F431337

General Info

Members Datasets Scaffolds Average Seq Length
389 260 778 191

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100001664|Ga0070714_1000016645
Length 214
Sequence MRAYRVRCAFKSAWITTEETEVSTSVLYMSISLDGYVAGPNDEPGNPGGDGFGRLHDWYGESQPSGAGPSKVSAEFIDELNATGAVLAGRRTVEQADHYGGDHHGVPIFVPSHRPPDPSVAGYPQVTYVTDGIESAMAQAKAAAGDRNVLVHGGYTAQRALEAGVLDEIQIHQIPVLFGRGRRLFDVLPSRIELEIIRVIDTPEATHIRYRIRR

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
103 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
104 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
105 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
130 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
131 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
132 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
133 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
134 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
135 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
136 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
137 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
138 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
139 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
140 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
141 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
142 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
159 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
160 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
243 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
244 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
245 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
251 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
252 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
253 2643221584 Caulobacter sp. Root656 Isolate Unclassified
254 2643221640 Caulobacter sp. Root342 Isolate Unclassified
255 2643221642 Caulobacter sp. Root343 Isolate Unclassified
256 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
257 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
258 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
259 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
260 2928153084 Leifsonia sp. 563 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.17
Metatranscriptomes 0.26
Isolates 2.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.03
Nodule 0.51
Rhizoplane 3.6
Rhizosphere 78.41
Stem 0
Stem Tuber 0
Unclassified 3.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100001664 3300005435 Bacteria 16176
2 JGI24735J21928_10005697 3300002067 Bacteria 4117
3 JGI25153J46596_10002162 3300003215 Bacteria 11499
4 rootH1_10127380 3300003323 Bacteria 5681
5 Ga0055526_1000901 3300003771 Bacteria 22132
6 Ga0055524_1070938 3300003775 Bacteria 671
7 Ga0055536_1007681 3300003781 Bacteria 4778
8 Ga0055530_10007385 3300003791 Bacteria 4642
9 JGI25405J52794_10067677 3300003911 Bacteria 777
10 Ga0068869_100039312 3300005334 Bacteria 3377
11 Ga0070660_100000768 3300005339 Bacteria 21276
12 Ga0070660_100023832 3300005339 Bacteria 4537
13 Ga0070660_100078434 3300005339 Bacteria 2590
14 Ga0070668_100090718 3300005347 Bacteria 2408
15 Ga0070688_100099466 3300005365 Bacteria 1915
16 Ga0070667_100065343 3300005367 Bacteria 3089
17 Ga0070709_10042296 3300005434 Unclassified 2813
18 Ga0070714_100357421 3300005435 Unclassified 1373
19 Ga0070713_100312470 3300005436 Bacteria 1449
20 Ga0070711_100063656 3300005439 Bacteria 2575
21 Ga0070711_100300912 3300005439 Bacteria 1275
22 Ga0070663_100085890 3300005455 Bacteria 2323
23 Ga0070678_101095551 3300005456 Bacteria 735
24 Ga0070706_101378802 3300005467 Bacteria 646
25 Ga0070707_100135414 3300005468 Bacteria 2396
26 Ga0070698_100278440 3300005471 Unclassified 1604
27 Ga0070698_100593862 3300005471 Bacteria 1047
28 Ga0070697_100506805 3300005536 Bacteria 1056
29 Ga0068853_100003661 3300005539 Bacteria 11789
30 Ga0068853_100164015 3300005539 Bacteria 2007
31 Ga0070665_100006552 3300005548 Bacteria 11834
32 Ga0070665_101623810 3300005548 Bacteria 654
33 Ga0068855_100001611 3300005563 Bacteria 28311
34 Ga0068855_100147247 3300005563 Bacteria 2680
35 Ga0068855_100486556 3300005563 Bacteria 1343
36 Ga0068857_100000516 3300005577 Bacteria 27794
37 Ga0068857_101062943 3300005577 Bacteria 781
38 Ga0068854_100062850 3300005578 Bacteria 2694
39 Ga0068863_100003853 3300005841 Bacteria 14834
40 Ga0068863_100877673 3300005841 Bacteria 897
41 Ga0081455_10001838 3300005937 Bacteria 25533
42 Ga0081538_10000700 3300005981 Bacteria 36835
43 Ga0081538_10039122 3300005981 Bacteria 3047
44 Ga0081539_10005211 3300005985 Bacteria 13472
45 Ga0081539_10021774 3300005985 Bacteria 4267
46 Ga0070717_10264135 3300006028 Bacteria 1523
47 Ga0070717_10272697 3300006028 Bacteria 1499
48 Ga0070717_10611669 3300006028 Bacteria 988
49 Ga0070716_100045752 3300006173 Bacteria 2459
50 Ga0070712_100161345 3300006175 Bacteria 1731
51 Ga0070712_100771487 3300006175 Bacteria 824
52 Ga0075367_10015690 3300006178 Bacteria 4122
53 Ga0075370_10060961 3300006353 Bacteria 2149
54 Ga0075370_10347666 3300006353 Bacteria 886
55 Ga0075428_100012531 3300006844 Bacteria 9429
56 Ga0075428_100083883 3300006844 Bacteria 3477
57 Ga0075428_100107963 3300006844 Bacteria 3033
58 Ga0075431_100132468 3300006847 Bacteria 2571
59 Ga0075429_100003426 3300006880 Bacteria 13527
60 Ga0075429_100394895 3300006880 Bacteria 1211
61 Ga0111539_10149921 3300009094 Bacteria 2730
62 Ga0111539_10868108 3300009094 Bacteria 1050
63 Ga0111539_11401422 3300009094 Bacteria 811
64 Ga0114129_10002099 3300009147 Bacteria 27418
65 Ga0114129_10239018 3300009147 Bacteria 2442
66 Ga0114129_10336939 3300009147 Bacteria 2002
67 Ga0114129_10598128 3300009147 Bacteria 1429
68 Ga0105241_10139230 3300009174 Bacteria 1974
69 Ga0105242_11505270 3300009176 Bacteria 704
70 Ga0105237_10046561 3300009545 Bacteria 4362
71 Ga0105238_10168003 3300009551 Bacteria 2169
72 Ga0105249_10475035 3300009553 Bacteria 1292
73 Ga0123341_1000528 3300009765 Bacteria 23671
74 Ga0105239_11057137 3300010375 Bacteria 934
75 Ga0157314_1000063 3300012500 Bacteria 11461
76 Ga0157370_10458294 3300013104 Bacteria 1172
77 Ga0157378_10713831 3300013297 Bacteria 1023
78 Ga0157378_11153422 3300013297 Bacteria 813
79 Ga0157380_10220196 3300014326 Bacteria 1698
80 Ga0213874_10089437 3300021377 Bacteria 1009
81 Ga0213876_10025599 3300021384 Bacteria 3112
82 Ga0213875_10014336 3300021388 Bacteria 3867
83 Ga0213875_10032548 3300021388 Bacteria 2463
84 Ga0207425_1000214 3300025245 Bacteria 45967
85 Ga0209026_1015394 3300025250 Bacteria 1255
86 Ga0209129_1000185 3300025258 Bacteria 86854
87 Ga0209673_1004123 3300025273 Bacteria 7972
88 Ga0209676_1000394 3300025292 Bacteria 79789
89 Ga0209564_1000349 3300025295 Bacteria 86861
90 Ga0209758_1000339 3300025297 Bacteria 86850
91 Ga0209050_1000686 3300025298 Bacteria 50855
92 Ga0209050_1012876 3300025298 Bacteria 3784
93 Ga0209256_1023026 3300025299 Bacteria 1869
94 Ga0209256_1049115 3300025299 Bacteria 1030
95 Ga0209051_1002470 3300025303 Bacteria 13206
96 Ga0209257_1008595 3300025304 Bacteria 5745
97 Ga0209257_1014199 3300025304 Bacteria 3445
98 Ga0207692_10038259 3300025898 Bacteria 2352
99 Ga0207654_10188501 3300025911 Bacteria 1350
100 Ga0207671_10030473 3300025914 Bacteria 4023
101 Ga0207671_10316109 3300025914 Bacteria 1235
102 Ga0207693_10006567 3300025915 Bacteria 9624
103 Ga0207693_10009621 3300025915 Bacteria 7870
104 Ga0207693_10130394 3300025915 Bacteria 1976
105 Ga0207693_10603311 3300025915 Bacteria 854
106 Ga0207663_10003441 3300025916 Bacteria 7750
107 Ga0207663_10288666 3300025916 Bacteria 1221
108 Ga0207663_10446336 3300025916 Unclassified 997
109 Ga0207657_10001845 3300025919 Bacteria 22885
110 Ga0207657_10034152 3300025919 Bacteria 4577
111 Ga0207694_10048018 3300025924 Bacteria 3302
112 Ga0207700_10648472 3300025928 Bacteria 941
113 Ga0207700_10766928 3300025928 Bacteria 862
114 Ga0207664_10000881 3300025929 Bacteria 20276
115 Ga0207664_10088759 3300025929 Bacteria 2531
116 Ga0207664_10327288 3300025929 Bacteria 1353
117 Ga0207664_10650633 3300025929 Bacteria 947
118 Ga0207664_11097289 3300025929 Bacteria 711
119 Ga0207665_10045978 3300025939 Bacteria 2924
120 Ga0207689_10129231 3300025942 Bacteria 2079
121 Ga0207667_10003527 3300025949 Bacteria 19334
122 Ga0207667_10159045 3300025949 Bacteria 2324
123 Ga0207667_10485374 3300025949 Bacteria 1254
124 Ga0207640_10124389 3300025981 Bacteria 1854
125 Ga0207658_10087279 3300025986 Bacteria 2409
126 Ga0207639_10002606 3300026041 Bacteria 12097
127 Ga0207639_10004431 3300026041 Bacteria 9475
128 Ga0207639_10183775 3300026041 Bacteria 1780
129 Ga0207678_10057987 3300026067 Bacteria 3332
130 Ga0207702_10000310 3300026078 Bacteria 55596
131 Ga0207641_10042358 3300026088 Bacteria 3819
132 Ga0207674_10000235 3300026116 Bacteria 69087
133 Ga0207674_10099215 3300026116 Bacteria 2895
134 Ga0209813_10114294 3300027866 Bacteria 933
135 Ga0207428_10499037 3300027907 Bacteria 884
136 Ga0268266_10005551 3300028379 Bacteria 11741
137 Ga0268266_10273659 3300028379 Bacteria 1568
138 Ga0265325_10186572 3300031241 Bacteria 963
139 Ga0307408_100084318 3300031548 Bacteria 2383
140 Ga0307405_10000141 3300031731 Bacteria 27923
141 Ga0307405_10235401 3300031731 Bacteria 1353
142 Ga0307413_10129185 3300031824 Bacteria 1726
143 Ga0307410_10079304 3300031852 Bacteria 2300
144 Ga0307410_10088095 3300031852 Bacteria 2197
145 Ga0307406_10010401 3300031901 Bacteria 5246
146 Ga0307406_10037373 3300031901 Unclassified 2998
147 Ga0307406_10047071 3300031901 Bacteria 2717
148 Ga0307407_10011157 3300031903 Unclassified 4266
149 Ga0307412_10302026 3300031911 Bacteria 1266
150 Ga0307409_100003027 3300031995 Bacteria 8979
151 Ga0307409_100038579 3300031995 Bacteria 3535
152 Ga0307409_101036729 3300031995 Bacteria 839
153 Ga0307416_100000422 3300032002 Bacteria 21570
154 Ga0307416_100423040 3300032002 Bacteria 1377
155 Ga0307411_10121384 3300032005 Bacteria 1891
156 Ga0307415_100000039 3300032126 Bacteria 56866
157 Ga0307415_100121766 3300032126 Bacteria 1957
158 Ga0307415_100203569 3300032126 Bacteria 1573
159 Ga0307415_101478315 3300032126 Bacteria 649
160 Ga0316214_1012346 3300033545 Bacteria 1166
161 Ga0316212_1027796 3300033547 Bacteria 794
162 Ga0373930_0022266 3300034816 Bacteria 1252
163 Ga0373944_0007695 3300035089 Bacteria 2893
164 Ga0373936_0002507 3300035113 Bacteria 6882
165 Ga0373954_0145518 3300035118 Bacteria 1157
166 Ga0373957_0275152 3300035120 Bacteria 711
167 Ga0373943_0004858 3300035170 Bacteria 6076
168 Ga0373943_0022525 3300035170 Bacteria 2920
169 Ga0373946_0004474 3300035171 Bacteria 5004
170 Ga0373946_0094901 3300035171 Bacteria 1328
171 Ga0373955_0020865 3300035172 Bacteria 3299
172 Ga0373935_0024013 3300035692 Bacteria 3748
173 Ga0373935_0172163 3300035692 Bacteria 1482
174 Ga0373927_0005881 3300035695 Bacteria 8407
175 Ga0373927_0254919 3300035695 Bacteria 1153
176 Ga0373933_0560620 3300035724 Bacteria 750
177 Ga0373947_0093807 3300035725 Bacteria 1876
178 Ga0373947_0211693 3300035725 Bacteria 1272
179 Ga0373937_0809368 3300036401 Bacteria 885
180 Ga0372808_001186 3300036459 Bacteria 2597
181 Ga0373925_0084314 3300037068 Bacteria 2421
182 Ga0373925_0686798 3300037068 Bacteria 844
183 Ga0395899_0019038 3300037312 Bacteria 5217
184 Ga0395899_0091865 3300037312 Bacteria 2199
185 Ga0395900_0006383 3300037418 Bacteria 12293
186 Ga0395900_0025006 3300037418 Bacteria 6111
187 Ga0395900_0170799 3300037418 Bacteria 2214
188 Ga0395900_0196776 3300037418 Bacteria 2041
189 Ga0395900_0737698 3300037418 Bacteria 916
190 Ga0395898_0002445 3300037466 Bacteria 21961
191 Ga0395898_0035903 3300037466 Bacteria 4925
192 Ga0395898_0564537 3300037466 Bacteria 1080
193 Ga0395905_0012628 3300037471 Bacteria 8126
194 Ga0395905_0058327 3300037471 Bacteria 3609
195 Ga0436364_0026190 3300037853 Bacteria 6285
196 Ga0436364_0171430 3300037853 Bacteria 1679
197 Ga0436364_0187301 3300037853 Bacteria 1290
198 Ga0436364_0262228 3300037853 Bacteria 2635
199 Ga0436364_0285021 3300037853 Bacteria 812
200 Ga0436364_1230606 3300037853 Bacteria 981
201 Ga0436364_1259472 3300037853 Bacteria 5071
202 Ga0395901_0005448 3300038443 Bacteria 12882
203 Ga0395901_0059381 3300038443 Bacteria 3979
204 Ga0395901_0101028 3300038443 Bacteria 3026
205 Ga0395901_0284511 3300038443 Bacteria 1717
206 Ga0395901_0363919 3300038443 Bacteria 1491
207 Ga0395901_0657575 3300038443 Bacteria 1050
208 Ga0436365_0579188 3300039437 Bacteria 7629
209 Ga0436365_0785871 3300039437 Bacteria 2770
210 Ga0436361_0050921 3300039447 Bacteria 745
211 Ga0436363_0030563 3300039450 Bacteria 1030
212 Ga0436363_1205330 3300039450 Bacteria 1553
213 Ga0436362_0403308 3300039453 Bacteria 2260
214 Ga0436362_0653913 3300039453 Bacteria 1541
215 Ga0436362_1254154 3300039453 Bacteria 836
216 Ga0451833_0457871 3300041491 Bacteria 1907
217 Ga0451839_1394888 3300041496 Bacteria 2941
218 Ga0439443_068636 3300042003 Bacteria 644
219 Ga0439448_0008144 3300042005 Bacteria 3061
220 Ga0439455_0003029 3300042012 Bacteria 3157
221 Ga0439455_0067393 3300042012 Bacteria 957
222 Ga0439463_000693 3300042016 Bacteria 9334
223 Ga0439463_010443 3300042016 Bacteria 2281
224 Ga0450900_012793 3300042136 Bacteria 1104
225 Ga0450905_014928 3300042142 Bacteria 1110
226 Ga0439458_0096743 3300042157 Unclassified 764
227 Ga0439444_0008600 3300042437 Bacteria 1593
228 Ga0439464_0017470 3300042439 Bacteria 1946
229 Ga0439460_0000774 3300042461 Bacteria 7204
230 Ga0450916_002043 3300042530 Bacteria 2090
231 Ga0439440_0000914 3300042993 Bacteria 5177
232 Ga0466972_0008842 3300044658 Bacteria 5054
233 Ga0466972_0023786 3300044658 Bacteria 3045
234 Ga0466972_0258807 3300044658 Bacteria 813
235 Ga0466965_0012266 3300044683 Bacteria 4027
236 Ga0466965_0232751 3300044683 Unclassified 984
237 Ga0466961_0087074 3300044693 Bacteria 1974
238 Ga0466961_0138419 3300044693 Bacteria 1525
239 Ga0466961_0340633 3300044693 Bacteria 913
240 Ga0466964_0428667 3300044706 Bacteria 697
241 Ga0466968_0046852 3300044735 Bacteria 1837
242 Ga0466968_0213859 3300044735 Bacteria 906
243 Ga0466970_0005128 3300044765 Bacteria 6472
244 Ga0466970_0304311 3300044765 Bacteria 899
245 Ga0466957_0050725 3300044842 Bacteria 2525
246 Ga0466960_0020632 3300044901 Bacteria 2921
247 Ga0466960_0214385 3300044901 Bacteria 1057
248 Ga0466960_0425054 3300044901 Bacteria 769
249 Ga0466959_0002312 3300045049 Bacteria 12156
250 Ga0466959_0025149 3300045049 Bacteria 4410
251 Ga0466958_0064358 3300045836 Bacteria 2236
252 Ga0466958_0289958 3300045836 Bacteria 1050
253 Ga0466958_0671120 3300045836 Bacteria 675
254 Ga0466967_0002429 3300045976 Bacteria 11589
255 Ga0466967_0019363 3300045976 Bacteria 5471
256 Ga0495592_0086972 3300046454 Bacteria 2250
257 Ga0495592_0293952 3300046454 Bacteria 1058
258 Ga0495651_0052207 3300046462 Bacteria 3149
259 Ga0495651_0113748 3300046462 Bacteria 1997
260 Ga0495653_0012055 3300046463 Bacteria 7053
261 Ga0495582_0057315 3300046473 Bacteria 2148
262 Ga0495639_0182896 3300046475 Bacteria 1021
263 Ga0495662_0068407 3300046476 Bacteria 1719
264 Ga0495664_0001508 3300046477 Bacteria 12335
265 Ga0495585_0133968 3300046492 Bacteria 1302
266 Ga0495596_0051671 3300046500 Bacteria 1610
267 Ga0495608_0022643 3300046511 Bacteria 4309
268 Ga0495618_0083704 3300046514 Bacteria 2038
269 Ga0495628_0182426 3300046516 Bacteria 1587
270 Ga0495630_0050790 3300046517 Bacteria 3103
271 Ga0495632_0000766 3300046519 Bacteria 28794
272 Ga0495644_0242208 3300046523 Bacteria 700
273 Ga0495652_0009580 3300046529 Bacteria 8797
274 Ga0495587_0060133 3300046536 Bacteria 2229
275 Ga0495597_0148521 3300046542 Bacteria 963
276 Ga0495645_0286055 3300046543 Bacteria 1082
277 Ga0495667_0081353 3300046559 Bacteria 2105
278 Ga0495656_0000246 3300046615 Bacteria 19061
279 Ga0495668_0055413 3300046616 Bacteria 2189
280 Ga0495668_0070963 3300046616 Bacteria 1914
281 Ga0495668_0186542 3300046616 Bacteria 1136
282 Ga0495634_0031929 3300046642 Bacteria 3624
283 Ga0495625_0029062 3300046660 Bacteria 4138
284 Ga0495635_0006668 3300046663 Bacteria 8064
285 Ga0495635_0197180 3300046663 Bacteria 1366
286 Ga0495659_0243687 3300046664 Bacteria 747
287 Ga0495657_0270346 3300046675 Bacteria 1019
288 Ga0495599_0048679 3300046678 Bacteria 2657
289 Ga0495599_0075204 3300046678 Bacteria 2109
290 Ga0495647_0208431 3300046681 Bacteria 859
291 Ga0495613_0049641 3300046689 Bacteria 3096
292 Ga0495624_0007328 3300046690 Bacteria 7744
293 Ga0495670_0000465 3300046691 Bacteria 19320
294 Ga0495649_0303981 3300046694 Bacteria 812
295 Ga0495600_0060269 3300046809 Bacteria 2478
296 Ga0495660_0004578 3300046810 Bacteria 8348
297 Ga0495660_0309349 3300046810 Bacteria 713
298 Ga0495581_0140239 3300047315 Bacteria 1410
299 Ga0495604_0714460 3300047317 Bacteria 635
300 Ga0495636_0148837 3300047318 Bacteria 1049
301 Ga0495674_0018889 3300047319 Bacteria 6411
302 Ga0495672_0022583 3300047320 Bacteria 4087
303 Ga0495676_0012194 3300047321 Bacteria 7753
304 Ga0495680_0051830 3300047322 Bacteria 3201
305 Ga0495680_0083094 3300047322 Bacteria 2415
306 Ga0495683_0065812 3300047323 Bacteria 1787
307 Ga0495681_0107410 3300047470 Bacteria 1212
308 Ga0495681_0107921 3300047470 Bacteria 1209
309 Ga0495684_0003476 3300047471 Bacteria 12326
310 Ga0496104_0019645 3300048907 Bacteria 6186
311 Ga0496105_0039339 3300048908 Unclassified 3898
312 Ga0496105_0511936 3300048908 Bacteria 941
313 Ga0496107_0390572 3300048910 Bacteria 1035
314 Ga0496108_0039288 3300048911 Bacteria 3945
315 Ga0496110_0073554 3300048913 Bacteria 3033
316 Ga0496110_0756973 3300048913 Bacteria 875
317 Ga0496112_0003553 3300048915 Bacteria 12949
318 Ga0496112_0234360 3300048915 Unclassified 1790
319 Ga0496113_0005816 3300048916 Bacteria 7739
320 Ga0496113_0028274 3300048916 Bacteria 4031
321 Ga0496115_0096888 3300048918 Unclassified 2416
322 Ga0496115_0123518 3300048918 Bacteria 2131
323 Ga0496115_0327577 3300048918 Bacteria 1252
324 Ga0496121_0003802 3300048924 Bacteria 21043
325 Ga0501034_0188389 3300049571 Bacteria 2026
326 Ga0501039_0038813 3300049575 Bacteria 3677
327 Ga0501040_0588784 3300049576 Bacteria 803
328 Ga0501041_0387325 3300049577 Bacteria 885
329 Ga0501047_0099112 3300049581 Bacteria 2793
330 Ga0501067_0020452 3300049583 Bacteria 3664
331 Ga0501067_0225999 3300049583 Bacteria 1042
332 Ga0501069_0135051 3300049585 Bacteria 1414
333 Ga0501070_0860931 3300049586 Bacteria 709
334 Ga0501071_0129962 3300049587 Bacteria 1870
335 Ga0501075_0354403 3300049591 Bacteria 1118
336 Ga0501076_0292375 3300049592 Bacteria 1335
337 Ga0501079_0219775 3300049741 Bacteria 1484
338 Ga0501080_0187639 3300049742 Bacteria 1901
339 Ga0501269_027676 3300049766 Bacteria 720
340 Ga0501035_0179877 3300049822 Bacteria 1822
341 Ga0501044_0010327 3300049823 Bacteria 10140
342 nmdc:mga00v17_493107_c1 3300050491 Bacteria 794
343 nmdc:mga0yw44_3915_c1 3300050492 Bacteria 6714
344 nmdc:mga0yw44_610516_c1 3300050492 Bacteria 741
345 nmdc:mga0k408_42650_c1 3300050493 Bacteria 2613
346 nmdc:mga0k408_62292_c1 3300050493 Bacteria 2169
347 nmdc:mga06z11_39262_c1 3300050494 Bacteria 2355
348 nmdc:mga04h51_134770_c1 3300050495 Bacteria 932
349 nmdc:mga07m45_141020_c1 3300050496 Bacteria 1396
350 nmdc:mga05p37_401709_c1 3300050507 Bacteria 1600
351 nmdc:mga05p37_590055_c1 3300050507 Bacteria 1256
352 nmdc:mga05p37_662109_c1 3300050507 Bacteria 1167
353 nmdc:mga05p37_684926_c1 3300050507 Unclassified 1142
354 nmdc:mga05p37_703053_c1 3300050507 Bacteria 1122
355 nmdc:mga05p37_83995_c1 3300050507 Bacteria 3923
356 nmdc:mga09592_754694_c1 3300050508 Bacteria 825
357 nmdc:mga0qj67_106893_c1 3300050509 Bacteria 2257
358 nmdc:mga06r32_149422_c1 3300050510 Bacteria 2314
359 nmdc:mga08y16_1342294_c1 3300050511 Unclassified 680
360 nmdc:mga08y16_214459_c2 3300050511 Bacteria 1633
361 nmdc:mga08y16_981330_c1 3300050511 Bacteria 826
362 nmdc:mga08x19_612011_c1 3300050514 Bacteria 772
363 nmdc:mga0a205_295202_c1 3300050515 Bacteria 1494
364 Ga0495612_0010527 3300053078 Bacteria 3739
365 Ga0495595_0018534 3300053084 Bacteria 3009
366 Ga0495619_0043263 3300053085 Bacteria 2952
367 Ga0500583_0004477 3300053092 Bacteria 4563
368 Ga0500641_0043518 3300053096 Bacteria 1823
369 Ga0500594_0187547 3300053118 Bacteria 676
370 Ga0500658_0043227 3300053134 Bacteria 1814
371 Ga0500588_0000878 3300053146 Bacteria 5279
372 Ga0500604_0208476 3300053151 Bacteria 673
373 Ga0500616_0000770 3300053153 Bacteria 36895
374 Ga0500616_0003348 3300053153 Bacteria 12331
375 Ga0500622_0031904 3300053156 Bacteria 2764
376 Ga0501082_0986824 3300060353 Bacteria 736
377 Ga0466962_0042278 3300061719 Bacteria 2181
378 Ga0530510_0024389 3300061734 Bacteria 4315
379 Ga0530510_0216365 3300061734 Bacteria 1424
380 2587917360 2585428106 Bacteria 5179711
381 2643779751 2643221552 Bacteria 5708754
382 2643927691 2643221584 Bacteria 5511711
383 2644227119 2643221640 Bacteria 5258820
384 2644233414 2643221642 Bacteria 5357871
385 2793318326 2791355259 Bacteria 7254731
386 2887478900 2887478801 Bacteria 8972725
387 2919058136 2919055335 Bacteria 3875751
388 2919524485 2919523602 Bacteria 3788128
389 2928156598 2928153084 Bacteria 4020257
390 Ga0070714_100001664
391 JGI24735J21928_10005697
392 JGI25153J46596_10002162
393 rootH1_10127380
394 Ga0055526_1000901
395 Ga0055524_1070938
396 Ga0055536_1007681
397 Ga0055530_10007385
398 JGI25405J52794_10067677
399 Ga0068869_100039312
400 Ga0070660_100000768
401 Ga0070660_100023832
402 Ga0070660_100078434
403 Ga0070668_100090718
404 Ga0070688_100099466
405 Ga0070667_100065343
406 Ga0070709_10042296
407 Ga0070714_100357421
408 Ga0070713_100312470
409 Ga0070711_100063656
410 Ga0070711_100300912
411 Ga0070663_100085890
412 Ga0070678_101095551
413 Ga0070706_101378802
414 Ga0070707_100135414
415 Ga0070698_100278440
416 Ga0070698_100593862
417 Ga0070697_100506805
418 Ga0068853_100003661
419 Ga0068853_100164015
420 Ga0070665_100006552
421 Ga0070665_101623810
422 Ga0068855_100001611
423 Ga0068855_100147247
424 Ga0068855_100486556
425 Ga0068857_100000516
426 Ga0068857_101062943
427 Ga0068854_100062850
428 Ga0068863_100003853
429 Ga0068863_100877673
430 Ga0081455_10001838
431 Ga0081538_10000700
432 Ga0081538_10039122
433 Ga0081539_10005211
434 Ga0081539_10021774
435 Ga0070717_10264135
436 Ga0070717_10272697
437 Ga0070717_10611669
438 Ga0070716_100045752
439 Ga0070712_100161345
440 Ga0070712_100771487
441 Ga0075367_10015690
442 Ga0075370_10060961
443 Ga0075370_10347666
444 Ga0075428_100012531
445 Ga0075428_100083883
446 Ga0075428_100107963
447 Ga0075431_100132468
448 Ga0075429_100003426
449 Ga0075429_100394895
450 Ga0111539_10149921
451 Ga0111539_10868108
452 Ga0111539_11401422
453 Ga0114129_10002099
454 Ga0114129_10239018
455 Ga0114129_10336939
456 Ga0114129_10598128
457 Ga0105241_10139230
458 Ga0105242_11505270
459 Ga0105237_10046561
460 Ga0105238_10168003
461 Ga0105249_10475035
462 Ga0123341_1000528
463 Ga0105239_11057137
464 Ga0157314_1000063
465 Ga0157370_10458294
466 Ga0157378_10713831
467 Ga0157378_11153422
468 Ga0157380_10220196
469 Ga0213874_10089437
470 Ga0213876_10025599
471 Ga0213875_10014336
472 Ga0213875_10032548
473 Ga0207425_1000214
474 Ga0209026_1015394
475 Ga0209129_1000185
476 Ga0209673_1004123
477 Ga0209676_1000394
478 Ga0209564_1000349
479 Ga0209758_1000339
480 Ga0209050_1000686
481 Ga0209050_1012876
482 Ga0209256_1023026
483 Ga0209256_1049115
484 Ga0209051_1002470
485 Ga0209257_1008595
486 Ga0209257_1014199
487 Ga0207692_10038259
488 Ga0207654_10188501
489 Ga0207671_10030473
490 Ga0207671_10316109
491 Ga0207693_10006567
492 Ga0207693_10009621
493 Ga0207693_10130394
494 Ga0207693_10603311
495 Ga0207663_10003441
496 Ga0207663_10288666
497 Ga0207663_10446336
498 Ga0207657_10001845
499 Ga0207657_10034152
500 Ga0207694_10048018
501 Ga0207700_10648472
502 Ga0207700_10766928
503 Ga0207664_10000881
504 Ga0207664_10088759
505 Ga0207664_10327288
506 Ga0207664_10650633
507 Ga0207664_11097289
508 Ga0207665_10045978
509 Ga0207689_10129231
510 Ga0207667_10003527
511 Ga0207667_10159045
512 Ga0207667_10485374
513 Ga0207640_10124389
514 Ga0207658_10087279
515 Ga0207639_10002606
516 Ga0207639_10004431
517 Ga0207639_10183775
518 Ga0207678_10057987
519 Ga0207702_10000310
520 Ga0207641_10042358
521 Ga0207674_10000235
522 Ga0207674_10099215
523 Ga0209813_10114294
524 Ga0207428_10499037
525 Ga0268266_10005551
526 Ga0268266_10273659
527 Ga0265325_10186572
528 Ga0307408_100084318
529 Ga0307405_10000141
530 Ga0307405_10235401
531 Ga0307413_10129185
532 Ga0307410_10079304
533 Ga0307410_10088095
534 Ga0307406_10010401
535 Ga0307406_10037373
536 Ga0307406_10047071
537 Ga0307407_10011157
538 Ga0307412_10302026
539 Ga0307409_100003027
540 Ga0307409_100038579
541 Ga0307409_101036729
542 Ga0307416_100000422
543 Ga0307416_100423040
544 Ga0307411_10121384
545 Ga0307415_100000039
546 Ga0307415_100121766
547 Ga0307415_100203569
548 Ga0307415_101478315
549 Ga0316214_1012346
550 Ga0316212_1027796
551 Ga0373930_0022266
552 Ga0373944_0007695
553 Ga0373936_0002507
554 Ga0373954_0145518
555 Ga0373957_0275152
556 Ga0373943_0004858
557 Ga0373943_0022525
558 Ga0373946_0004474
559 Ga0373946_0094901
560 Ga0373955_0020865
561 Ga0373935_0024013
562 Ga0373935_0172163
563 Ga0373927_0005881
564 Ga0373927_0254919
565 Ga0373933_0560620
566 Ga0373947_0093807
567 Ga0373947_0211693
568 Ga0373937_0809368
569 Ga0372808_001186
570 Ga0373925_0084314
571 Ga0373925_0686798
572 Ga0395899_0019038
573 Ga0395899_0091865
574 Ga0395900_0006383
575 Ga0395900_0025006
576 Ga0395900_0170799
577 Ga0395900_0196776
578 Ga0395900_0737698
579 Ga0395898_0002445
580 Ga0395898_0035903
581 Ga0395898_0564537
582 Ga0395905_0012628
583 Ga0395905_0058327
584 Ga0436364_0026190
585 Ga0436364_0171430
586 Ga0436364_0187301
587 Ga0436364_0262228
588 Ga0436364_0285021
589 Ga0436364_1230606
590 Ga0436364_1259472
591 Ga0395901_0005448
592 Ga0395901_0059381
593 Ga0395901_0101028
594 Ga0395901_0284511
595 Ga0395901_0363919
596 Ga0395901_0657575
597 Ga0436365_0579188
598 Ga0436365_0785871
599 Ga0436361_0050921
600 Ga0436363_0030563
601 Ga0436363_1205330
602 Ga0436362_0403308
603 Ga0436362_0653913
604 Ga0436362_1254154
605 Ga0451833_0457871
606 Ga0451839_1394888
607 Ga0439443_068636
608 Ga0439448_0008144
609 Ga0439455_0003029
610 Ga0439455_0067393
611 Ga0439463_000693
612 Ga0439463_010443
613 Ga0450900_012793
614 Ga0450905_014928
615 Ga0439458_0096743
616 Ga0439444_0008600
617 Ga0439464_0017470
618 Ga0439460_0000774
619 Ga0450916_002043
620 Ga0439440_0000914
621 Ga0466972_0008842
622 Ga0466972_0023786
623 Ga0466972_0258807
624 Ga0466965_0012266
625 Ga0466965_0232751
626 Ga0466961_0087074
627 Ga0466961_0138419
628 Ga0466961_0340633
629 Ga0466964_0428667
630 Ga0466968_0046852
631 Ga0466968_0213859
632 Ga0466970_0005128
633 Ga0466970_0304311
634 Ga0466957_0050725
635 Ga0466960_0020632
636 Ga0466960_0214385
637 Ga0466960_0425054
638 Ga0466959_0002312
639 Ga0466959_0025149
640 Ga0466958_0064358
641 Ga0466958_0289958
642 Ga0466958_0671120
643 Ga0466967_0002429
644 Ga0466967_0019363
645 Ga0495592_0086972
646 Ga0495592_0293952
647 Ga0495651_0052207
648 Ga0495651_0113748
649 Ga0495653_0012055
650 Ga0495582_0057315
651 Ga0495639_0182896
652 Ga0495662_0068407
653 Ga0495664_0001508
654 Ga0495585_0133968
655 Ga0495596_0051671
656 Ga0495608_0022643
657 Ga0495618_0083704
658 Ga0495628_0182426
659 Ga0495630_0050790
660 Ga0495632_0000766
661 Ga0495644_0242208
662 Ga0495652_0009580
663 Ga0495587_0060133
664 Ga0495597_0148521
665 Ga0495645_0286055
666 Ga0495667_0081353
667 Ga0495656_0000246
668 Ga0495668_0055413
669 Ga0495668_0070963
670 Ga0495668_0186542
671 Ga0495634_0031929
672 Ga0495625_0029062
673 Ga0495635_0006668
674 Ga0495635_0197180
675 Ga0495659_0243687
676 Ga0495657_0270346
677 Ga0495599_0048679
678 Ga0495599_0075204
679 Ga0495647_0208431
680 Ga0495613_0049641
681 Ga0495624_0007328
682 Ga0495670_0000465
683 Ga0495649_0303981
684 Ga0495600_0060269
685 Ga0495660_0004578
686 Ga0495660_0309349
687 Ga0495581_0140239
688 Ga0495604_0714460
689 Ga0495636_0148837
690 Ga0495674_0018889
691 Ga0495672_0022583
692 Ga0495676_0012194
693 Ga0495680_0051830
694 Ga0495680_0083094
695 Ga0495683_0065812
696 Ga0495681_0107410
697 Ga0495681_0107921
698 Ga0495684_0003476
699 Ga0496104_0019645
700 Ga0496105_0039339
701 Ga0496105_0511936
702 Ga0496107_0390572
703 Ga0496108_0039288
704 Ga0496110_0073554
705 Ga0496110_0756973
706 Ga0496112_0003553
707 Ga0496112_0234360
708 Ga0496113_0005816
709 Ga0496113_0028274
710 Ga0496115_0096888
711 Ga0496115_0123518
712 Ga0496115_0327577
713 Ga0496121_0003802
714 Ga0501034_0188389
715 Ga0501039_0038813
716 Ga0501040_0588784
717 Ga0501041_0387325
718 Ga0501047_0099112
719 Ga0501067_0020452
720 Ga0501067_0225999
721 Ga0501069_0135051
722 Ga0501070_0860931
723 Ga0501071_0129962
724 Ga0501075_0354403
725 Ga0501076_0292375
726 Ga0501079_0219775
727 Ga0501080_0187639
728 Ga0501269_027676
729 Ga0501035_0179877
730 Ga0501044_0010327
731 nmdc:mga00v17_493107_c1
732 nmdc:mga0yw44_3915_c1
733 nmdc:mga0yw44_610516_c1
734 nmdc:mga0k408_42650_c1
735 nmdc:mga0k408_62292_c1
736 nmdc:mga06z11_39262_c1
737 nmdc:mga04h51_134770_c1
738 nmdc:mga07m45_141020_c1
739 nmdc:mga05p37_401709_c1
740 nmdc:mga05p37_590055_c1
741 nmdc:mga05p37_662109_c1
742 nmdc:mga05p37_684926_c1
743 nmdc:mga05p37_703053_c1
744 nmdc:mga05p37_83995_c1
745 nmdc:mga09592_754694_c1
746 nmdc:mga0qj67_106893_c1
747 nmdc:mga06r32_149422_c1
748 nmdc:mga08y16_1342294_c1
749 nmdc:mga08y16_214459_c2
750 nmdc:mga08y16_981330_c1
751 nmdc:mga08x19_612011_c1
752 nmdc:mga0a205_295202_c1
753 Ga0495612_0010527
754 Ga0495595_0018534
755 Ga0495619_0043263
756 Ga0500583_0004477
757 Ga0500641_0043518
758 Ga0500594_0187547
759 Ga0500658_0043227
760 Ga0500588_0000878
761 Ga0500604_0208476
762 Ga0500616_0000770
763 Ga0500616_0003348
764 Ga0500622_0031904
765 Ga0501082_0986824
766 Ga0466962_0042278
767 Ga0530510_0024389
768 Ga0530510_0216365
769 2587917360
770 2643779751
771 2643927691
772 2644227119
773 2644233414
774 2793318326
775 2887478900
776 2919058136
777 2919524485
778 2928156598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

24

208

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pft-assembly1.cif.gz_A crystal structure of untagged c54a mutant flavin reductase (dszd) in complex with fmn from mycobacterium goodii 0.7876 168 190
4f07-assembly2.cif.gz_B structure of the styrene monooxygenase flavin reductase (smob) from pseudomonas putida s12 0.7824 168 190
4f07-assembly6.cif.gz_L structure of the styrene monooxygenase flavin reductase (smob) from pseudomonas putida s12 0.7759 168 190
3k87-assembly1.cif.gz_B crystal structure of nadh:fad oxidoreductase (tftc) - fad complex 0.7757 168 190
4l82-assembly1.cif.gz_B structure of a putative oxidoreductase from rickettsia felis 0.7732 168 190
ID Description Score Start End Superfamily
1wgbA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8159 168 190 2.30.110.10
af_Q9UTQ4_42_231_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8034 168 190 2.30.110.10
2d38A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8031 168 190 2.30.110.10
3zoeB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7989 168 190 2.30.110.10
af_O53667_1_162_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7949 168 190 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A535YH66-F1-model_v4 Riboflavin biosynthesis protein RibD 0.9307 57 190 GO:0008703
GO:0009231
AF-A0A535YH66-F1-model_v4 Riboflavin biosynthesis protein RibD 0.9043 57 190 GO:0008703
GO:0009231
AF-A0A5M3XIT4-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.8942 103 190 GO:0008703
GO:0009231
AF-A0A542KV82-F1-model_v4 RibD domain-containing protein 0.8882 59 190 GO:0008703
GO:0009231
AF-A0A535B5C8-F1-model_v4 Deaminase 0.877 45 190 GO:0008703
GO:0009231

Map