005544 Bacteria 31535
80 Ga0070696_100043282 3300005546 Bacteria 3115
81 Ga0070693_100000957 3300005547 Bacteria 12805
82 Ga0070665_100164676 3300005548 Bacteria 2220
83 Ga0070665_100287662 3300005548 Bacteria 1646
84 Ga0070665_100421527 3300005548 Bacteria 1343
85 Ga0070704_100309924 3300005549 Bacteria 1318
86 Ga0068855_100004620 3300005563 Bacteria 16802
87 Ga0068855_100199207 3300005563 Bacteria 2255
88 Ga0070664_100011858 3300005564 Bacteria 7074
89 Ga0070664_100117325 3300005564 Bacteria 2328
90 Ga0068857_100249077 3300005577 Bacteria 1628
91 Ga0068854_100000649 3300005578 Bacteria 20632
92 Ga0068854_100718928 3300005578 Unclassified 864
93 Ga0070702_100199885 3300005615 Bacteria 1322
94 Ga0068852_100004965 3300005616 Bacteria 9455
95 Ga0068852_100108581 3300005616 Bacteria 2518
96 Ga0068859_100004936 3300005617 Bacteria 13556
97 Ga0068859_100231726 3300005617 Bacteria 1935
98 Ga0068859_100606410 3300005617 Bacteria 1188
99 Ga0068859_100979972 3300005617 Bacteria 928
100 Ga0068859_101014881 3300005617 Bacteria 911
101 Ga0068864_100105452 3300005618 Bacteria 2505
102 Ga0068866_10000626 3300005718 Bacteria 16065
103 Ga0068861_100001208 3300005719 Bacteria 16084
104 Ga0068861_100377508 3300005719 Unclassified 1251
105 Ga0068851_10000607 3300005834 Bacteria 15426
106 Ga0068870_10000035 3300005840 Bacteria 43532
107 Ga0068870_10528420 3300005840 Bacteria 791
108 Ga0068863_100003321 3300005841 Bacteria 15886
109 Ga0068863_101560618 3300005841 Unclassified 669
110 Ga0068860_100107714 3300005843 Bacteria 2663
111 Ga0068860_100898315 3300005843 Bacteria 902
112 Ga0068862_100001652 3300005844 Bacteria 20286
113 Ga0068862_100275479 3300005844 Bacteria 1540
114 Ga0068862_101016333 3300005844 Unclassified 821
115 Ga0081540_1000052 3300005983 Bacteria 124880
116 Ga0081540_1000426 3300005983 Bacteria 41613
117 Ga0081540_1000788 3300005983 Bacteria 29095
118 Ga0097621_100092224 3300006237 Bacteria 2536
119 Ga0097621_100319425 3300006237 Bacteria 1375
120 Ga0097621_100443336 3300006237 Bacteria 1169
121 Ga0068871_100000529 3300006358 Bacteria 26128
122 Ga0068871_100032928 3300006358 Bacteria 4099
123 Ga0075428_100064223 3300006844 Bacteria 4020
124 Ga0075430_100030282 3300006846 Bacteria 4595
125 Ga0075430_100144916 3300006846 Unclassified 1978
126 Ga0075431_100017661 3300006847 Bacteria 7253
127 Ga0075431_100073146 3300006847 Bacteria 3537
128 Ga0075431_100522266 3300006847 Bacteria 1177
129 Ga0075431_100553910 3300006847 Bacteria 1137
130 Ga0075433_10578235 3300006852 Bacteria 987
131 Ga0075434_100629328 3300006871 Bacteria 1092
132 Ga0075434_100767805 3300006871 Bacteria 981
133 Ga0075434_100863700 3300006871 Unclassified 920
134 Ga0075429_100043972 3300006880 Bacteria 3885
135 Ga0068865_100000955 3300006881 Bacteria 16461
136 Ga0068865_100469375 3300006881 Bacteria 1044
137 Ga0097620_100004935 3300006931 Bacteria 13556
138 Ga0097620_100231726 3300006931 Bacteria 1935
139 Ga0097620_100606383 3300006931 Bacteria 1188
140 Ga0097620_101014640 3300006931 Bacteria 911
141 Ga0075435_100165890 3300007076 Bacteria 1862
142 Ga0111539_10003645 3300009094 Bacteria 20294
143 Ga0105245_10002417 3300009098 Bacteria 16904
144 Ga0105245_10006833 3300009098 Bacteria 10009
145 Ga0105247_10000495 3300009101 Bacteria 32681
146 Ga0105247_10000863 3300009101 Bacteria 22935
147 Ga0114129_10238687 3300009147 Bacteria 2444
148 Ga0114129_12088526 3300009147 Bacteria 684
149 Ga0105241_10000244 3300009174 Bacteria 41239
150 Ga0105242_10003018 3300009176 Bacteria 13157
151 Ga0105242_10078037 3300009176 Bacteria 2764
152 Ga0105248_11417190 3300009177 Bacteria 786
153 Ga0105248_12036452 3300009177 Unclassified 652
154 Ga0105237_10001821 3300009545 Bacteria 27502
155 Ga0105238_10000705 3300009551 Bacteria 34903
156 Ga0105249_10000549 3300009553 Bacteria 34738
157 Ga0105239_10034279 3300010375 Bacteria 5574
158 Ga0105246_10004199 3300011119 Bacteria 8754
159 Ga0105246_10399900 3300011119 Unclassified 1140
160 Ga0157373_10008204 3300013100 Bacteria 7767
161 Ga0157371_10002774 3300013102 Bacteria 16440
162 Ga0157369_10001108 3300013105 Bacteria 33690
163 Ga0157369_11496140 3300013105 Bacteria 687
164 Ga0157374_10001654 3300013296 Bacteria 18651
165 Ga0157374_11339307 3300013296 Bacteria 738
166 Ga0157378_10001798 3300013297 Bacteria 19261
167 Ga0157378_11093750 3300013297 Bacteria 834
168 Ga0163162_10002320 3300013306 Bacteria 17852
169 Ga0157372_10016419 3300013307 Bacteria 7943
170 Ga0157375_10003855 3300013308 Bacteria 13018
171 Ga0157375_10207367 3300013308 Bacteria 2117
172 Ga0157375_10505231 3300013308 Bacteria 1373
173 Ga0163163_10009683 3300014325 Bacteria 8621
174 Ga0157380_10234992 3300014326 Unclassified 1649
175 Ga0157377_10001667 3300014745 Bacteria 9677
176 Ga0157379_10001549 3300014968 Bacteria 18909
177 Ga0157376_10002532 3300014969 Bacteria 12387
178 Ga0157376_10133677 3300014969 Bacteria 2217
179 Ga0157376_10153562 3300014969 Bacteria 2079
180 Ga0157376_11167810 3300014969 Bacteria 797
181 Ga0157376_11478171 3300014969 Bacteria 712
182 Ga0163161_10085000 3300017792 Bacteria 2334
183 Ga0213872_10058032 3300021361 Bacteria 1752
184 Ga0207697_10000520 3300025315 Bacteria 21713
185 Ga0207656_10000802 3300025321 Bacteria 10265
186 Ga0207656_10049060 3300025321 Bacteria 1819
187 Ga0207653_10113884 3300025885 Bacteria 968
188 Ga0207642_10056802 3300025899 Bacteria 1797
189 Ga0207710_10000993 3300025900 Bacteria 14831
190 Ga0207710_10026345 3300025900 Bacteria 2512
191 Ga0207688_10000098 3300025901 Bacteria 34240
192 Ga0207688_10233895 3300025901 Bacteria 1110
193 Ga0207647_10011704 3300025904 Bacteria 6141
194 Ga0207645_10000055 3300025907 Bacteria 83041
195 Ga0207645_10685299 3300025907 Bacteria 696
196 Ga0207643_10000054 3300025908 Bacteria 74219
197 Ga0207643_10704853 3300025908 Unclassified 652
198 Ga0207705_10011080 3300025909 Bacteria 6537
199 Ga0207684_10489994 3300025910 Bacteria 1054
200 Ga0207654_10429406 3300025911 Bacteria 923
201 Ga0207695_10041598 3300025913 Bacteria 4918
202 Ga0207671_10031518 3300025914 Bacteria 3950
203 Ga0207663_10267912 3300025916 Bacteria 1264
204 Ga0207660_10294528 3300025917 Bacteria 1291
205 Ga0207662_10000418 3300025918 Bacteria 18784
206 Ga0207662_10600705 3300025918 Unclassified 766
207 Ga0207657_10000070 3300025919 Bacteria 94634
208 Ga0207649_10257630 3300025920 Bacteria 1259
209 Ga0207652_10110827 3300025921 Bacteria 2434
210 Ga0207681_10054525 3300025923 Bacteria 2718
211 Ga0207681_10167648 3300025923 Bacteria 1662
212 Ga0207681_11116790 3300025923 Bacteria 662
213 Ga0207650_10053702 3300025925 Bacteria 2987
214 Ga0207650_10876684 3300025925 Unclassified 762
215 Ga0207659_10000136 3300025926 Bacteria 43133
216 Ga0207659_10121589 3300025926 Bacteria 2001
217 Ga0207687_10056692 3300025927 Bacteria 2749
218 Ga0207706_10000094 3300025933 Bacteria 92942
219 Ga0207686_10028703 3300025934 Bacteria 3274
220 Ga0207709_10507411 3300025935 Bacteria 942
221 Ga0207670_10000420 3300025936 Bacteria 24017
222 Ga0207670_10001606 3300025936 Bacteria 11781
223 Ga0207670_10043487 3300025936 Unclassified 2967
224 Ga0207669_10000303 3300025937 Bacteria 22654
225 Ga0207704_10002966 3300025938 Bacteria 7668
226 Ga0207691_10000173 3300025940 Bacteria 60288
227 Ga0207691_10003696 3300025940 Bacteria 14837
228 Ga0207711_10007180 3300025941 Bacteria 9335
229 Ga0207711_11014350 3300025941 Bacteria 770
230 Ga0207689_10000287 3300025942 Bacteria 45869
231 Ga0207679_10421907 3300025945 Unclassified 1177
232 Ga0207667_10018498 3300025949 Bacteria 7812
233 Ga0207667_10132835 3300025949 Bacteria 2564
234 Ga0207712_10001006 3300025961 Bacteria 20086
235 Ga0207668_10001718 3300025972 Bacteria 12822
236 Ga0207668_10270854 3300025972 Bacteria 1388
237 Ga0207658_10045597 3300025986 Bacteria 3196
238 Ga0207658_10325298 3300025986 Bacteria 1332
239 Ga0207677_10001271 3300026023 Bacteria 13555
240 Ga0207677_10021183 3300026023 Bacteria 3966
241 Ga0207677_10234091 3300026023 Bacteria 1481
242 Ga0207703_11577192 3300026035 Viruses 632
243 Ga0207639_10081070 3300026041 Bacteria 2569
244 Ga0207678_10008975 3300026067 Bacteria 8798
245 Ga0207678_10220740 3300026067 Unclassified 1622
246 Ga0207708_10020333 3300026075 Bacteria 5007
247 Ga0207708_11153465 3300026075 Bacteria 677
248 Ga0207702_11514440 3300026078 Bacteria 664
249 Ga0207641_10057288 3300026088 Bacteria 3313
250 Ga0207641_10361807 3300026088 Unclassified 1385
251 Ga0207641_11408291 3300026088 Unclassified 698
252 Ga0207648_10000247 3300026089 Bacteria 58338
253 Ga0207648_10432282 3300026089 Bacteria 1197
254 Ga0207648_10815722 3300026089 Unclassified 869
255 Ga0207676_10002084 3300026095 Bacteria 14509
256 Ga0207674_10000426 3300026116 Bacteria 54953
257 Ga0207674_11084390 3300026116 Unclassified 770
258 Ga0207675_100000063 3300026118 Bacteria 80198
259 Ga0207675_100066699 3300026118 Bacteria 3364
260 Ga0207683_10000053 3300026121 Bacteria 85332
261 Ga0207683_10197995 3300026121 Unclassified 1826
262 Ga0207698_10191736 3300026142 Bacteria 1821
263 Ga0207698_10215808 3300026142 Bacteria 1730
264 Ga0207428_10008546 3300027907 Bacteria 9237
265 Ga0268266_10001038 3300028379 Bacteria 34907
266 Ga0268266_10014270 3300028379 Bacteria 6833
267 Ga0268266_10155639 3300028379 Bacteria 2064
268 Ga0268266_11300442 3300028379 Bacteria 702
269 Ga0268265_10002440 3300028380 Bacteria 14023
270 Ga0268265_10340575 3300028380 Bacteria 1365
271 Ga0268265_10382537 3300028380 Bacteria 1295
272 Ga0268264_10000986 3300028381 Bacteria 29112
273 Ga0268264_10422132 3300028381 Bacteria 1286
274 Ga0265337_1006553 3300028556 Bacteria 4472
275 Ga0265338_10462293 3300028800 Bacteria 897
276 Ga0265332_10078102 3300031238 Unclassified 1405
277 Ga0265320_10026140 3300031240 Bacteria 3059
278 Ga0307513_10186928 3300031456 Unclassified 1928
279 Ga0307509_10209612 3300031507 Bacteria 1775
280 Ga0307508_10625674 3300031616 Bacteria 680
281 Ga0307416_101407988 3300032002 Unclassified 803
282 Ga0307414_10865970 3300032004 Unclassified 827
283 Ga0373928_0122101 3300035084 Bacteria 699
284 Ga0373954_0370655 3300035118 Bacteria 707
285 Ga0373943_0223431 3300035170 Bacteria 1050
286 Ga0373955_0097355 3300035172 Bacteria 1685
287 Ga0373942_0050634 3300035207 Bacteria 1164
288 Ga0373931_0219248 3300035691 Bacteria 1145
289 Ga0373935_0560954 3300035692 Bacteria 833
290 Ga0373937_0025263 3300036401 Bacteria 5363
291 Ga0373937_0145579 3300036401 Bacteria 2218
292 Ga0373937_0877639 3300036401 Bacteria 846
293 Ga0436361_0762727 3300039447 Bacteria 2909
294 Ga0436363_0557477 3300039450 Bacteria 806
295 Ga0436363_1644309 3300039450 Bacteria 3908
296 Ga0451793_0230728 3300041452 Unclassified 1255
297 Ga0451797_1281718 3300041453 Bacteria 573
298 Ga0451797_1426412 3300041453 Bacteria 1138
299 Ga0451795_1253713 3300041456 Bacteria 633
300 Ga0451802_1599663 3300041460 Bacteria 866
301 Ga0451804_0597469 3300041463 Unclassified 606
302 Ga0451807_0323219 3300041486 Unclassified 647
303 Ga0451807_0973877 3300041486 Bacteria 8476
304 Ga0451807_2228592 3300041486 Bacteria 975
305 Ga0451839_0610579 3300041496 Bacteria 639
306 Ga0451841_0134688 3300041498 Bacteria 558
307 Ga0451849_1563670 3300041505 Bacteria 824
308 Ga0451853_3720402 3300041512 Bacteria 727
309 Ga0439448_0015039 3300042005 Bacteria 2341
310 Ga0439450_172642 3300042008 Bacteria 572
311 Ga0439455_0007368 3300042012 Bacteria 2324
312 Ga0450896_036063 3300042133 Bacteria 761
313 Ga0466959_0583288 3300045049 Bacteria 753
314 Ga0451576_1046052 3300045051 Bacteria 855
315 Ga0495662_0107882 3300046476 Bacteria 1364
316 Ga0495628_0001524 3300046516 Bacteria 21223
317 Ga0495613_0861305 3300046689 Unclassified 588
318 Ga0495600_0427869 3300046809 Unclassified 821
319 Ga0495684_0028093 3300047471 Bacteria 4320
320 Ga0496102_0049731 3300048905 Bacteria 3814
321 Ga0496104_0279400 3300048907 Bacteria 1583
322 Ga0496106_0014970 3300048909 Bacteria 5738
323 Ga0496107_0004956 3300048910 Bacteria 9062
324 Ga0496108_0037698 3300048911 Bacteria 4028
325 Ga0496109_0009793 3300048912 Bacteria 8181
326 Ga0496110_1036935 3300048913 Bacteria 728
327 Ga0496112_0003038 3300048915 Bacteria 13727
328 Ga0496114_0339763 3300048917 Bacteria 1328
329 Ga0501032_0048053 3300049569 Bacteria 2881
330 Ga0501032_0726977 3300049569 Unclassified 629
331 Ga0501033_0842101 3300049570 Unclassified 618
332 Ga0501034_0009350 3300049571 Bacteria 10270
333 Ga0501034_0071472 3300049571 Unclassified 3480
334 Ga0501038_0195177 3300049574 Bacteria 1627
335 Ga0501038_0776032 3300049574 Bacteria 714
336 Ga0501043_0009569 3300049579 Bacteria 7598
337 Ga0501043_0154335 3300049579 Bacteria 1796
338 Ga0501043_0542149 3300049579 Bacteria 865
339 Ga0501046_0062571 3300049580 Bacteria 2907
340 Ga0501046_0133271 3300049580 Bacteria 1883
341 Ga0501047_0004201 3300049581 Bacteria 13563
342 Ga0501047_0032486 3300049581 Bacteria 5038
343 Ga0501047_0066619 3300049581 Unclassified 3471
344 Ga0501048_0479839 3300049582 Unclassified 891
345 Ga0501048_0616559 3300049582 Bacteria 779
346 Ga0501067_0016751 3300049583 Bacteria 4049
347 Ga0501068_0000163 3300049584 Bacteria 30860
348 Ga0501069_0022084 3300049585 Bacteria 3458
349 Ga0501070_0000705 3300049586 Bacteria 30678
350 Ga0501072_0000004 3300049588 Bacteria 282897
351 Ga0501073_0065046 3300049589 Bacteria 2543
352 Ga0501073_0120952 3300049589 Bacteria 1814
353 Ga0501076_0104274 3300049592 Bacteria 2288
354 Ga0501077_0012019 3300049593 Bacteria 5419
355 Ga0501077_0468588 3300049593 Bacteria 807
356 Ga0501079_0021414 3300049741 Bacteria 4945
357 Ga0501080_0034224 3300049742 Bacteria 4741
358 Ga0501080_0729166 3300049742 Bacteria 873
359 Ga0501080_0895132 3300049742 Bacteria 774
360 Ga0501083_0020261 3300049744 Bacteria 4628
361 Ga0501083_0700954 3300049744 Bacteria 658
362 Ga0501044_0093493 3300049823 Unclassified 3032
363 Ga0501044_0139764 3300049823 Unclassified 2411
364 nmdc:mga05p37_1885280_c1 3300050507 Bacteria 572
365 nmdc:mga05p37_277708_c1 3300050507 Bacteria 1999
366 nmdc:mga09592_4432_c1 3300050508 Bacteria 11367
367 nmdc:mga0qj67_108338_c1 3300050509 Unclassified 2241
368 nmdc:mga0qj67_33850_c1 3300050509 Bacteria 3988
369 nmdc:mga06r32_12442_c1 3300050510 Bacteria 7679
370 nmdc:mga06r32_223254_c1 3300050510 Bacteria 1872
371 nmdc:mga06r32_301590_c1 3300050510 Bacteria 1588
372 nmdc:mga06r32_455031_c1 3300050510 Bacteria 1259
373 nmdc:mga0n895_357448_c1 3300050512 Unclassified 1479
374 nmdc:mga0n895_918154_c1 3300050512 Bacteria 860
375 nmdc:mga0n895_95753_c1 3300050512 Bacteria 2973
376 nmdc:mga0rr50_134503_c1 3300050513 Bacteria 1983
377 nmdc:mga0a205_1041883_c1 3300050515 Bacteria 665
378 nmdc:mga0a205_495126_c1 3300050515 Bacteria 1079
379 Ga0500641_0323332 3300053096 Bacteria 627
380 Ga0500556_0231214 3300053104 Bacteria 729
381 Ga0500617_128151 3300053124 Bacteria 1037
382 Ga0500642_0228113 3300053130 Bacteria 861
383 Ga0500559_0429658 3300053136 Bacteria 612
384 Ga0500568_0007526 3300053139 Bacteria 5334
385 Ga0500588_0004045 3300053146 Bacteria 3145
386 Ga0501084_0000308 3300054114 Bacteria 37148
387 Ga0501084_0415913 3300054114 Bacteria 1136
388 Ga0501082_0012038 3300060353 Bacteria 7434
389 Ga0530510_0034553 3300061734 Bacteria 3643
390 Ga0105240_10001794
391 JGI24737J22298_10163043
392 JGI24749J21850_1017216
393 rootH2_10231588
394 rootH1_10207350
395 JGI25404J52841_10072195
396 Ga0058860_10732615
397 Ga0065704_10072298
398 Ga0065715_10101557
399 Ga0070658_10001909
400 Ga0070676_10613670
401 Ga0070683_100042023
402 Ga0070690_100000245
403 Ga0070670_100056960
404 Ga0070670_101003682
405 Ga0070670_101113632
406 Ga0070677_10000065
407 Ga0070677_10078721
408 Ga0068869_100028014
409 Ga0068869_101434183
410 Ga0068869_101705378
411 Ga0070680_100297676
412 Ga0070682_100004766
413 Ga0070682_100159544
414 Ga0070682_100250120
415 Ga0070682_100614798
416 Ga0068868_100033933
417 Ga0068868_100346969
418 Ga0070660_100001727
419 Ga0070689_100022099
420 Ga0070689_100275480
421 Ga0070689_100327951
422 Ga0070689_102246637
423 Ga0070691_10159708
424 Ga0070687_100000121
425 Ga0070687_100550754
426 Ga0070668_100015566
427 Ga0070669_100005655
428 Ga0070669_100329750
429 Ga0070669_101077175
430 Ga0070675_100026385
431 Ga0070671_100138883
432 Ga0070671_100393453
433 Ga0070671_100474435
434 Ga0070674_100009991
435 Ga0070673_100651451
436 Ga0070688_100000751
437 Ga0070688_100264201
438 Ga0070688_100554929
439 Ga0070659_100002473
440 Ga0070659_100494431
441 Ga0070667_100053694
442 Ga0070667_100450014
443 Ga0070701_10009212
444 Ga0070711_100348731
445 Ga0070705_100001864
446 Ga0070705_100130374
447 Ga0070700_100005808
448 Ga0070694_100027778
449 Ga0070663_100023501
450 Ga0070678_100005934
451 Ga0070678_100726742
452 Ga0070681_11481107
453 Ga0068867_100001116
454 Ga0068867_100198969
455 Ga0068867_100896658
456 Ga0070685_10000339
457 Ga0070706_100279155
458 Ga0070698_100055793
459 Ga0070698_101212089
460 Ga0070699_100658828
461 Ga0070679_100144306
462 Ga0070684_100029696
463 Ga0070697_100817103
464 Ga0068853_100005141
465 Ga0070672_100021954
466 Ga0070672_100514752
467 Ga0070672_101350777
468 Ga0070686_100000321
469 Ga0070696_100043282
470 Ga0070693_100000957
471 Ga0070665_100164676
472 Ga0070665_100287662
473 Ga0070665_100421527
474 Ga0070704_100309924
475 Ga0068855_100004620
476 Ga0068855_100199207
477 Ga0070664_100011858
478 Ga0070664_100117325
479 Ga0068857_100249077
480 Ga0068854_100000649
481 Ga0068854_100718928
482 Ga0070702_100199885
483 Ga0068852_100004965
484 Ga0068852_100108581
485 Ga0068859_100004936
486 Ga0068859_100231726
487 Ga0068859_100606410
488 Ga0068859_100979972
489 Ga0068859_101014881
490 Ga0068864_100105452
491 Ga0068866_10000626
492 Ga0068861_100001208
493 Ga0068861_100377508
494 Ga0068851_10000607
495 Ga0068870_10000035
496 Ga0068870_10528420
497 Ga0068863_100003321
498 Ga0068863_101560618
499 Ga0068860_100107714
500 Ga0068860_100898315
501 Ga0068862_100001652
502 Ga0068862_100275479
503 Ga0068862_101016333
504 Ga0081540_1000052
505 Ga0081540_1000426
506 Ga0081540_1000788
507 Ga0097621_100092224
508 Ga0097621_100319425
509 Ga0097621_100443336
510 Ga0068871_100000529
511 Ga0068871_100032928
512 Ga0075428_100064223
513 Ga0075430_100030282
514 Ga0075430_100144916
515 Ga0075431_100017661
516 Ga0075431_100073146
517 Ga0075431_100522266
518 Ga0075431_100553910
519 Ga0075433_10578235
520 Ga0075434_100629328
521 Ga0075434_100767805
522 Ga0075434_100863700
523 Ga0075429_100043972
524 Ga0068865_100000955
525 Ga0068865_100469375
526 Ga0097620_100004935
527 Ga0097620_100231726
528 Ga0097620_100606383
529 Ga0097620_101014640
530 Ga0075435_100165890
531 Ga0111539_10003645
532 Ga0105245_10002417
533 Ga0105245_10006833
534 Ga0105247_10000495
535 Ga0105247_10000863
536 Ga0114129_10238687
537 Ga0114129_12088526
538 Ga0105241_10000244
539 Ga0105242_10003018
540 Ga0105242_10078037
541 Ga0105248_11417190
542 Ga0105248_12036452
543 Ga0105237_10001821
544 Ga0105238_10000705
545 Ga0105249_10000549
546 Ga0105239_10034279
547 Ga0105246_10004199
548 Ga0105246_10399900
549 Ga0157373_10008204
550 Ga0157371_10002774
551 Ga0157369_10001108
552 Ga0157369_11496140
553 Ga0157374_10001654
554 Ga0157374_11339307
555 Ga0157378_10001798
556 Ga0157378_11093750
557 Ga0163162_10002320
558 Ga0157372_10016419
559 Ga0157375_10003855
560 Ga0157375_10207367
561 Ga0157375_10505231
562 Ga0163163_10009683
563 Ga0157380_10234992
564 Ga0157377_10001667
565 Ga0157379_10001549
566 Ga0157376_10002532
567 Ga0157376_10133677
568 Ga0157376_10153562
569 Ga0157376_11167810
570 Ga0157376_11478171
571 Ga0163161_10085000
572 Ga0213872_10058032
573 Ga0207697_10000520
574 Ga0207656_10000802
575 Ga0207656_10049060
576 Ga0207653_10113884
577 Ga0207642_10056802
578 Ga0207710_10000993
579 Ga0207710_10026345
580 Ga0207688_10000098
581 Ga0207688_10233895
582 Ga0207647_10011704
583 Ga0207645_10000055
584 Ga0207645_10685299
585 Ga0207643_10000054
586 Ga0207643_10704853
587 Ga0207705_10011080
588 Ga0207684_10489994
589 Ga0207654_10429406
590 Ga0207695_10041598
591 Ga0207671_10031518
592 Ga0207663_10267912
593 Ga0207660_10294528
594 Ga0207662_10000418
595 Ga0207662_10600705
596 Ga0207657_10000070
597 Ga0207649_10257630
598 Ga0207652_10110827
599 Ga0207681_10054525
600 Ga0207681_10167648
601 Ga0207681_11116790
602 Ga0207650_10053702
603 Ga0207650_10876684
604 Ga0207659_10000136
605 Ga0207659_10121589
606 Ga0207687_10056692
607 Ga0207706_10000094
608 Ga0207686_10028703
609 Ga0207709_10507411
610 Ga0207670_10000420
611 Ga0207670_10001606
612 Ga0207670_10043487
613 Ga0207669_10000303
614 Ga0207704_10002966
615 Ga0207691_10000173
616 Ga0207691_10003696
617 Ga0207711_10007180
618 Ga0207711_11014350
619 Ga0207689_10000287
620 Ga0207679_10421907
621 Ga0207667_10018498
622 Ga0207667_10132835
623 Ga0207712_10001006
624 Ga0207668_10001718
625 Ga0207668_10270854
626 Ga0207658_10045597
627 Ga0207658_10325298
628 Ga0207677_10001271
629 Ga0207677_10021183
630 Ga0207677_10234091
631 Ga0207703_11577192
632 Ga0207639_10081070
633 Ga0207678_10008975
634 Ga0207678_10220740
635 Ga0207708_10020333
636 Ga0207708_11153465
637 Ga0207702_11514440
638 Ga0207641_10057288
639 Ga0207641_10361807
640 Ga0207641_11408291
641 Ga0207648_10000247
642 Ga0207648_10432282
643 Ga0207648_10815722
644 Ga0207676_10002084
645 Ga0207674_10000426
646 Ga0207674_11084390
647 Ga0207675_100000063
648 Ga0207675_100066699
649 Ga0207683_10000053
650 Ga0207683_10197995
651 Ga0207698_10191736
652 Ga0207698_10215808
653 Ga0207428_10008546
654 Ga0268266_10001038
655 Ga0268266_10014270
656 Ga0268266_10155639
657 Ga0268266_11300442
658 Ga0268265_10002440
659 Ga0268265_10340575
660 Ga0268265_10382537
661 Ga0268264_10000986
662 Ga0268264_10422132
663 Ga0265337_1006553
664 Ga0265338_10462293
665 Ga0265332_10078102
666 Ga0265320_10026140
667 Ga0307513_10186928
668 Ga0307509_10209612
669 Ga0307508_10625674
670 Ga0307416_101407988
671 Ga0307414_10865970
672 Ga0373928_0122101
673 Ga0373954_0370655
674 Ga0373943_0223431
675 Ga0373955_0097355
676 Ga0373942_0050634
677 Ga0373931_0219248
678 Ga0373935_0560954
679 Ga0373937_0025263
680 Ga0373937_0145579
681 Ga0373937_0877639
682 Ga0436361_0762727
683 Ga0436363_0557477
684 Ga0436363_1644309
685 Ga0451793_0230728
686 Ga0451797_1281718
687 Ga0451797_1426412
688 Ga0451795_1253713
689 Ga0451802_1599663
690 Ga0451804_0597469
691 Ga0451807_0323219
692 Ga0451807_0973877
693 Ga0451807_2228592
694 Ga0451839_0610579
695 Ga0451841_0134688
696 Ga0451849_1563670
697 Ga0451853_3720402
698 Ga0439448_0015039
699 Ga0439450_172642
700 Ga0439455_0007368
701 Ga0450896_036063
702 Ga0466959_0583288
703 Ga0451576_1046052
704 Ga0495662_0107882
705 Ga0495628_0001524
706 Ga0495613_0861305
707 Ga0495600_0427869
708 Ga0495684_0028093
709 Ga0496102_0049731
710 Ga0496104_0279400
711 Ga0496106_0014970
712 Ga0496107_0004956
713 Ga0496108_0037698
714 Ga0496109_0009793
715 Ga0496110_1036935
716 Ga0496112_0003038
717 Ga0496114_0339763
718 Ga0501032_0048053
719 Ga0501032_0726977
720 Ga0501033_0842101
721 Ga0501034_0009350
722 Ga0501034_0071472
723 Ga0501038_0195177
724 Ga0501038_0776032
725 Ga0501043_0009569
726 Ga0501043_0154335
727 Ga0501043_0542149
728 Ga0501046_0062571
729 Ga0501046_0133271
730 Ga0501047_0004201
731 Ga0501047_0032486
732 Ga0501047_0066619
733 Ga0501048_0479839
734 Ga0501048_0616559
735 Ga0501067_0016751
736 Ga0501068_0000163
737 Ga0501069_0022084
738 Ga0501070_0000705
739 Ga0501072_0000004
740 Ga0501073_0065046
741 Ga0501073_0120952
742 Ga0501076_0104274
743 Ga0501077_0012019
744 Ga0501077_0468588
745 Ga0501079_0021414
746 Ga0501080_0034224
747 Ga0501080_0729166
748 Ga0501080_0895132
749 Ga0501083_0020261
750 Ga0501083_0700954
751 Ga0501044_0093493
752 Ga0501044_0139764
753 nmdc:mga05p37_1885280_c1
754 nmdc:mga05p37_277708_c1
755 nmdc:mga09592_4432_c1
756 nmdc:mga0qj67_108338_c1
757 nmdc:mga0qj67_33850_c1
758 nmdc:mga06r32_12442_c1
759 nmdc:mga06r32_223254_c1
760 nmdc:mga06r32_301590_c1
761 nmdc:mga06r32_455031_c1
762 nmdc:mga0n895_357448_c1
763 nmdc:mga0n895_918154_c1
764 nmdc:mga0n895_95753_c1
765 nmdc:mga0rr50_134503_c1
766 nmdc:mga0a205_1041883_c1
767 nmdc:mga0a205_495126_c1
768 Ga0500641_0323332
769 Ga0500556_0231214
770 Ga0500617_128151
771 Ga0500642_0228113
772 Ga0500559_0429658
773 Ga0500568_0007526
774 Ga0500588_0004045
775 Ga0501084_0000308
776 Ga0501084_0415913
777 Ga0501082_0012038
778 Ga0530510_0034553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

31

163

0.92

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

36

147

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.842 8 145
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.8357 8 145
3itw-assembly1.cif.gz_B-2 crystal structure of tiox from micromonospora sp. ml1 0.8323 9 143
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.808 12 141
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.8018 9 143
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8698 85 145 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8566 87 149 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.856 85 145 3.30.720.110
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8254 89 142 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.808 12 141 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2V9PIK7-F1-model_v4 VOC domain-containing protein 0.9484 1 145 GO:0003700
AF-A0A7W0SZ62-F1-model_v4 VOC family protein 0.9386 9 143
AF-A0A7W7ZYJ9-F1-model_v4 Putative glyoxalase superfamily protein PhnB 0.9378 8 143
AF-A0A5C7JCL7-F1-model_v4 Glyoxalase 0.937 9 142
AF-A0A7H8KD65-F1-model_v4 VOC family protein 0.937 9 143

Map