F431268

General Info

Members Datasets Scaffolds Average Seq Length
388 225 776 122

Family's Representative Sequence

Representative Sequence 3300053120|Ga0500597_054077|Ga0500597_054077_947_1372
Length 141
Sequence LEIKRLTAQFQGKPAMTARRTSFYLDKQNAKWLGVCSGIAEYTGLERAWVRVGAVLLTIMGGFPWTLIAYLVTAWVANPKPMGLYDSAEDAKFWQGVRQSPTRSTRDVRAKFRDIDRRLADVETHYTSRNSSLANEIDNLR

Samples

Sample ID Description Type Environment
1 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
112 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
120 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
121 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
122 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
123 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
144 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
145 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
148 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
149 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
150 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
156 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
174 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
175 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
176 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
177 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
185 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
186 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
190 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
191 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
192 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
193 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
194 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
195 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
196 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
206 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
207 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
208 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
209 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
210 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
211 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
212 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
213 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
214 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
215 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
216 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
217 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
218 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
219 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
220 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
221 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
222 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
223 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
224 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
225 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 0.52
Isolates 2.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.41
Nodule 0.52
Rhizoplane 2.58
Rhizosphere 84.54
Stem 0
Stem Tuber 0
Unclassified 2.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500597_054077 3300053120 Bacteria 1715
2 SwRhRL2b_contig_3081814 2162886007 Bacteria 7029
3 MBSR1b_contig_1719237 2162886012 Bacteria 883
4 JGI24750J21931_1040649 3300002070 Bacteria 706
5 JGI24748J21848_1018038 3300002074 Bacteria 846
6 JGI24749J21850_1022190 3300002076 Bacteria 900
7 JGI24033J26618_1029836 3300002155 Bacteria 730
8 JGI24742J22300_10086218 3300002244 Bacteria 597
9 JGI24751J29686_10054889 3300002459 Bacteria 821
10 Ga0065714_10238809 3300005288 Bacteria 799
11 Ga0065704_10000727 3300005289 Bacteria 28130
12 Ga0065715_10092118 3300005293 Bacteria 5320
13 Ga0065715_10123164 3300005293 Bacteria 2181
14 Ga0070658_10003530 3300005327 Bacteria 12834
15 Ga0070658_10231385 3300005327 Bacteria 1565
16 Ga0070676_10015554 3300005328 Bacteria 4198
17 Ga0070683_100124568 3300005329 Bacteria 2436
18 Ga0070683_100370263 3300005329 Bacteria 1365
19 Ga0070670_100011203 3300005331 Bacteria 7663
20 Ga0070670_100664942 3300005331 Bacteria 935
21 Ga0070670_101202896 3300005331 Bacteria 692
22 Ga0070677_10001594 3300005333 Bacteria 7175
23 Ga0070666_10813946 3300005335 Bacteria 688
24 Ga0070660_100029116 3300005339 Bacteria 4136
25 Ga0070687_100095480 3300005343 Bacteria 1653
26 Ga0070661_100135907 3300005344 Bacteria 1850
27 Ga0070661_100822683 3300005344 Bacteria 763
28 Ga0070668_100009393 3300005347 Bacteria 7254
29 Ga0070668_100121240 3300005347 Bacteria 2090
30 Ga0070668_100360320 3300005347 Bacteria 1233
31 Ga0070668_100540531 3300005347 Bacteria 1013
32 Ga0070669_100013405 3300005353 Bacteria 5829
33 Ga0070669_100035259 3300005353 Bacteria 3624
34 Ga0070669_101082813 3300005353 Bacteria 690
35 Ga0070675_100005534 3300005354 Bacteria 9669
36 Ga0070671_100006051 3300005355 Bacteria 9642
37 Ga0070671_100033916 3300005355 Bacteria 4224
38 Ga0070671_100182639 3300005355 Bacteria 1776
39 Ga0070674_100029354 3300005356 Bacteria 3621
40 Ga0070674_101795109 3300005356 Unclassified 556
41 Ga0070673_100007906 3300005364 Bacteria 7049
42 Ga0070659_100499524 3300005366 Bacteria 1037
43 Ga0070659_101073899 3300005366 Bacteria 709
44 Ga0070667_100005289 3300005367 Bacteria 10787
45 Ga0070667_100262270 3300005367 Bacteria 1547
46 Ga0070701_10325620 3300005438 Bacteria 952
47 Ga0070694_100715797 3300005444 Bacteria 815
48 Ga0070678_100016584 3300005456 Bacteria 4717
49 Ga0070678_101312280 3300005456 Bacteria 674
50 Ga0070662_100041628 3300005457 Bacteria 3278
51 Ga0068867_100017475 3300005459 Bacteria 5095
52 Ga0068853_100286279 3300005539 Bacteria 1520
53 Ga0068853_101803436 3300005539 Unclassified 593
54 Ga0070672_100010331 3300005543 Bacteria 6472
55 Ga0070672_101024799 3300005543 Bacteria 732
56 Ga0070665_100010026 3300005548 Bacteria 9584
57 Ga0070665_100126587 3300005548 Bacteria 2557
58 Ga0070665_100228408 3300005548 Bacteria 1861
59 Ga0068855_101478235 3300005563 Bacteria 698
60 Ga0070664_100107059 3300005564 Bacteria 2437
61 Ga0068857_100085975 3300005577 Bacteria 2811
62 Ga0068857_100086051 3300005577 Bacteria 2810
63 Ga0068854_100392098 3300005578 Bacteria 1147
64 Ga0068859_100044660 3300005617 Bacteria 4452
65 Ga0068859_100282628 3300005617 Bacteria 1752
66 Ga0068859_100430852 3300005617 Bacteria 1415
67 Ga0068864_100287197 3300005618 Bacteria 1537
68 Ga0068864_100939870 3300005618 Bacteria 855
69 Ga0068866_10329391 3300005718 Bacteria 963
70 Ga0068861_100017138 3300005719 Bacteria 5136
71 Ga0068861_102170032 3300005719 Bacteria 556
72 Ga0068863_100148835 3300005841 Bacteria 2240
73 Ga0068860_100029465 3300005843 Bacteria 5280
74 Ga0068860_100034812 3300005843 Bacteria 4832
75 Ga0068860_100517630 3300005843 Bacteria 1193
76 Ga0068860_100518205 3300005843 Bacteria 1192
77 Ga0068862_100003936 3300005844 Bacteria 12632
78 Ga0068862_100009186 3300005844 Bacteria 8188
79 Ga0068862_100035547 3300005844 Bacteria 4220
80 Ga0068862_101302680 3300005844 Bacteria 728
81 Ga0068871_100502746 3300006358 Bacteria 1093
82 Ga0075431_100708140 3300006847 Bacteria 984
83 Ga0075434_100654036 3300006871 Bacteria 1069
84 Ga0068865_100161866 3300006881 Bacteria 1708
85 Ga0068865_100975125 3300006881 Bacteria 741
86 Ga0097620_100044657 3300006931 Bacteria 4452
87 Ga0097620_100282613 3300006931 Bacteria 1752
88 Ga0097620_100430878 3300006931 Bacteria 1415
89 Ga0079104_1033951 3300006946 Bacteria 1243
90 Ga0105251_10126251 3300009011 Bacteria 1161
91 Ga0105250_10225631 3300009092 Bacteria 795
92 Ga0111539_10142858 3300009094 Bacteria 2802
93 Ga0105247_10228473 3300009101 Bacteria 1263
94 Ga0105243_10062418 3300009148 Bacteria 2983
95 Ga0105241_11496828 3300009174 Bacteria 649
96 Ga0105242_11310808 3300009176 Unclassified 748
97 Ga0105248_10039946 3300009177 Bacteria 5259
98 Ga0105248_10274598 3300009177 Bacteria 1898
99 Ga0105237_12101626 3300009545 Bacteria 574
100 Ga0105249_10000144 3300009553 Bacteria 91994
101 Ga0105249_10009121 3300009553 Bacteria 8676
102 Ga0105249_10052718 3300009553 Bacteria 3716
103 Ga0105249_11025764 3300009553 Bacteria 894
104 Ga0105249_11676531 3300009553 Bacteria 708
105 Ga0157373_10542451 3300013100 Bacteria 843
106 Ga0157371_11067326 3300013102 Bacteria 618
107 Ga0157378_10802013 3300013297 Bacteria 967
108 Ga0163162_10018752 3300013306 Bacteria 6782
109 Ga0163162_11089098 3300013306 Bacteria 905
110 Ga0157372_10241883 3300013307 Bacteria 2094
111 Ga0163163_10118395 3300014325 Bacteria 2681
112 Ga0157380_10014156 3300014326 Bacteria 5832
113 Ga0157377_11267694 3300014745 Unclassified 574
114 Ga0163161_10091502 3300017792 Bacteria 2251
115 Ga0209676_1060276 3300025292 Bacteria 948
116 Ga0209257_1103406 3300025304 Bacteria 691
117 Ga0207697_10005048 3300025315 Bacteria 6185
118 Ga0207697_10216508 3300025315 Bacteria 844
119 Ga0207696_1022215 3300025711 Bacteria 2020
120 Ga0207713_1025681 3300025735 Bacteria 2714
121 Ga0207682_10001996 3300025893 Bacteria 9230
122 Ga0207682_10002227 3300025893 Bacteria 8747
123 Ga0207642_10417833 3300025899 Bacteria 806
124 Ga0207645_10010873 3300025907 Bacteria 6237
125 Ga0207705_10067916 3300025909 Bacteria 2580
126 Ga0207662_10734747 3300025918 Bacteria 693
127 Ga0207657_10001988 3300025919 Bacteria 22083
128 Ga0207681_10000140 3300025923 Bacteria 60064
129 Ga0207681_10064680 3300025923 Bacteria 2526
130 Ga0207681_10127829 3300025923 Bacteria 1874
131 Ga0207650_10049500 3300025925 Bacteria 3103
132 Ga0207650_10359212 3300025925 Bacteria 1200
133 Ga0207659_10001721 3300025926 Bacteria 12974
134 Ga0207659_10011868 3300025926 Bacteria 5519
135 Ga0207644_10003930 3300025931 Bacteria 9643
136 Ga0207644_10012576 3300025931 Bacteria 5626
137 Ga0207644_10320113 3300025931 Bacteria 1254
138 Ga0207644_10525208 3300025931 Bacteria 978
139 Ga0207706_10000187 3300025933 Bacteria 69090
140 Ga0207706_10044534 3300025933 Bacteria 3933
141 Ga0207709_10118959 3300025935 Bacteria 1780
142 Ga0207669_10035657 3300025937 Bacteria 2833
143 Ga0207669_10081268 3300025937 Bacteria 2076
144 Ga0207704_11592284 3300025938 Unclassified 561
145 Ga0207691_10049598 3300025940 Bacteria 3846
146 Ga0207691_10297195 3300025940 Bacteria 1388
147 Ga0207711_10045743 3300025941 Bacteria 3741
148 Ga0207661_10191565 3300025944 Bacteria 1793
149 Ga0207679_10803728 3300025945 Bacteria 857
150 Ga0207651_10072999 3300025960 Bacteria 2438
151 Ga0207712_10000109 3300025961 Bacteria 92018
152 Ga0207712_10029391 3300025961 Bacteria 3686
153 Ga0207712_10051403 3300025961 Bacteria 2882
154 Ga0207668_10011518 3300025972 Bacteria 5377
155 Ga0207668_10041906 3300025972 Bacteria 3097
156 Ga0207668_10046594 3300025972 Bacteria 2963
157 Ga0207668_10077199 3300025972 Bacteria 2400
158 Ga0207668_10528095 3300025972 Bacteria 1019
159 Ga0207658_10006597 3300025986 Bacteria 7911
160 Ga0207658_10031515 3300025986 Bacteria 3766
161 Ga0207677_10205949 3300026023 Bacteria 1567
162 Ga0207639_10091163 3300026041 Bacteria 2440
163 Ga0207639_10486130 3300026041 Bacteria 1126
164 Ga0207678_10078689 3300026067 Bacteria 2823
165 Ga0207708_10543332 3300026075 Bacteria 979
166 Ga0207641_10128636 3300026088 Bacteria 2271
167 Ga0207648_10098447 3300026089 Bacteria 2561
168 Ga0207648_10132087 3300026089 Bacteria 2198
169 Ga0207648_10520800 3300026089 Bacteria 1089
170 Ga0207676_10048610 3300026095 Bacteria 3294
171 Ga0207674_10072353 3300026116 Bacteria 3463
172 Ga0207674_10166861 3300026116 Bacteria 2156
173 Ga0207675_100006920 3300026118 Bacteria 10730
174 Ga0207675_101474659 3300026118 Bacteria 701
175 Ga0207683_10019836 3300026121 Bacteria 5743
176 Ga0209281_1027055 3300027111 Bacteria 1054
177 Ga0209970_1004740 3300027614 Bacteria 2250
178 Ga0210002_1011494 3300027617 Bacteria 1367
179 Ga0209974_10016661 3300027876 Bacteria 2440
180 Ga0207428_10952046 3300027907 Bacteria 605
181 Ga0207428_10967581 3300027907 Bacteria 599
182 Ga0268266_10007807 3300028379 Bacteria 9593
183 Ga0268266_10948813 3300028379 Bacteria 832
184 Ga0268265_10000082 3300028380 Bacteria 120835
185 Ga0268265_10044455 3300028380 Bacteria 3307
186 Ga0268265_10711050 3300028380 Bacteria 971
187 Ga0268264_10002733 3300028381 Bacteria 15396
188 Ga0268264_10025377 3300028381 Bacteria 4843
189 Ga0268264_10653838 3300028381 Bacteria 1040
190 Ga0316177_1128682 3300030731 Bacteria 1392
191 Ga0316176_1173599 3300030732 Bacteria 1042
192 Ga0316179_1087796 3300030734 Bacteria 810
193 Ga0316183_1113572 3300030742 Bacteria 1084
194 Ga0316181_1186795 3300030744 Bacteria 1979
195 Ga0307408_100012053 3300031548 Bacteria 5723
196 Ga0307408_100059500 3300031548 Bacteria 2780
197 Ga0307408_100098060 3300031548 Bacteria 2227
198 Ga0307408_100227101 3300031548 Bacteria 1526
199 Ga0307408_100434778 3300031548 Bacteria 1135
200 Ga0307516_10983102 3300031730 Bacteria 515
201 Ga0307405_10010396 3300031731 Bacteria 4819
202 Ga0307405_10029652 3300031731 Bacteria 3199
203 Ga0307405_10051201 3300031731 Bacteria 2561
204 Ga0307405_10112713 3300031731 Bacteria 1845
205 Ga0307413_10007277 3300031824 Bacteria 5126
206 Ga0307413_10009336 3300031824 Bacteria 4690
207 Ga0307413_10062702 3300031824 Bacteria 2301
208 Ga0307413_10265835 3300031824 Bacteria 1281
209 Ga0307413_10430855 3300031824 Bacteria 1041
210 Ga0307413_10637123 3300031824 Unclassified 877
211 Ga0307410_10006176 3300031852 Bacteria 6434
212 Ga0307410_10029733 3300031852 Bacteria 3483
213 Ga0307410_10047471 3300031852 Bacteria 2870
214 Ga0307410_10364988 3300031852 Bacteria 1157
215 Ga0307410_10552463 3300031852 Bacteria 954
216 Ga0307410_11163370 3300031852 Bacteria 671
217 Ga0307410_11350655 3300031852 Bacteria 624
218 Ga0307410_12037483 3300031852 Bacteria 512
219 Ga0307406_10022270 3300031901 Bacteria 3757
220 Ga0307406_10086653 3300031901 Bacteria 2097
221 Ga0307406_10405842 3300031901 Bacteria 1081
222 Ga0307406_10670932 3300031901 Bacteria 862
223 Ga0307407_10037397 3300031903 Bacteria 2681
224 Ga0307407_10044618 3300031903 Bacteria 2500
225 Ga0307407_10071520 3300031903 Bacteria 2065
226 Ga0307407_10124655 3300031903 Bacteria 1639
227 Ga0307412_10000557 3300031911 Bacteria 22165
228 Ga0307412_10022421 3300031911 Bacteria 3870
229 Ga0307412_10056839 3300031911 Bacteria 2609
230 Ga0307412_10153277 3300031911 Bacteria 1703
231 Ga0307412_10171414 3300031911 Bacteria 1623
232 Ga0307412_10228747 3300031911 Bacteria 1430
233 Ga0307412_12102154 3300031911 Bacteria 524
234 Ga0307409_100005979 3300031995 Bacteria 7092
235 Ga0307409_100388226 3300031995 Bacteria 1329
236 Ga0307409_100632844 3300031995 Bacteria 1061
237 Ga0307409_101132696 3300031995 Bacteria 804
238 Ga0307409_101601739 3300031995 Bacteria 679
239 Ga0307416_100012769 3300032002 Bacteria 5677
240 Ga0307416_100024819 3300032002 Bacteria 4383
241 Ga0307416_100097400 3300032002 Bacteria 2547
242 Ga0307416_100115967 3300032002 Bacteria 2373
243 Ga0307416_100383497 3300032002 Bacteria 1436
244 Ga0307416_100393467 3300032002 Bacteria 1421
245 Ga0307416_100630894 3300032002 Bacteria 1154
246 Ga0307416_101365292 3300032002 Bacteria 814
247 Ga0307414_10000288 3300032004 Bacteria 29634
248 Ga0307414_10044513 3300032004 Bacteria 3032
249 Ga0307414_10071272 3300032004 Bacteria 2506
250 Ga0307414_10082737 3300032004 Bacteria 2355
251 Ga0307414_10203166 3300032004 Bacteria 1613
252 Ga0307414_10237672 3300032004 Bacteria 1506
253 Ga0307414_10362827 3300032004 Bacteria 1247
254 Ga0307414_10931396 3300032004 Bacteria 798
255 Ga0307414_11232402 3300032004 Bacteria 693
256 Ga0307414_12103210 3300032004 Bacteria 527
257 Ga0307411_10015969 3300032005 Bacteria 4237
258 Ga0307411_10020705 3300032005 Bacteria 3833
259 Ga0307411_10044181 3300032005 Bacteria 2856
260 Ga0307411_10165547 3300032005 Bacteria 1661
261 Ga0307411_10205393 3300032005 Bacteria 1516
262 Ga0307411_10423349 3300032005 Bacteria 1107
263 Ga0307411_10685424 3300032005 Bacteria 891
264 Ga0307411_11253979 3300032005 Bacteria 674
265 Ga0307411_11595470 3300032005 Bacteria 602
266 Ga0307411_11843299 3300032005 Bacteria 562
267 Ga0307411_11970599 3300032005 Bacteria 545
268 Ga0307415_100014076 3300032126 Bacteria 4690
269 Ga0307415_100060455 3300032126 Bacteria 2618
270 Ga0307415_100205486 3300032126 Bacteria 1566
271 Ga0307415_100922389 3300032126 Bacteria 806
272 Ga0307415_101382056 3300032126 Bacteria 670
273 Ga0307415_101964096 3300032126 Bacteria 569
274 Ga0395899_0000261 3300037312 Bacteria 69173
275 Ga0395900_0000036 3300037418 Bacteria 250619
276 Ga0395900_0027017 3300037418 Bacteria 5876
277 Ga0395900_0129615 3300037418 Bacteria 2586
278 Ga0395898_0157111 3300037466 Bacteria 2175
279 Ga0395905_0097610 3300037471 Bacteria 2759
280 Ga0395905_0150010 3300037471 Bacteria 2193
281 Ga0395905_0289423 3300037471 Bacteria 1525
282 Ga0395901_0000036 3300038443 Bacteria 214274
283 Ga0395901_0331132 3300038443 Bacteria 1574
284 Ga0436365_0849823 3300039437 Bacteria 545
285 Ga0451793_1754654 3300041452 Bacteria 919
286 Ga0451837_0711028 3300041494 Bacteria 591
287 Ga0451841_0079321 3300041498 Bacteria 1083
288 Ga0451853_0561203 3300041512 Bacteria 2017
289 Ga0451853_4017816 3300041512 Bacteria 968
290 Ga0439432_100051 3300042006 Bacteria 868
291 Ga0450915_015155 3300042119 Bacteria 578
292 Ga0439464_0028118 3300042439 Bacteria 1566
293 Ga0495663_0239566 3300046525 Unclassified 641
294 Ga0495642_0220759 3300046528 Bacteria 827
295 Ga0495654_0116128 3300046530 Bacteria 1216
296 Ga0495598_0018755 3300046537 Bacteria 1803
297 Ga0495621_0001333 3300046539 Bacteria 6383
298 Ga0495621_0004362 3300046539 Bacteria 3973
299 Ga0495597_0074381 3300046542 Bacteria 1459
300 Ga0495622_0001538 3300046557 Bacteria 11470
301 Ga0495633_0040095 3300046558 Bacteria 2233
302 Ga0495633_0107866 3300046558 Bacteria 1291
303 Ga0495659_0009203 3300046664 Bacteria 3150
304 Ga0495659_0055712 3300046664 Bacteria 1450
305 Ga0495659_0073309 3300046664 Bacteria 1287
306 Ga0495669_0016445 3300046684 Bacteria 3168
307 Ga0495669_0475337 3300046684 Bacteria 607
308 Ga0495669_0489360 3300046684 Bacteria 598
309 Ga0495670_0014290 3300046691 Bacteria 3905
310 Ga0495670_0133102 3300046691 Bacteria 1297
311 Ga0495670_0182989 3300046691 Bacteria 1107
312 Ga0495670_0298088 3300046691 Bacteria 864
313 Ga0495671_0007648 3300046692 Bacteria 6138
314 Ga0495649_0068220 3300046694 Bacteria 1908
315 Ga0495677_0016039 3300047445 Bacteria 2720
316 Ga0495677_0214021 3300047445 Unclassified 750
317 Ga0495686_0033550 3300047472 Bacteria 3313
318 Ga0496100_0009590 3300048903 Bacteria 5440
319 Ga0496101_0030765 3300048904 Bacteria 3767
320 Ga0496102_0000267 3300048905 Bacteria 66761
321 Ga0496103_0000585 3300048906 Bacteria 28793
322 Ga0496104_0000128 3300048907 Bacteria 70094
323 Ga0496105_0000064 3300048908 Bacteria 83935
324 Ga0496112_0015089 3300048915 Bacteria 7195
325 Ga0496113_0000417 3300048916 Bacteria 20659
326 Ga0496113_0697705 3300048916 Bacteria 810
327 Ga0496116_0120517 3300048919 Bacteria 1519
328 Ga0496116_0501225 3300048919 Bacteria 504
329 Ga0496117_0017621 3300048920 Bacteria 5958
330 Ga0496118_0014865 3300048921 Bacteria 7250
331 Ga0496119_0000077 3300048922 Bacteria 143108
332 Ga0496120_0001734 3300048923 Bacteria 24816
333 Ga0496120_0267765 3300048923 Bacteria 795
334 Ga0496121_0000031 3300048924 Bacteria 384119
335 Ga0496121_0016955 3300048924 Bacteria 7481
336 Ga0496122_0003369 3300048925 Bacteria 21037
337 Ga0496123_0003247 3300048926 Bacteria 18471
338 Ga0496124_0004900 3300048927 Bacteria 15386
339 Ga0496125_0003202 3300048928 Bacteria 20208
340 Ga0496126_0000619 3300048929 Bacteria 66827
341 Ga0496126_0106118 3300048929 Bacteria 2452
342 Ga0495682_0051892 3300049460 Bacteria 1491
343 Ga0501290_000235 3300049513 Bacteria 9179
344 Ga0501320_068342 3300049536 Bacteria 510
345 Ga0501336_014309 3300049552 Bacteria 670
346 Ga0501047_0167377 3300049581 Bacteria 2068
347 Ga0501198_042632 3300049649 Bacteria 790
348 Ga0501206_015373 3300049653 Bacteria 1059
349 Ga0501207_017717 3300049654 Bacteria 1114
350 Ga0501249_007508 3300049679 Bacteria 2254
351 Ga0501221_018467 3300049704 Bacteria 1344
352 Ga0501225_0023288 3300049705 Bacteria 1707
353 Ga0501225_0094708 3300049705 Bacteria 867
354 Ga0501272_020498 3300049769 Bacteria 792
355 Ga0501273_013199 3300049770 Bacteria 1050
356 Ga0501035_1170614 3300049822 Bacteria 598
357 Ga0501044_1599818 3300049823 Bacteria 516
358 Ga0501212_044321 3300049851 Bacteria 742
359 nmdc:mga08y16_233218_c1 3300050511 Bacteria 1903
360 nmdc:mga0n895_701010_c1 3300050512 Bacteria 1008
361 nmdc:mga0a205_913233_c1 3300050515 Bacteria 725
362 Ga0500643_000115 3300053087 Bacteria 84126
363 Ga0500641_0073061 3300053096 Bacteria 1447
364 Ga0500592_000376 3300053116 Bacteria 7493
365 Ga0500594_0099681 3300053118 Bacteria 892
366 Ga0500595_011591 3300053119 Bacteria 3442
367 Ga0500618_003516 3300053125 Bacteria 5339
368 Ga0500618_091157 3300053125 Unclassified 685
369 Ga0500658_0187827 3300053134 Bacteria 942
370 Ga0500559_0163923 3300053136 Bacteria 1045
371 Ga0500573_0344161 3300053140 Bacteria 727
372 Ga0500604_0054094 3300053151 Bacteria 1246
373 Ga0500624_000001 3300053157 Bacteria 284974
374 Ga0500627_0000390 3300053158 Bacteria 11811
375 Ga0500627_0016393 3300053158 Bacteria 2889
376 Ga0500627_0231192 3300053158 Bacteria 823
377 Ga0500627_0417234 3300053158 Bacteria 569
378 Ga0500637_0000156 3300053178 Bacteria 24981
379 Ga0500645_001470 3300053730 Bacteria 11841
380 2738709800 2738541275 Bacteria 4830863
381 2738848225 2738541301 Bacteria 4834102
382 2738863954 2738541304 Bacteria 4833665
383 2739296472 2738543022 Bacteria 4835059
384 2739358150 2738543033 Bacteria 4833336
385 2896430409 2896429255 Bacteria 2557483
386 2919139699 2919138771 Bacteria 5281312
387 2928101357 2928100450 Bacteria 4837635
388 2928960232 2928959182 Bacteria 4725774
389 Ga0500597_054077
390 SwRhRL2b_contig_3081814
391 MBSR1b_contig_1719237
392 JGI24750J21931_1040649
393 JGI24748J21848_1018038
394 JGI24749J21850_1022190
395 JGI24033J26618_1029836
396 JGI24742J22300_10086218
397 JGI24751J29686_10054889
398 Ga0065714_10238809
399 Ga0065704_10000727
400 Ga0065715_10092118
401 Ga0065715_10123164
402 Ga0070658_10003530
403 Ga0070658_10231385
404 Ga0070676_10015554
405 Ga0070683_100124568
406 Ga0070683_100370263
407 Ga0070670_100011203
408 Ga0070670_100664942
409 Ga0070670_101202896
410 Ga0070677_10001594
411 Ga0070666_10813946
412 Ga0070660_100029116
413 Ga0070687_100095480
414 Ga0070661_100135907
415 Ga0070661_100822683
416 Ga0070668_100009393
417 Ga0070668_100121240
418 Ga0070668_100360320
419 Ga0070668_100540531
420 Ga0070669_100013405
421 Ga0070669_100035259
422 Ga0070669_101082813
423 Ga0070675_100005534
424 Ga0070671_100006051
425 Ga0070671_100033916
426 Ga0070671_100182639
427 Ga0070674_100029354
428 Ga0070674_101795109
429 Ga0070673_100007906
430 Ga0070659_100499524
431 Ga0070659_101073899
432 Ga0070667_100005289
433 Ga0070667_100262270
434 Ga0070701_10325620
435 Ga0070694_100715797
436 Ga0070678_100016584
437 Ga0070678_101312280
438 Ga0070662_100041628
439 Ga0068867_100017475
440 Ga0068853_100286279
441 Ga0068853_101803436
442 Ga0070672_100010331
443 Ga0070672_101024799
444 Ga0070665_100010026
445 Ga0070665_100126587
446 Ga0070665_100228408
447 Ga0068855_101478235
448 Ga0070664_100107059
449 Ga0068857_100085975
450 Ga0068857_100086051
451 Ga0068854_100392098
452 Ga0068859_100044660
453 Ga0068859_100282628
454 Ga0068859_100430852
455 Ga0068864_100287197
456 Ga0068864_100939870
457 Ga0068866_10329391
458 Ga0068861_100017138
459 Ga0068861_102170032
460 Ga0068863_100148835
461 Ga0068860_100029465
462 Ga0068860_100034812
463 Ga0068860_100517630
464 Ga0068860_100518205
465 Ga0068862_100003936
466 Ga0068862_100009186
467 Ga0068862_100035547
468 Ga0068862_101302680
469 Ga0068871_100502746
470 Ga0075431_100708140
471 Ga0075434_100654036
472 Ga0068865_100161866
473 Ga0068865_100975125
474 Ga0097620_100044657
475 Ga0097620_100282613
476 Ga0097620_100430878
477 Ga0079104_1033951
478 Ga0105251_10126251
479 Ga0105250_10225631
480 Ga0111539_10142858
481 Ga0105247_10228473
482 Ga0105243_10062418
483 Ga0105241_11496828
484 Ga0105242_11310808
485 Ga0105248_10039946
486 Ga0105248_10274598
487 Ga0105237_12101626
488 Ga0105249_10000144
489 Ga0105249_10009121
490 Ga0105249_10052718
491 Ga0105249_11025764
492 Ga0105249_11676531
493 Ga0157373_10542451
494 Ga0157371_11067326
495 Ga0157378_10802013
496 Ga0163162_10018752
497 Ga0163162_11089098
498 Ga0157372_10241883
499 Ga0163163_10118395
500 Ga0157380_10014156
501 Ga0157377_11267694
502 Ga0163161_10091502
503 Ga0209676_1060276
504 Ga0209257_1103406
505 Ga0207697_10005048
506 Ga0207697_10216508
507 Ga0207696_1022215
508 Ga0207713_1025681
509 Ga0207682_10001996
510 Ga0207682_10002227
511 Ga0207642_10417833
512 Ga0207645_10010873
513 Ga0207705_10067916
514 Ga0207662_10734747
515 Ga0207657_10001988
516 Ga0207681_10000140
517 Ga0207681_10064680
518 Ga0207681_10127829
519 Ga0207650_10049500
520 Ga0207650_10359212
521 Ga0207659_10001721
522 Ga0207659_10011868
523 Ga0207644_10003930
524 Ga0207644_10012576
525 Ga0207644_10320113
526 Ga0207644_10525208
527 Ga0207706_10000187
528 Ga0207706_10044534
529 Ga0207709_10118959
530 Ga0207669_10035657
531 Ga0207669_10081268
532 Ga0207704_11592284
533 Ga0207691_10049598
534 Ga0207691_10297195
535 Ga0207711_10045743
536 Ga0207661_10191565
537 Ga0207679_10803728
538 Ga0207651_10072999
539 Ga0207712_10000109
540 Ga0207712_10029391
541 Ga0207712_10051403
542 Ga0207668_10011518
543 Ga0207668_10041906
544 Ga0207668_10046594
545 Ga0207668_10077199
546 Ga0207668_10528095
547 Ga0207658_10006597
548 Ga0207658_10031515
549 Ga0207677_10205949
550 Ga0207639_10091163
551 Ga0207639_10486130
552 Ga0207678_10078689
553 Ga0207708_10543332
554 Ga0207641_10128636
555 Ga0207648_10098447
556 Ga0207648_10132087
557 Ga0207648_10520800
558 Ga0207676_10048610
559 Ga0207674_10072353
560 Ga0207674_10166861
561 Ga0207675_100006920
562 Ga0207675_101474659
563 Ga0207683_10019836
564 Ga0209281_1027055
565 Ga0209970_1004740
566 Ga0210002_1011494
567 Ga0209974_10016661
568 Ga0207428_10952046
569 Ga0207428_10967581
570 Ga0268266_10007807
571 Ga0268266_10948813
572 Ga0268265_10000082
573 Ga0268265_10044455
574 Ga0268265_10711050
575 Ga0268264_10002733
576 Ga0268264_10025377
577 Ga0268264_10653838
578 Ga0316177_1128682
579 Ga0316176_1173599
580 Ga0316179_1087796
581 Ga0316183_1113572
582 Ga0316181_1186795
583 Ga0307408_100012053
584 Ga0307408_100059500
585 Ga0307408_100098060
586 Ga0307408_100227101
587 Ga0307408_100434778
588 Ga0307516_10983102
589 Ga0307405_10010396
590 Ga0307405_10029652
591 Ga0307405_10051201
592 Ga0307405_10112713
593 Ga0307413_10007277
594 Ga0307413_10009336
595 Ga0307413_10062702
596 Ga0307413_10265835
597 Ga0307413_10430855
598 Ga0307413_10637123
599 Ga0307410_10006176
600 Ga0307410_10029733
601 Ga0307410_10047471
602 Ga0307410_10364988
603 Ga0307410_10552463
604 Ga0307410_11163370
605 Ga0307410_11350655
606 Ga0307410_12037483
607 Ga0307406_10022270
608 Ga0307406_10086653
609 Ga0307406_10405842
610 Ga0307406_10670932
611 Ga0307407_10037397
612 Ga0307407_10044618
613 Ga0307407_10071520
614 Ga0307407_10124655
615 Ga0307412_10000557
616 Ga0307412_10022421
617 Ga0307412_10056839
618 Ga0307412_10153277
619 Ga0307412_10171414
620 Ga0307412_10228747
621 Ga0307412_12102154
622 Ga0307409_100005979
623 Ga0307409_100388226
624 Ga0307409_100632844
625 Ga0307409_101132696
626 Ga0307409_101601739
627 Ga0307416_100012769
628 Ga0307416_100024819
629 Ga0307416_100097400
630 Ga0307416_100115967
631 Ga0307416_100383497
632 Ga0307416_100393467
633 Ga0307416_100630894
634 Ga0307416_101365292
635 Ga0307414_10000288
636 Ga0307414_10044513
637 Ga0307414_10071272
638 Ga0307414_10082737
639 Ga0307414_10203166
640 Ga0307414_10237672
641 Ga0307414_10362827
642 Ga0307414_10931396
643 Ga0307414_11232402
644 Ga0307414_12103210
645 Ga0307411_10015969
646 Ga0307411_10020705
647 Ga0307411_10044181
648 Ga0307411_10165547
649 Ga0307411_10205393
650 Ga0307411_10423349
651 Ga0307411_10685424
652 Ga0307411_11253979
653 Ga0307411_11595470
654 Ga0307411_11843299
655 Ga0307411_11970599
656 Ga0307415_100014076
657 Ga0307415_100060455
658 Ga0307415_100205486
659 Ga0307415_100922389
660 Ga0307415_101382056
661 Ga0307415_101964096
662 Ga0395899_0000261
663 Ga0395900_0000036
664 Ga0395900_0027017
665 Ga0395900_0129615
666 Ga0395898_0157111
667 Ga0395905_0097610
668 Ga0395905_0150010
669 Ga0395905_0289423
670 Ga0395901_0000036
671 Ga0395901_0331132
672 Ga0436365_0849823
673 Ga0451793_1754654
674 Ga0451837_0711028
675 Ga0451841_0079321
676 Ga0451853_0561203
677 Ga0451853_4017816
678 Ga0439432_100051
679 Ga0450915_015155
680 Ga0439464_0028118
681 Ga0495663_0239566
682 Ga0495642_0220759
683 Ga0495654_0116128
684 Ga0495598_0018755
685 Ga0495621_0001333
686 Ga0495621_0004362
687 Ga0495597_0074381
688 Ga0495622_0001538
689 Ga0495633_0040095
690 Ga0495633_0107866
691 Ga0495659_0009203
692 Ga0495659_0055712
693 Ga0495659_0073309
694 Ga0495669_0016445
695 Ga0495669_0475337
696 Ga0495669_0489360
697 Ga0495670_0014290
698 Ga0495670_0133102
699 Ga0495670_0182989
700 Ga0495670_0298088
701 Ga0495671_0007648
702 Ga0495649_0068220
703 Ga0495677_0016039
704 Ga0495677_0214021
705 Ga0495686_0033550
706 Ga0496100_0009590
707 Ga0496101_0030765
708 Ga0496102_0000267
709 Ga0496103_0000585
710 Ga0496104_0000128
711 Ga0496105_0000064
712 Ga0496112_0015089
713 Ga0496113_0000417
714 Ga0496113_0697705
715 Ga0496116_0120517
716 Ga0496116_0501225
717 Ga0496117_0017621
718 Ga0496118_0014865
719 Ga0496119_0000077
720 Ga0496120_0001734
721 Ga0496120_0267765
722 Ga0496121_0000031
723 Ga0496121_0016955
724 Ga0496122_0003369
725 Ga0496123_0003247
726 Ga0496124_0004900
727 Ga0496125_0003202
728 Ga0496126_0000619
729 Ga0496126_0106118
730 Ga0495682_0051892
731 Ga0501290_000235
732 Ga0501320_068342
733 Ga0501336_014309
734 Ga0501047_0167377
735 Ga0501198_042632
736 Ga0501206_015373
737 Ga0501207_017717
738 Ga0501249_007508
739 Ga0501221_018467
740 Ga0501225_0023288
741 Ga0501225_0094708
742 Ga0501272_020498
743 Ga0501273_013199
744 Ga0501035_1170614
745 Ga0501044_1599818
746 Ga0501212_044321
747 nmdc:mga08y16_233218_c1
748 nmdc:mga0n895_701010_c1
749 nmdc:mga0a205_913233_c1
750 Ga0500643_000115
751 Ga0500641_0073061
752 Ga0500592_000376
753 Ga0500594_0099681
754 Ga0500595_011591
755 Ga0500618_003516
756 Ga0500618_091157
757 Ga0500658_0187827
758 Ga0500559_0163923
759 Ga0500573_0344161
760 Ga0500604_0054094
761 Ga0500624_000001
762 Ga0500627_0000390
763 Ga0500627_0016393
764 Ga0500627_0231192
765 Ga0500627_0417234
766 Ga0500637_0000156
767 Ga0500645_001470
768 2738709800
769 2738848225
770 2738863954
771 2739296472
772 2739358150
773 2896430409
774 2919139699
775 2928101357
776 2928960232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04024

PspC

PspC domain

21

80

0.85

Map