F431234

General Info

Members Datasets Scaffolds Average Seq Length
388 219 776 264

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0067903|Ga0496112_0067903_286_1206
Length 306
Sequence MSIEPPSERSGPPPGRGPSVDLDPTGIVTGKSPDRQRRQFLNYAFYRLDPVFRRLPADEQQTAVRGFINLVKKWESLDEVILRTYSLVGLRADVDFLLWRIAFDPLCFQSMEAAIRRSRLGAYLSPIYSFLSMQRRSEYVNKTKGAGEGVELLAGQGKFLFVYPFVKTRQWYLLSPHARQGLMDEHIAASAPFKGVHLNTSYSFGIDDQDFVVAFDSDYPQEFVDLGRAAPILGSEPVHAARYADVHVREGADRRDPGATGGRGLTRWARTEGLKTTWERPAAVRRLHGRGPGCRVGSPAMEWALS

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
146 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
147 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
148 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
212 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.7
Nodule 0
Rhizoplane 3.35
Rhizosphere 89.95
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0067903 3300048915 Bacteria 3520
2 JGI25406J46586_10002715 3300003203 Bacteria 8344
3 Ga0065704_10071574 3300005289 Bacteria 10639
4 Ga0065704_10073597 3300005289 Bacteria 6976
5 Ga0065712_10025285 3300005290 Bacteria 1590
6 Ga0065712_10178537 3300005290 Bacteria 1205
7 Ga0065707_10158476 3300005295 Bacteria 1586
8 Ga0065707_10172459 3300005295 Bacteria 1474
9 Ga0070676_10002802 3300005328 Bacteria 9009
10 Ga0070683_100111822 3300005329 Bacteria 2577
11 Ga0070690_100117821 3300005330 Bacteria 1779
12 Ga0070670_100022893 3300005331 Bacteria 5376
13 Ga0070670_100074600 3300005331 Bacteria 2914
14 Ga0070670_100189389 3300005331 Bacteria 1787
15 Ga0070670_100213623 3300005331 Bacteria 1677
16 Ga0070677_10001401 3300005333 Bacteria 7688
17 Ga0068869_100011805 3300005334 Bacteria 5746
18 Ga0068869_100067923 3300005334 Bacteria 2631
19 Ga0068869_100090081 3300005334 Bacteria 2304
20 Ga0070666_10035980 3300005335 Bacteria 3284
21 Ga0070666_10104820 3300005335 Bacteria 1952
22 Ga0070680_100093905 3300005336 Bacteria 2486
23 Ga0070680_100574650 3300005336 Bacteria 967
24 Ga0070682_100242654 3300005337 Bacteria 1294
25 Ga0068868_100035804 3300005338 Bacteria 3839
26 Ga0068868_100214675 3300005338 Bacteria 1609
27 Ga0070689_100002830 3300005340 Bacteria 11412
28 Ga0070691_10121491 3300005341 Bacteria 1316
29 Ga0070687_100075847 3300005343 Bacteria 1819
30 Ga0070687_100116171 3300005343 Bacteria 1523
31 Ga0070661_100271894 3300005344 Bacteria 1312
32 Ga0070692_10075182 3300005345 Bacteria 1809
33 Ga0070668_100250155 3300005347 Bacteria 1471
34 Ga0070669_100063955 3300005353 Bacteria 2709
35 Ga0070675_100240115 3300005354 Bacteria 1583
36 Ga0070675_100363533 3300005354 Bacteria 1285
37 Ga0070675_100421278 3300005354 Bacteria 1194
38 Ga0070671_100051438 3300005355 Bacteria 3426
39 Ga0070671_100517680 3300005355 Bacteria 1027
40 Ga0070673_100001253 3300005364 Bacteria 14749
41 Ga0070673_100033236 3300005364 Bacteria 3892
42 Ga0070673_100128395 3300005364 Bacteria 2124
43 Ga0070673_100167381 3300005364 Bacteria 1874
44 Ga0070688_100000591 3300005365 Bacteria 18259
45 Ga0070659_100725408 3300005366 Bacteria 861
46 Ga0070667_100244073 3300005367 Bacteria 1604
47 Ga0070703_10040083 3300005406 Bacteria 1455
48 Ga0070701_10037651 3300005438 Bacteria 2443
49 Ga0070705_100002989 3300005440 Bacteria 8359
50 Ga0070705_100121601 3300005440 Bacteria 1687
51 Ga0070705_100202313 3300005440 Bacteria 1362
52 Ga0070700_100129530 3300005441 Bacteria 1701
53 Ga0070694_100001096 3300005444 Bacteria 15510
54 Ga0070694_100002116 3300005444 Bacteria 11764
55 Ga0070694_100243401 3300005444 Bacteria 1357
56 Ga0070708_100190750 3300005445 Bacteria 1917
57 Ga0070663_100046709 3300005455 Bacteria 3065
58 Ga0070663_100086277 3300005455 Bacteria 2318
59 Ga0070678_100175875 3300005456 Bacteria 1748
60 Ga0070662_100008143 3300005457 Bacteria 6829
61 Ga0068867_100012488 3300005459 Bacteria 6011
62 Ga0068867_100125011 3300005459 Bacteria 1992
63 Ga0070706_100483778 3300005467 Bacteria 1152
64 Ga0070707_100447399 3300005468 Bacteria 1252
65 Ga0070698_100091928 3300005471 Bacteria 3016
66 Ga0070699_100011700 3300005518 Bacteria 7577
67 Ga0070672_100000166 3300005543 Bacteria 36328
68 Ga0070672_100150094 3300005543 Bacteria 1927
69 Ga0070686_100017914 3300005544 Bacteria 4147
70 Ga0070686_100029433 3300005544 Bacteria 3342
71 Ga0070686_100208002 3300005544 Bacteria 1407
72 Ga0070695_100000064 3300005545 Bacteria 42035
73 Ga0070695_100086026 3300005545 Bacteria 2088
74 Ga0070696_100004945 3300005546 Bacteria 8898
75 Ga0070696_100096158 3300005546 Bacteria 2116
76 Ga0070693_100009801 3300005547 Bacteria 4777
77 Ga0070704_100064126 3300005549 Bacteria 2639
78 Ga0070704_100088454 3300005549 Bacteria 2301
79 Ga0070704_100137820 3300005549 Bacteria 1901
80 Ga0070704_100160917 3300005549 Bacteria 1775
81 Ga0068855_100511940 3300005563 Bacteria 1303
82 Ga0070664_100058340 3300005564 Bacteria 3283
83 Ga0070664_100069017 3300005564 Bacteria 3023
84 Ga0070664_100168128 3300005564 Bacteria 1944
85 Ga0068854_100024650 3300005578 Bacteria 4121
86 Ga0068856_100254718 3300005614 Bacteria 1770
87 Ga0070702_100228047 3300005615 Bacteria 1250
88 Ga0068859_100007844 3300005617 Bacteria 10834
89 Ga0068864_100058016 3300005618 Bacteria 3344
90 Ga0068864_100476977 3300005618 Bacteria 1197
91 Ga0068864_100515637 3300005618 Bacteria 1152
92 Ga0068866_10094928 3300005718 Bacteria 1633
93 Ga0068851_10078807 3300005834 Bacteria 1717
94 Ga0068863_100150991 3300005841 Bacteria 2223
95 Ga0068863_100351914 3300005841 Bacteria 1435
96 Ga0068858_100016453 3300005842 Bacteria 6944
97 Ga0068858_100021713 3300005842 Bacteria 5998
98 Ga0068858_100489775 3300005842 Bacteria 1187
99 Ga0068860_100207503 3300005843 Bacteria 1900
100 Ga0068862_100161577 3300005844 Bacteria 2000
101 Ga0068862_100210909 3300005844 Bacteria 1755
102 Ga0081539_10000122 3300005985 Bacteria 183393
103 Ga0075365_10073067 3300006038 Bacteria 2311
104 Ga0075364_10014698 3300006051 Bacteria 4841
105 Ga0075364_10032267 3300006051 Bacteria 3366
106 Ga0075364_10143210 3300006051 Bacteria 1609
107 Ga0075364_10211479 3300006051 Bacteria 1315
108 Ga0075367_10017790 3300006178 Bacteria 3908
109 Ga0075367_10020717 3300006178 Bacteria 3666
110 Ga0075367_10230531 3300006178 Bacteria 1160
111 Ga0075427_10006205 3300006194 Bacteria 1725
112 Ga0068871_100103378 3300006358 Bacteria 2388
113 Ga0075428_100005221 3300006844 Bacteria 14441
114 Ga0075428_100024759 3300006844 Bacteria 6640
115 Ga0075428_100143633 3300006844 Bacteria 2594
116 Ga0075428_100220986 3300006844 Bacteria 2045
117 Ga0075428_100294219 3300006844 Bacteria 1746
118 Ga0075428_100443399 3300006844 Bacteria 1391
119 Ga0075430_100005040 3300006846 Bacteria 11122
120 Ga0075431_100032389 3300006847 Bacteria 5386
121 Ga0075431_100062799 3300006847 Bacteria 3833
122 Ga0075431_100309529 3300006847 Bacteria 1595
123 Ga0075433_10000236 3300006852 Bacteria 31700
124 Ga0075433_10009913 3300006852 Bacteria 7637
125 Ga0075433_10037109 3300006852 Bacteria 4202
126 Ga0075433_10141273 3300006852 Bacteria 2140
127 Ga0075433_10183412 3300006852 Bacteria 1862
128 Ga0075434_100005302 3300006871 Bacteria 11729
129 Ga0075434_100007557 3300006871 Bacteria 10068
130 Ga0075434_100154464 3300006871 Bacteria 2314
131 Ga0075434_100167321 3300006871 Bacteria 2218
132 Ga0068865_100298245 3300006881 Bacteria 1289
133 Ga0097620_100007844 3300006931 Bacteria 10834
134 Ga0075435_100001882 3300007076 Bacteria 13650
135 Ga0075435_100010692 3300007076 Bacteria 6718
136 Ga0075435_100087521 3300007076 Bacteria 2567
137 Ga0075435_100124299 3300007076 Bacteria 2155
138 Ga0111539_10002317 3300009094 Bacteria 25338
139 Ga0111539_10011387 3300009094 Bacteria 11166
140 Ga0111539_10023771 3300009094 Bacteria 7530
141 Ga0111539_10209368 3300009094 Bacteria 2272
142 Ga0105245_10219880 3300009098 Bacteria 1832
143 Ga0114129_10047442 3300009147 Bacteria 6035
144 Ga0114129_10061327 3300009147 Bacteria 5255
145 Ga0114129_10123003 3300009147 Bacteria 3570
146 Ga0114129_10171104 3300009147 Bacteria 2961
147 Ga0114129_10469104 3300009147 Bacteria 1649
148 Ga0114129_10477989 3300009147 Bacteria 1631
149 Ga0105241_10015918 3300009174 Bacteria 5510
150 Ga0105242_10032153 3300009176 Bacteria 4194
151 Ga0105242_10042901 3300009176 Bacteria 3656
152 Ga0105248_10171732 3300009177 Bacteria 2443
153 Ga0105248_10830126 3300009177 Bacteria 1043
154 Ga0105248_11139377 3300009177 Bacteria 882
155 Ga0105249_10003004 3300009553 Bacteria 14549
156 Ga0105239_10177094 3300010375 Bacteria 2385
157 Ga0163162_10004052 3300013306 Bacteria 14058
158 Ga0163162_10102047 3300013306 Bacteria 2962
159 Ga0157375_10005816 3300013308 Bacteria 10732
160 Ga0163163_10154039 3300014325 Bacteria 2342
161 Ga0163163_10612937 3300014325 Bacteria 1152
162 Ga0157377_10009324 3300014745 Bacteria 4808
163 Ga0157377_10081343 3300014745 Bacteria 1894
164 Ga0157379_10292551 3300014968 Bacteria 1483
165 Ga0157376_10776836 3300014969 Bacteria 969
166 Ga0207697_10002245 3300025315 Bacteria 10092
167 Ga0207682_10015855 3300025893 Bacteria 2937
168 Ga0207682_10019563 3300025893 Bacteria 2651
169 Ga0207682_10021410 3300025893 Bacteria 2543
170 Ga0207642_10170830 3300025899 Bacteria 1176
171 Ga0207688_10111103 3300025901 Bacteria 1591
172 Ga0207688_10315715 3300025901 Bacteria 958
173 Ga0207680_10052372 3300025903 Bacteria 2446
174 Ga0207645_10004547 3300025907 Bacteria 10248
175 Ga0207645_10010688 3300025907 Bacteria 6296
176 Ga0207645_10238207 3300025907 Bacteria 1202
177 Ga0207684_10156034 3300025910 Bacteria 1964
178 Ga0207684_10492088 3300025910 Bacteria 1051
179 Ga0207707_10325291 3300025912 Bacteria 1327
180 Ga0207660_10300144 3300025917 Bacteria 1279
181 Ga0207662_10016123 3300025918 Bacteria 4212
182 Ga0207662_10048458 3300025918 Bacteria 2517
183 Ga0207649_10213750 3300025920 Bacteria 1369
184 Ga0207681_10031595 3300025923 Bacteria 3459
185 Ga0207650_10050404 3300025925 Bacteria 3078
186 Ga0207650_10064687 3300025925 Bacteria 2738
187 Ga0207650_10086941 3300025925 Bacteria 2381
188 Ga0207650_10112609 3300025925 Bacteria 2109
189 Ga0207659_10000585 3300025926 Bacteria 21814
190 Ga0207659_10177691 3300025926 Bacteria 1684
191 Ga0207687_10106632 3300025927 Bacteria 2072
192 Ga0207690_10362294 3300025932 Bacteria 1149
193 Ga0207706_10010833 3300025933 Bacteria 8318
194 Ga0207706_10043605 3300025933 Bacteria 3975
195 Ga0207686_10290059 3300025934 Bacteria 1211
196 Ga0207669_10064610 3300025937 Bacteria 2266
197 Ga0207669_10408516 3300025937 Bacteria 1065
198 Ga0207704_10119607 3300025938 Bacteria 1799
199 Ga0207704_10301810 3300025938 Bacteria 1227
200 Ga0207691_10000888 3300025940 Bacteria 29662
201 Ga0207689_10002833 3300025942 Bacteria 16002
202 Ga0207689_10014972 3300025942 Bacteria 6580
203 Ga0207689_10032020 3300025942 Bacteria 4374
204 Ga0207661_10043459 3300025944 Bacteria 3546
205 Ga0207679_10017709 3300025945 Bacteria 4758
206 Ga0207679_10137867 3300025945 Bacteria 1967
207 Ga0207679_10252413 3300025945 Bacteria 1500
208 Ga0207651_10018713 3300025960 Bacteria 4131
209 Ga0207651_10094130 3300025960 Bacteria 2202
210 Ga0207712_10397819 3300025961 Bacteria 1157
211 Ga0207668_10483838 3300025972 Bacteria 1062
212 Ga0207658_10076298 3300025986 Bacteria 2553
213 Ga0207677_10077719 3300026023 Bacteria 2368
214 Ga0207703_10015655 3300026035 Bacteria 5914
215 Ga0207703_10560693 3300026035 Bacteria 1078
216 Ga0207678_10017173 3300026067 Bacteria 6353
217 Ga0207678_10039388 3300026067 Bacteria 4102
218 Ga0207678_10051485 3300026067 Bacteria 3555
219 Ga0207708_10007445 3300026075 Bacteria 8092
220 Ga0207708_10074859 3300026075 Bacteria 2595
221 Ga0207702_10206561 3300026078 Bacteria 1824
222 Ga0207641_10269636 3300026088 Bacteria 1597
223 Ga0207641_10283632 3300026088 Bacteria 1559
224 Ga0207648_10008266 3300026089 Bacteria 10104
225 Ga0207648_10174157 3300026089 Bacteria 1902
226 Ga0207676_10168258 3300026095 Bacteria 1907
227 Ga0207676_10723709 3300026095 Bacteria 966
228 Ga0207675_100042496 3300026118 Bacteria 4244
229 Ga0207675_100124994 3300026118 Bacteria 2436
230 Ga0207675_100641641 3300026118 Bacteria 1067
231 Ga0207683_10006686 3300026121 Bacteria 9865
232 Ga0207683_10042411 3300026121 Bacteria 3974
233 Ga0207683_10092855 3300026121 Bacteria 2689
234 Ga0209813_10081143 3300027866 Bacteria 1073
235 Ga0207428_10001048 3300027907 Bacteria 30412
236 Ga0207428_10006724 3300027907 Bacteria 10556
237 Ga0207428_10436991 3300027907 Bacteria 955
238 Ga0268264_10514212 3300028381 Bacteria 1169
239 Ga0307408_100177788 3300031548 Bacteria 1704
240 Ga0307408_100184674 3300031548 Bacteria 1675
241 Ga0307405_10078270 3300031731 Bacteria 2151
242 Ga0307405_10106664 3300031731 Unclassified 1890
243 Ga0307410_10032474 3300031852 Bacteria 3360
244 Ga0307407_10365409 3300031903 Bacteria 1026
245 Ga0307412_10151588 3300031911 Bacteria 1711
246 Ga0307412_10171937 3300031911 Bacteria 1621
247 Ga0307412_10381595 3300031911 Bacteria 1141
248 Ga0307416_100060777 3300032002 Bacteria 3079
249 Ga0307416_100839413 3300032002 Unclassified 1016
250 Ga0307414_10387737 3300032004 Bacteria 1210
251 Ga0307411_10315900 3300032005 Bacteria 1259
252 Ga0307411_10600671 3300032005 Bacteria 946
253 Ga0307415_100104822 3300032126 Bacteria 2084
254 Ga0307415_100383065 3300032126 Bacteria 1195
255 Ga0373940_0031027 3300035088 Bacteria 1425
256 Ga0373951_0012473 3300035091 Bacteria 1912
257 Ga0373942_0004705 3300035207 Bacteria 3164
258 Ga0373937_0461518 3300036401 Bacteria 1206
259 Ga0373925_0162457 3300037068 Bacteria 1760
260 Ga0439433_0030431 3300041999 Bacteria 1234
261 Ga0439449_0051634 3300042007 Bacteria 1521
262 Ga0450908_000758 3300042184 Bacteria 6186
263 Ga0439464_0048358 3300042439 Bacteria 1225
264 Ga0451577_0033524 3300042876 Bacteria 4629
265 Ga0453684_0149118 3300044712 Bacteria 2782
266 Ga0451576_0015927 3300045051 Bacteria 8311
267 Ga0451576_0035593 3300045051 Bacteria 5281
268 Ga0451576_0117687 3300045051 Bacteria 2766
269 Ga0495629_0053135 3300046459 Bacteria 2835
270 Ga0495594_0031095 3300046499 Bacteria 2893
271 Ga0495642_0023261 3300046528 Bacteria 2445
272 Ga0495598_0073428 3300046537 Bacteria 1082
273 Ga0495609_0052746 3300046538 Bacteria 1809
274 Ga0495621_0008733 3300046539 Bacteria 3047
275 Ga0495656_0290010 3300046615 Bacteria 836
276 Ga0495634_0093872 3300046642 Bacteria 1945
277 Ga0495659_0047087 3300046664 Bacteria 1558
278 Ga0495588_0087679 3300046674 Bacteria 1628
279 Ga0495669_0004448 3300046684 Bacteria 5790
280 Ga0495636_0023204 3300047318 Bacteria 2510
281 Ga0495636_0182202 3300047318 Bacteria 953
282 Ga0495677_0033613 3300047445 Bacteria 1869
283 Ga0495685_025970 3300047447 Bacteria 2016
284 Ga0496100_0115016 3300048903 Bacteria 1875
285 Ga0496101_0052919 3300048904 Bacteria 2928
286 Ga0496101_0237219 3300048904 Bacteria 1419
287 Ga0496101_0409180 3300048904 Bacteria 1069
288 Ga0496102_0003011 3300048905 Bacteria 14268
289 Ga0496106_0194553 3300048909 Bacteria 1613
290 Ga0496107_0244124 3300048910 Bacteria 1336
291 Ga0496108_0054341 3300048911 Bacteria 3361
292 Ga0496109_0177323 3300048912 Bacteria 2001
293 Ga0496110_0130589 3300048913 Bacteria 2268
294 Ga0496112_0029712 3300048915 Bacteria 5288
295 Ga0496112_0037118 3300048915 Bacteria 4757
296 Ga0501033_0493933 3300049570 Bacteria 847
297 Ga0501034_0352272 3300049571 Bacteria 1400
298 Ga0501036_0061531 3300049572 Bacteria 3180
299 Ga0501036_0308869 3300049572 Bacteria 1322
300 Ga0501039_0052365 3300049575 Bacteria 3159
301 Ga0501040_0076128 3300049576 Bacteria 2320
302 Ga0501040_0193051 3300049576 Bacteria 1445
303 Ga0501041_0315555 3300049577 Bacteria 986
304 Ga0501043_0054047 3300049579 Bacteria 3154
305 Ga0501046_0043915 3300049580 Bacteria 3556
306 Ga0501048_0095997 3300049582 Bacteria 2091
307 Ga0501069_0072782 3300049585 Bacteria 1927
308 Ga0501071_0004739 3300049587 Bacteria 8655
309 Ga0501071_0009118 3300049587 Bacteria 6589
310 Ga0501071_0146501 3300049587 Bacteria 1760
311 Ga0501072_0005625 3300049588 Bacteria 9539
312 Ga0501072_0027533 3300049588 Bacteria 4434
313 Ga0501072_0257855 3300049588 Bacteria 1388
314 Ga0501073_0029762 3300049589 Bacteria 3903
315 Ga0501074_0132083 3300049590 Bacteria 1786
316 Ga0501074_0304609 3300049590 Bacteria 1132
317 Ga0501075_0025529 3300049591 Bacteria 4341
318 Ga0501075_0115902 3300049591 Bacteria 2037
319 Ga0501075_0124219 3300049591 Bacteria 1965
320 Ga0501076_0034338 3300049592 Bacteria 3964
321 Ga0501076_0037333 3300049592 Bacteria 3809
322 Ga0501076_0106795 3300049592 Bacteria 2260
323 Ga0501076_0290537 3300049592 Bacteria 1339
324 Ga0501076_0475007 3300049592 Bacteria 1030
325 Ga0501077_0274085 3300049593 Bacteria 1073
326 Ga0501079_0035542 3300049741 Bacteria 3836
327 Ga0501079_0146649 3300049741 Bacteria 1839
328 Ga0501079_0286264 3300049741 Bacteria 1288
329 Ga0501079_0404137 3300049741 Bacteria 1071
330 Ga0501080_0161252 3300049742 Bacteria 2071
331 Ga0501081_0240132 3300049743 Bacteria 1321
332 Ga0501045_0006047 3300049824 Bacteria 8382
333 Ga0501045_0060843 3300049824 Bacteria 2769
334 nmdc:mga03683_117907_c1 3300050489 Bacteria 1178
335 nmdc:mga00v17_114344_c1 3300050491 Bacteria 1714
336 nmdc:mga00v17_28015_c1 3300050491 Bacteria 3295
337 nmdc:mga00v17_91388_c1 3300050491 Bacteria 1912
338 nmdc:mga0yw44_8258_c1 3300050492 Bacteria 5173
339 nmdc:mga0k408_15611_c1 3300050493 Bacteria 4201
340 nmdc:mga0k408_8449_c1 3300050493 Bacteria 5528
341 nmdc:mga06z11_6645_c1 3300050494 Bacteria 4726
342 nmdc:mga06z11_85311_c1 3300050494 Bacteria 1703
343 nmdc:mga06z11_90903_c1 3300050494 Bacteria 1657
344 nmdc:mga04h51_9148_c1 3300050495 Bacteria 2672
345 nmdc:mga07m45_140774_c1 3300050496 Bacteria 1397
346 nmdc:mga05p37_130596_c1 3300050507 Bacteria 3082
347 nmdc:mga05p37_146825_c1 3300050507 Bacteria 2887
348 nmdc:mga05p37_24637_c2 3300050507 Bacteria 6216
349 nmdc:mga05p37_401172_c1 3300050507 Bacteria 1601
350 nmdc:mga05p37_692493_c1 3300050507 Bacteria 1134
351 nmdc:mga05p37_764451_c1 3300050507 Bacteria 1063
352 nmdc:mga09592_156192_c1 3300050508 Bacteria 1969
353 nmdc:mga09592_21674_c1 3300050508 Bacteria 5297
354 nmdc:mga0qj67_132530_c1 3300050509 Bacteria 2019
355 nmdc:mga0qj67_213356_c1 3300050509 Bacteria 1567
356 nmdc:mga0qj67_25457_c1 3300050509 Bacteria 4572
357 nmdc:mga06r32_117341_c1 3300050510 Bacteria 2623
358 nmdc:mga06r32_16183_c1 3300050510 Bacteria 6794
359 nmdc:mga06r32_9918_c1 3300050510 Bacteria 8595
360 nmdc:mga08y16_17148_c1 3300050511 Bacteria 7624
361 nmdc:mga08y16_206388_c1 3300050511 Bacteria 2036
362 nmdc:mga08y16_7357_c1 3300050511 Bacteria 11549
363 nmdc:mga0n895_47058_c1 3300050512 Bacteria 4216
364 nmdc:mga0rr50_18460_c1 3300050513 Bacteria 4687
365 nmdc:mga0rr50_42896_c1 3300050513 Bacteria 3307
366 nmdc:mga0rr50_75374_c1 3300050513 Bacteria 2586
367 nmdc:mga0rr50_75630_c1 3300050513 Bacteria 2582
368 nmdc:mga0a205_18037_c1 3300050515 Bacteria 3565
369 nmdc:mga0a205_256439_c2 3300050515 Unclassified 1216
370 nmdc:mga0a205_293_c2 3300050515 Bacteria 34916
371 nmdc:mga0a205_37256_c1 3300050515 Bacteria 4677
372 nmdc:mga0a205_44014_c1 3300050515 Bacteria 2898
373 nmdc:mga0a205_533260_c1 3300050515 Bacteria 1030
374 Ga0495619_0111937 3300053085 Bacteria 1866
375 Ga0500641_0000664 3300053096 Bacteria 12396
376 Ga0500555_000048 3300053103 Bacteria 61782
377 Ga0500568_0008622 3300053139 Bacteria 4897
378 Ga0500616_0001193 3300053153 Bacteria 26401
379 Ga0500645_000118 3300053730 Bacteria 62173
380 Ga0501084_0014985 3300054114 Bacteria 6428
381 Ga0501084_0034834 3300054114 Bacteria 4210
382 Ga0501084_0320401 3300054114 Bacteria 1309
383 Ga0501084_0415594 3300054114 Bacteria 1137
384 Ga0590077_003494 3300059426 Bacteria 3251
385 Ga0501082_0040380 3300060353 Bacteria 4026
386 Ga0501082_0297577 3300060353 Bacteria 1405
387 Ga0501082_0361332 3300060353 Bacteria 1266
388 Ga0530510_0008027 3300061734 Bacteria 7364
389 Ga0496112_0067903
390 JGI25406J46586_10002715
391 Ga0065704_10071574
392 Ga0065704_10073597
393 Ga0065712_10025285
394 Ga0065712_10178537
395 Ga0065707_10158476
396 Ga0065707_10172459
397 Ga0070676_10002802
398 Ga0070683_100111822
399 Ga0070690_100117821
400 Ga0070670_100022893
401 Ga0070670_100074600
402 Ga0070670_100189389
403 Ga0070670_100213623
404 Ga0070677_10001401
405 Ga0068869_100011805
406 Ga0068869_100067923
407 Ga0068869_100090081
408 Ga0070666_10035980
409 Ga0070666_10104820
410 Ga0070680_100093905
411 Ga0070680_100574650
412 Ga0070682_100242654
413 Ga0068868_100035804
414 Ga0068868_100214675
415 Ga0070689_100002830
416 Ga0070691_10121491
417 Ga0070687_100075847
418 Ga0070687_100116171
419 Ga0070661_100271894
420 Ga0070692_10075182
421 Ga0070668_100250155
422 Ga0070669_100063955
423 Ga0070675_100240115
424 Ga0070675_100363533
425 Ga0070675_100421278
426 Ga0070671_100051438
427 Ga0070671_100517680
428 Ga0070673_100001253
429 Ga0070673_100033236
430 Ga0070673_100128395
431 Ga0070673_100167381
432 Ga0070688_100000591
433 Ga0070659_100725408
434 Ga0070667_100244073
435 Ga0070703_10040083
436 Ga0070701_10037651
437 Ga0070705_100002989
438 Ga0070705_100121601
439 Ga0070705_100202313
440 Ga0070700_100129530
441 Ga0070694_100001096
442 Ga0070694_100002116
443 Ga0070694_100243401
444 Ga0070708_100190750
445 Ga0070663_100046709
446 Ga0070663_100086277
447 Ga0070678_100175875
448 Ga0070662_100008143
449 Ga0068867_100012488
450 Ga0068867_100125011
451 Ga0070706_100483778
452 Ga0070707_100447399
453 Ga0070698_100091928
454 Ga0070699_100011700
455 Ga0070672_100000166
456 Ga0070672_100150094
457 Ga0070686_100017914
458 Ga0070686_100029433
459 Ga0070686_100208002
460 Ga0070695_100000064
461 Ga0070695_100086026
462 Ga0070696_100004945
463 Ga0070696_100096158
464 Ga0070693_100009801
465 Ga0070704_100064126
466 Ga0070704_100088454
467 Ga0070704_100137820
468 Ga0070704_100160917
469 Ga0068855_100511940
470 Ga0070664_100058340
471 Ga0070664_100069017
472 Ga0070664_100168128
473 Ga0068854_100024650
474 Ga0068856_100254718
475 Ga0070702_100228047
476 Ga0068859_100007844
477 Ga0068864_100058016
478 Ga0068864_100476977
479 Ga0068864_100515637
480 Ga0068866_10094928
481 Ga0068851_10078807
482 Ga0068863_100150991
483 Ga0068863_100351914
484 Ga0068858_100016453
485 Ga0068858_100021713
486 Ga0068858_100489775
487 Ga0068860_100207503
488 Ga0068862_100161577
489 Ga0068862_100210909
490 Ga0081539_10000122
491 Ga0075365_10073067
492 Ga0075364_10014698
493 Ga0075364_10032267
494 Ga0075364_10143210
495 Ga0075364_10211479
496 Ga0075367_10017790
497 Ga0075367_10020717
498 Ga0075367_10230531
499 Ga0075427_10006205
500 Ga0068871_100103378
501 Ga0075428_100005221
502 Ga0075428_100024759
503 Ga0075428_100143633
504 Ga0075428_100220986
505 Ga0075428_100294219
506 Ga0075428_100443399
507 Ga0075430_100005040
508 Ga0075431_100032389
509 Ga0075431_100062799
510 Ga0075431_100309529
511 Ga0075433_10000236
512 Ga0075433_10009913
513 Ga0075433_10037109
514 Ga0075433_10141273
515 Ga0075433_10183412
516 Ga0075434_100005302
517 Ga0075434_100007557
518 Ga0075434_100154464
519 Ga0075434_100167321
520 Ga0068865_100298245
521 Ga0097620_100007844
522 Ga0075435_100001882
523 Ga0075435_100010692
524 Ga0075435_100087521
525 Ga0075435_100124299
526 Ga0111539_10002317
527 Ga0111539_10011387
528 Ga0111539_10023771
529 Ga0111539_10209368
530 Ga0105245_10219880
531 Ga0114129_10047442
532 Ga0114129_10061327
533 Ga0114129_10123003
534 Ga0114129_10171104
535 Ga0114129_10469104
536 Ga0114129_10477989
537 Ga0105241_10015918
538 Ga0105242_10032153
539 Ga0105242_10042901
540 Ga0105248_10171732
541 Ga0105248_10830126
542 Ga0105248_11139377
543 Ga0105249_10003004
544 Ga0105239_10177094
545 Ga0163162_10004052
546 Ga0163162_10102047
547 Ga0157375_10005816
548 Ga0163163_10154039
549 Ga0163163_10612937
550 Ga0157377_10009324
551 Ga0157377_10081343
552 Ga0157379_10292551
553 Ga0157376_10776836
554 Ga0207697_10002245
555 Ga0207682_10015855
556 Ga0207682_10019563
557 Ga0207682_10021410
558 Ga0207642_10170830
559 Ga0207688_10111103
560 Ga0207688_10315715
561 Ga0207680_10052372
562 Ga0207645_10004547
563 Ga0207645_10010688
564 Ga0207645_10238207
565 Ga0207684_10156034
566 Ga0207684_10492088
567 Ga0207707_10325291
568 Ga0207660_10300144
569 Ga0207662_10016123
570 Ga0207662_10048458
571 Ga0207649_10213750
572 Ga0207681_10031595
573 Ga0207650_10050404
574 Ga0207650_10064687
575 Ga0207650_10086941
576 Ga0207650_10112609
577 Ga0207659_10000585
578 Ga0207659_10177691
579 Ga0207687_10106632
580 Ga0207690_10362294
581 Ga0207706_10010833
582 Ga0207706_10043605
583 Ga0207686_10290059
584 Ga0207669_10064610
585 Ga0207669_10408516
586 Ga0207704_10119607
587 Ga0207704_10301810
588 Ga0207691_10000888
589 Ga0207689_10002833
590 Ga0207689_10014972
591 Ga0207689_10032020
592 Ga0207661_10043459
593 Ga0207679_10017709
594 Ga0207679_10137867
595 Ga0207679_10252413
596 Ga0207651_10018713
597 Ga0207651_10094130
598 Ga0207712_10397819
599 Ga0207668_10483838
600 Ga0207658_10076298
601 Ga0207677_10077719
602 Ga0207703_10015655
603 Ga0207703_10560693
604 Ga0207678_10017173
605 Ga0207678_10039388
606 Ga0207678_10051485
607 Ga0207708_10007445
608 Ga0207708_10074859
609 Ga0207702_10206561
610 Ga0207641_10269636
611 Ga0207641_10283632
612 Ga0207648_10008266
613 Ga0207648_10174157
614 Ga0207676_10168258
615 Ga0207676_10723709
616 Ga0207675_100042496
617 Ga0207675_100124994
618 Ga0207675_100641641
619 Ga0207683_10006686
620 Ga0207683_10042411
621 Ga0207683_10092855
622 Ga0209813_10081143
623 Ga0207428_10001048
624 Ga0207428_10006724
625 Ga0207428_10436991
626 Ga0268264_10514212
627 Ga0307408_100177788
628 Ga0307408_100184674
629 Ga0307405_10078270
630 Ga0307405_10106664
631 Ga0307410_10032474
632 Ga0307407_10365409
633 Ga0307412_10151588
634 Ga0307412_10171937
635 Ga0307412_10381595
636 Ga0307416_100060777
637 Ga0307416_100839413
638 Ga0307414_10387737
639 Ga0307411_10315900
640 Ga0307411_10600671
641 Ga0307415_100104822
642 Ga0307415_100383065
643 Ga0373940_0031027
644 Ga0373951_0012473
645 Ga0373942_0004705
646 Ga0373937_0461518
647 Ga0373925_0162457
648 Ga0439433_0030431
649 Ga0439449_0051634
650 Ga0450908_000758
651 Ga0439464_0048358
652 Ga0451577_0033524
653 Ga0453684_0149118
654 Ga0451576_0015927
655 Ga0451576_0035593
656 Ga0451576_0117687
657 Ga0495629_0053135
658 Ga0495594_0031095
659 Ga0495642_0023261
660 Ga0495598_0073428
661 Ga0495609_0052746
662 Ga0495621_0008733
663 Ga0495656_0290010
664 Ga0495634_0093872
665 Ga0495659_0047087
666 Ga0495588_0087679
667 Ga0495669_0004448
668 Ga0495636_0023204
669 Ga0495636_0182202
670 Ga0495677_0033613
671 Ga0495685_025970
672 Ga0496100_0115016
673 Ga0496101_0052919
674 Ga0496101_0237219
675 Ga0496101_0409180
676 Ga0496102_0003011
677 Ga0496106_0194553
678 Ga0496107_0244124
679 Ga0496108_0054341
680 Ga0496109_0177323
681 Ga0496110_0130589
682 Ga0496112_0029712
683 Ga0496112_0037118
684 Ga0501033_0493933
685 Ga0501034_0352272
686 Ga0501036_0061531
687 Ga0501036_0308869
688 Ga0501039_0052365
689 Ga0501040_0076128
690 Ga0501040_0193051
691 Ga0501041_0315555
692 Ga0501043_0054047
693 Ga0501046_0043915
694 Ga0501048_0095997
695 Ga0501069_0072782
696 Ga0501071_0004739
697 Ga0501071_0009118
698 Ga0501071_0146501
699 Ga0501072_0005625
700 Ga0501072_0027533
701 Ga0501072_0257855
702 Ga0501073_0029762
703 Ga0501074_0132083
704 Ga0501074_0304609
705 Ga0501075_0025529
706 Ga0501075_0115902
707 Ga0501075_0124219
708 Ga0501076_0034338
709 Ga0501076_0037333
710 Ga0501076_0106795
711 Ga0501076_0290537
712 Ga0501076_0475007
713 Ga0501077_0274085
714 Ga0501079_0035542
715 Ga0501079_0146649
716 Ga0501079_0286264
717 Ga0501079_0404137
718 Ga0501080_0161252
719 Ga0501081_0240132
720 Ga0501045_0006047
721 Ga0501045_0060843
722 nmdc:mga03683_117907_c1
723 nmdc:mga00v17_114344_c1
724 nmdc:mga00v17_28015_c1
725 nmdc:mga00v17_91388_c1
726 nmdc:mga0yw44_8258_c1
727 nmdc:mga0k408_15611_c1
728 nmdc:mga0k408_8449_c1
729 nmdc:mga06z11_6645_c1
730 nmdc:mga06z11_85311_c1
731 nmdc:mga06z11_90903_c1
732 nmdc:mga04h51_9148_c1
733 nmdc:mga07m45_140774_c1
734 nmdc:mga05p37_130596_c1
735 nmdc:mga05p37_146825_c1
736 nmdc:mga05p37_24637_c2
737 nmdc:mga05p37_401172_c1
738 nmdc:mga05p37_692493_c1
739 nmdc:mga05p37_764451_c1
740 nmdc:mga09592_156192_c1
741 nmdc:mga09592_21674_c1
742 nmdc:mga0qj67_132530_c1
743 nmdc:mga0qj67_213356_c1
744 nmdc:mga0qj67_25457_c1
745 nmdc:mga06r32_117341_c1
746 nmdc:mga06r32_16183_c1
747 nmdc:mga06r32_9918_c1
748 nmdc:mga08y16_17148_c1
749 nmdc:mga08y16_206388_c1
750 nmdc:mga08y16_7357_c1
751 nmdc:mga0n895_47058_c1
752 nmdc:mga0rr50_18460_c1
753 nmdc:mga0rr50_42896_c1
754 nmdc:mga0rr50_75374_c1
755 nmdc:mga0rr50_75630_c1
756 nmdc:mga0a205_18037_c1
757 nmdc:mga0a205_256439_c2
758 nmdc:mga0a205_293_c2
759 nmdc:mga0a205_37256_c1
760 nmdc:mga0a205_44014_c1
761 nmdc:mga0a205_533260_c1
762 Ga0495619_0111937
763 Ga0500641_0000664
764 Ga0500555_000048
765 Ga0500568_0008622
766 Ga0500616_0001193
767 Ga0500645_000118
768 Ga0501084_0014985
769 Ga0501084_0034834
770 Ga0501084_0320401
771 Ga0501084_0415594
772 Ga0590077_003494
773 Ga0501082_0040380
774 Ga0501082_0297577
775 Ga0501082_0361332
776 Ga0530510_0008027

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06778

Chlor_dismutase

Chlorite dismutase

60

229

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dtz-assembly1.cif.gz_B crystal structure of putative chlorite dismutase ta0507 0.7942 34 258
3dtz-assembly1.cif.gz_C crystal structure of putative chlorite dismutase ta0507 0.7896 36 256
3dtz-assembly1.cif.gz_B crystal structure of putative chlorite dismutase ta0507 0.7878 34 258
3nn4-assembly1.cif.gz_E structure of chlorite dismutase from candidatus nitrospira defluvii r173k mutant 0.7843 37 257
3nn3-assembly1.cif.gz_C structure of chlorite dismutase from candidatus nitrospira defluvii r173a mutant 0.7825 37 257
ID Description Score Start End Superfamily
1vdhC01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.8646 37 131 3.30.70.1030
af_Q2G0J1_1_118_3.30.70.1030 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.8224 37 145 3.30.70.1030
5loqE01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.796 37 152 3.30.70.1030
af_Q2G0J1_1_118_3.30.70.1030 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.7524 37 145 3.30.70.1030
af_P9WL45_128_230_3.30.70.1030 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.7446 157 255 3.30.70.1030
ID Description Score Start End GO Terms
AF-A0A383A9Z9-F1-model_v4 Light-independent protochlorophyllide reductase subunit B-like C-terminal domain-containing protein 0.9221 26 116 GO:0015979
GO:0015995
GO:0016491
GO:0020037
GO:0046872
AF-A0A534VV90-F1-model_v4 Heme-dependent peroxidase 0.9174 37 131 GO:0004601
GO:0020037
GO:0046872
AF-A0A538G0A2-F1-model_v4 Chlorite dismutase family protein 0.916 34 126 GO:0016491
GO:0020037
GO:0046872
AF-A0A5N9CZI2-F1-model_v4 Chlorite dismutase family protein 0.9123 31 137 GO:0016491
GO:0020037
GO:0046872
AF-A0A521K9E3-F1-model_v4 Chlorite dismutase 0.9114 29 130 GO:0016491
GO:0020037
GO:0046872

Map