F431182

General Info

Members Datasets Scaffolds Average Seq Length
388 197 776 246

Family's Representative Sequence

Representative Sequence 3300038725|Ga0400484_39743|Ga0400484_39743_13527_14420
Length 297
Sequence MIPDQNVFFNTPDMLVIQHGKGLFSAARFVLLWDIFCNRKIDPMTYCLGICVQDGLMFASDSRTNAGVDYVTSYSKMHVFEPAPDRVFVLLSAGNLATTQEIVNIIQRDIDYPNGGENLLTARYLFEAADYVGRVSQLVQQQHGVVLQQAGVSGEVSLILGGQIQGQPHGLMLIYPQGNHIEASRSTPYLQIGENKYGKPVLDRVLRYDLPLNDAARLALVSLSSTTMSNITVGPPYEVAICNVDQFRIGSRCKFEEGEEYLKQLQEAWTNGLIHSFNNLPRFDWERDDQMGLGFVE

Samples

Sample ID Description Type Environment
1 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
141 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
149 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
150 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
151 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
152 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
153 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
154 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
155 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
156 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
164 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
169 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
170 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
171 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
172 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
175 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
190 2738541337 Pelomonas sp. BT06 Isolate Unclassified
191 2831864461 Roseateles noduli HZ7 Isolate Nodule
192 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
193 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
194 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
195 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
196 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
197 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.3
Metatranscriptomes 4.38
Isolates 2.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.96
Nodule 0.77
Rhizoplane 0
Rhizosphere 86.86
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400484_39743 3300038725 Bacteria 14640
2 JGI24740J21852_10039879 3300001979 Bacteria 1428
3 JGI24737J22298_10003306 3300001990 Bacteria 5709
4 JGI24737J22298_10023519 3300001990 Bacteria 1954
5 JGI24743J22301_10014014 3300001991 Bacteria 1475
6 JGI24735J21928_10003935 3300002067 Bacteria 5028
7 JGI24735J21928_10017727 3300002067 Bacteria 2200
8 JGI24744J21845_10010492 3300002077 Bacteria 1898
9 JGI25165J46597_1000120 3300003214 Bacteria 136275
10 rootH1_10003920 3300003316 Bacteria 4939
11 rootL2_10001141 3300003322 Bacteria 16441
12 rootH1_10022861 3300003323 Bacteria 4568
13 rootH1_10069761 3300003323 Bacteria 2559
14 rootH1_10069782 3300003323 Bacteria 4657
15 JGI25161J50226_1011213 3300003374 Bacteria 1142
16 Ga0055542_1001687 3300003762 Bacteria 9752
17 Ga0055529_1011821 3300003763 Bacteria 1122
18 Ga0055526_1006257 3300003771 Bacteria 6520
19 Ga0055524_1000162 3300003775 Bacteria 77486
20 Ga0055524_1002935 3300003775 Bacteria 8504
21 Ga0055540_1032214 3300003792 Bacteria 1198
22 Ga0055531_10002797 3300003794 Bacteria 11441
23 Ga0055531_10011443 3300003794 Bacteria 4274
24 Ga0055543_1006127 3300004625 Bacteria 2958
25 Ga0065165_1000086 3300005262 Bacteria 154235
26 Ga0065165_1000562 3300005262 Bacteria 55318
27 Ga0070658_10018792 3300005327 Bacteria 5536
28 Ga0070658_10185533 3300005327 Bacteria 1751
29 Ga0070676_10000539 3300005328 Bacteria 18309
30 Ga0070676_10006059 3300005328 Bacteria 6454
31 Ga0070670_100008429 3300005331 Bacteria 8791
32 Ga0070670_100015819 3300005331 Bacteria 6475
33 Ga0070670_100062033 3300005331 Bacteria 3209
34 Ga0070670_100145297 3300005331 Bacteria 2052
35 Ga0070677_10035188 3300005333 Bacteria 1940
36 Ga0068869_100000897 3300005334 Bacteria 17161
37 Ga0070666_10221508 3300005335 Bacteria 1335
38 Ga0068868_100000016 3300005338 Bacteria 102357
39 Ga0070660_100001721 3300005339 Bacteria 14994
40 Ga0070660_100049891 3300005339 Bacteria 3219
41 Ga0070660_100200717 3300005339 Bacteria 1618
42 Ga0070689_100069946 3300005340 Bacteria 2739
43 Ga0070668_100001367 3300005347 Bacteria 17476
44 Ga0070669_100023943 3300005353 Bacteria 4374
45 Ga0070675_100004924 3300005354 Bacteria 10184
46 Ga0070675_100019654 3300005354 Bacteria 5385
47 Ga0070671_100014742 3300005355 Bacteria 6317
48 Ga0070671_100619518 3300005355 Bacteria 936
49 Ga0070674_100242916 3300005356 Bacteria 1411
50 Ga0070673_100000017 3300005364 Bacteria 112829
51 Ga0070673_100127461 3300005364 Bacteria 2131
52 Ga0070688_100273452 3300005365 Bacteria 1211
53 Ga0070667_100571777 3300005367 Bacteria 1040
54 Ga0070667_100717135 3300005367 Bacteria 926
55 Ga0070700_100100570 3300005441 Bacteria 1904
56 Ga0070678_100032821 3300005456 Bacteria 3597
57 Ga0070678_100064341 3300005456 Bacteria 2718
58 Ga0070662_100048570 3300005457 Bacteria 3057
59 Ga0070662_100060998 3300005457 Bacteria 2752
60 Ga0070662_100120562 3300005457 Bacteria 2010
61 Ga0068867_100000013 3300005459 Bacteria 112835
62 Ga0068867_100132292 3300005459 Bacteria 1940
63 Ga0070685_10263533 3300005466 Bacteria 1147
64 Ga0070679_100209364 3300005530 Bacteria 1914
65 Ga0068853_100050705 3300005539 Bacteria 3571
66 Ga0068853_100406584 3300005539 Bacteria 1275
67 Ga0070672_100321746 3300005543 Bacteria 1315
68 Ga0070665_100398091 3300005548 Bacteria 1385
69 Ga0068855_100004632 3300005563 Bacteria 16781
70 Ga0070664_100383780 3300005564 Bacteria 1283
71 Ga0068854_100005926 3300005578 Bacteria 7742
72 Ga0068854_100096007 3300005578 Bacteria 2214
73 Ga0068856_100019299 3300005614 Bacteria 6617
74 Ga0068852_100265717 3300005616 Bacteria 1649
75 Ga0068859_100054658 3300005617 Bacteria 4016
76 Ga0068859_100674822 3300005617 Bacteria 1125
77 Ga0068864_100018158 3300005618 Bacteria 5870
78 Ga0068866_10024751 3300005718 Bacteria 2814
79 Ga0068866_10079490 3300005718 Bacteria 1757
80 Ga0068861_100046630 3300005719 Bacteria 3268
81 Ga0068861_100144861 3300005719 Bacteria 1943
82 Ga0068851_10028717 3300005834 Bacteria 2748
83 Ga0068863_100001846 3300005841 Bacteria 21046
84 Ga0068863_100170797 3300005841 Bacteria 2085
85 Ga0068863_100407583 3300005841 Bacteria 1330
86 Ga0068860_100282523 3300005843 Bacteria 1622
87 Ga0068862_100055667 3300005844 Bacteria 3388
88 Ga0068862_100069256 3300005844 Bacteria 3045
89 Ga0081539_10070811 3300005985 Bacteria 1870
90 Ga0097621_100032868 3300006237 Bacteria 4127
91 Ga0097621_100099327 3300006237 Bacteria 2446
92 Ga0097621_100206118 3300006237 Bacteria 1708
93 Ga0075370_10055415 3300006353 Bacteria 2252
94 Ga0068871_100001748 3300006358 Bacteria 14647
95 Ga0068871_100011649 3300006358 Bacteria 6457
96 Ga0068871_100497054 3300006358 Bacteria 1099
97 Ga0075428_100030959 3300006844 Bacteria 5917
98 Ga0075430_100497348 3300006846 Bacteria 1006
99 Ga0068865_100000007 3300006881 Bacteria 185316
100 Ga0097620_100054660 3300006931 Bacteria 4016
101 Ga0097620_100674789 3300006931 Bacteria 1125
102 Ga0099823_1000003 3300006944 Bacteria 189058
103 Ga0099794_10098771 3300007265 Bacteria 1455
104 Ga0105240_10102596 3300009093 Bacteria 3476
105 Ga0105245_10001117 3300009098 Bacteria 24272
106 Ga0105243_10000118 3300009148 Bacteria 91438
107 Ga0105243_10179864 3300009148 Bacteria 1838
108 Ga0105242_10000196 3300009176 Bacteria 46996
109 Ga0105248_10256277 3300009177 Bacteria 1969
110 Ga0105237_10436119 3300009545 Bacteria 1316
111 Ga0105249_10063336 3300009553 Bacteria 3397
112 Ga0105239_10033901 3300010375 Bacteria 5604
113 Ga0105239_10855087 3300010375 Bacteria 1043
114 Ga0105246_10000135 3300011119 Bacteria 34300
115 Ga0157319_1000002 3300012497 Bacteria 410803
116 Ga0157373_10049689 3300013100 Bacteria 2988
117 Ga0157373_10437764 3300013100 Bacteria 940
118 Ga0157370_10029399 3300013104 Bacteria 5393
119 Ga0157369_10051381 3300013105 Bacteria 4460
120 Ga0157369_10504769 3300013105 Bacteria 1251
121 Ga0157374_10000189 3300013296 Bacteria 57356
122 Ga0157378_10000264 3300013297 Bacteria 51230
123 Ga0163162_10229603 3300013306 Bacteria 1986
124 Ga0163162_10534751 3300013306 Bacteria 1301
125 Ga0157375_10000436 3300013308 Bacteria 37738
126 Ga0157375_10039912 3300013308 Bacteria 4520
127 Ga0157375_10133327 3300013308 Bacteria 2605
128 Ga0163163_10161259 3300014325 Bacteria 2288
129 Ga0157380_10111346 3300014326 Bacteria 2301
130 Ga0157377_10013436 3300014745 Bacteria 4145
131 Ga0157376_10000081 3300014969 Bacteria 72584
132 Ga0157376_10024520 3300014969 Bacteria 4738
133 Ga0157376_10109738 3300014969 Bacteria 2426
134 Ga0163161_10054090 3300017792 Bacteria 2913
135 Ga0163161_10064509 3300017792 Bacteria 2672
136 Ga0163161_10351872 3300017792 Bacteria 1171
137 Ga0213872_10039993 3300021361 Bacteria 2140
138 Ga0213872_10046011 3300021361 Bacteria 1986
139 Ga0207427_101184 3300025231 Bacteria 10191
140 Ga0209026_1003769 3300025250 Bacteria 4806
141 Ga0209148_1000074 3300025254 Bacteria 314356
142 Ga0209148_1002129 3300025254 Bacteria 7417
143 Ga0209233_1000003 3300025261 Bacteria 1607366
144 Ga0209455_1000386 3300025272 Bacteria 39294
145 Ga0209673_1004964 3300025273 Bacteria 6904
146 Ga0209564_1000229 3300025295 Bacteria 125047
147 Ga0209050_1004234 3300025298 Bacteria 9865
148 Ga0209256_1000072 3300025299 Bacteria 239812
149 Ga0209256_1002034 3300025299 Bacteria 17988
150 Ga0209051_1001591 3300025303 Bacteria 18621
151 Ga0209257_1000385 3300025304 Bacteria 88117
152 Ga0207682_10043601 3300025893 Bacteria 1836
153 Ga0207682_10139052 3300025893 Bacteria 1089
154 Ga0207642_10029237 3300025899 Bacteria 2280
155 Ga0207647_10019833 3300025904 Bacteria 4515
156 Ga0207647_10179558 3300025904 Bacteria 1230
157 Ga0207645_10004550 3300025907 Bacteria 10242
158 Ga0207645_10010378 3300025907 Bacteria 6394
159 Ga0207643_10058612 3300025908 Bacteria 2195
160 Ga0207705_10000110 3300025909 Bacteria 92932
161 Ga0207705_10089917 3300025909 Bacteria 2247
162 Ga0207695_10122326 3300025913 Bacteria 2569
163 Ga0207671_10023258 3300025914 Bacteria 4674
164 Ga0207662_10290235 3300025918 Bacteria 1085
165 Ga0207657_10002766 3300025919 Bacteria 18890
166 Ga0207657_10022183 3300025919 Bacteria 5955
167 Ga0207681_10209602 3300025923 Bacteria 1501
168 Ga0207681_10363747 3300025923 Bacteria 1161
169 Ga0207650_10008253 3300025925 Bacteria 7110
170 Ga0207650_10022993 3300025925 Bacteria 4417
171 Ga0207650_10050037 3300025925 Bacteria 3088
172 Ga0207650_10106750 3300025925 Bacteria 2163
173 Ga0207659_10005412 3300025926 Bacteria 7735
174 Ga0207659_10063809 3300025926 Bacteria 2664
175 Ga0207659_10318918 3300025926 Bacteria 1282
176 Ga0207687_10006851 3300025927 Bacteria 7503
177 Ga0207644_10775574 3300025931 Bacteria 801
178 Ga0207706_10023251 3300025933 Bacteria 5567
179 Ga0207706_10075599 3300025933 Bacteria 2962
180 Ga0207709_10000156 3300025935 Bacteria 93099
181 Ga0207669_10104710 3300025937 Bacteria 1880
182 Ga0207669_10503734 3300025937 Bacteria 969
183 Ga0207704_10000017 3300025938 Bacteria 154190
184 Ga0207691_10004057 3300025940 Bacteria 14198
185 Ga0207691_10103857 3300025940 Bacteria 2533
186 Ga0207689_10002708 3300025942 Bacteria 16386
187 Ga0207667_10000071 3300025949 Bacteria 178355
188 Ga0207667_10204213 3300025949 Bacteria 2027
189 Ga0207651_10000011 3300025960 Bacteria 191950
190 Ga0207651_10058055 3300025960 Bacteria 2673
191 Ga0207651_10065062 3300025960 Bacteria 2555
192 Ga0207651_10069246 3300025960 Bacteria 2491
193 Ga0207712_10022196 3300025961 Bacteria 4176
194 Ga0207712_10062749 3300025961 Bacteria 2643
195 Ga0207668_10060955 3300025972 Bacteria 2650
196 Ga0207640_10000131 3300025981 Bacteria 56277
197 Ga0207640_10008747 3300025981 Bacteria 5634
198 Ga0207677_10000173 3300026023 Bacteria 50916
199 Ga0207677_10550032 3300026023 Bacteria 1006
200 Ga0207639_10010755 3300026041 Bacteria 6341
201 Ga0207678_10003032 3300026067 Bacteria 15198
202 Ga0207708_10189833 3300026075 Bacteria 1635
203 Ga0207702_10098999 3300026078 Bacteria 2570
204 Ga0207641_10025194 3300026088 Bacteria 4905
205 Ga0207641_10098669 3300026088 Bacteria 2569
206 Ga0207641_10392413 3300026088 Bacteria 1331
207 Ga0207648_10000045 3300026089 Bacteria 111963
208 Ga0207648_10176001 3300026089 Bacteria 1892
209 Ga0207648_10185153 3300026089 Bacteria 1844
210 Ga0207676_10026849 3300026095 Bacteria 4283
211 Ga0207676_10031849 3300026095 Bacteria 3968
212 Ga0207676_10204660 3300026095 Bacteria 1746
213 Ga0207675_100130009 3300026118 Bacteria 2387
214 Ga0207675_100181952 3300026118 Bacteria 2013
215 Ga0207683_10018920 3300026121 Bacteria 5876
216 Ga0207683_10206974 3300026121 Bacteria 1784
217 Ga0207698_10337848 3300026142 Bacteria 1417
218 Ga0209389_1000243 3300027296 Bacteria 34996
219 Ga0209371_1026534 3300027312 Bacteria 1317
220 Ga0209371_1026732 3300027312 Bacteria 1308
221 Ga0209974_10001429 3300027876 Bacteria 8640
222 Ga0268265_10104713 3300028380 Bacteria 2294
223 Ga0268265_10548453 3300028380 Bacteria 1097
224 Ga0268264_10090550 3300028381 Bacteria 2636
225 Ga0307515_10030134 3300028794 Bacteria 9131
226 Ga0268256_1030170 3300030500 Bacteria 1317
227 Ga0268256_1030430 3300030500 Bacteria 1308
228 Ga0307408_100008251 3300031548 Bacteria 6874
229 Ga0316575_10000396 3300031665 Bacteria 12432
230 Ga0316579_10000419 3300031691 Bacteria 13540
231 Ga0316579_10000678 3300031691 Bacteria 11542
232 Ga0316579_10000847 3300031691 Bacteria 10600
233 Ga0316579_10004486 3300031691 Bacteria 5547
234 Ga0316579_10005146 3300031691 Bacteria 5254
235 Ga0316579_10011365 3300031691 Bacteria 3782
236 Ga0316579_10033651 3300031691 Bacteria 2355
237 Ga0316579_10053351 3300031691 Bacteria 1894
238 Ga0316579_10096867 3300031691 Bacteria 1411
239 Ga0316576_10000787 3300031727 Bacteria 15929
240 Ga0316576_10001135 3300031727 Bacteria 13976
241 Ga0316576_10003059 3300031727 Bacteria 9731
242 Ga0316576_10003257 3300031727 Bacteria 9472
243 Ga0316576_10003496 3300031727 Bacteria 9233
244 Ga0316576_10004363 3300031727 Bacteria 8471
245 Ga0316576_10006862 3300031727 Bacteria 7118
246 Ga0316576_10012388 3300031727 Bacteria 5630
247 Ga0316576_10015172 3300031727 Bacteria 5163
248 Ga0316576_10019214 3300031727 Bacteria 4680
249 Ga0316576_10020039 3300031727 Bacteria 4593
250 Ga0316576_10110166 3300031727 Bacteria 2063
251 Ga0316576_10243921 3300031727 Bacteria 1349
252 Ga0316578_10000029 3300031728 Bacteria 29549
253 Ga0316578_10000804 3300031728 Bacteria 11636
254 Ga0316578_10000970 3300031728 Bacteria 10898
255 Ga0316578_10003679 3300031728 Bacteria 7074
256 Ga0316578_10006551 3300031728 Bacteria 5759
257 Ga0316578_10013147 3300031728 Bacteria 4379
258 Ga0316578_10032577 3300031728 Bacteria 2979
259 Ga0316578_10048193 3300031728 Bacteria 2487
260 Ga0316578_10091456 3300031728 Bacteria 1817
261 Ga0316578_10094400 3300031728 Bacteria 1789
262 Ga0316577_10000654 3300031733 Bacteria 14481
263 Ga0316577_10001473 3300031733 Bacteria 11151
264 Ga0316577_10004532 3300031733 Bacteria 7182
265 Ga0316577_10012103 3300031733 Bacteria 4691
266 Ga0316577_10016494 3300031733 Bacteria 4072
267 Ga0316577_10019211 3300031733 Bacteria 3780
268 Ga0316577_10035236 3300031733 Bacteria 2797
269 Ga0316577_10037156 3300031733 Bacteria 2724
270 Ga0316577_10046667 3300031733 Bacteria 2420
271 Ga0316577_10077817 3300031733 Unclassified 1852
272 Ga0316577_10132278 3300031733 Bacteria 1404
273 Ga0316583_10001064 3300032133 Bacteria 8899
274 Ga0316583_10001833 3300032133 Bacteria 7231
275 Ga0316583_10005035 3300032133 Bacteria 4730
276 Ga0316583_10029078 3300032133 Bacteria 1971
277 Ga0316583_10034623 3300032133 Bacteria 1792
278 Ga0316585_10000035 3300032137 Bacteria 20542
279 Ga0316585_10000116 3300032137 Bacteria 14891
280 Ga0316585_10001630 3300032137 Bacteria 5953
281 Ga0316585_10002514 3300032137 Bacteria 4951
282 Ga0316585_10013651 3300032137 Bacteria 2419
283 Ga0316585_10016089 3300032137 Bacteria 2250
284 Ga0316585_10031766 3300032137 Unclassified 1661
285 Ga0316585_10032766 3300032137 Bacteria 1637
286 Ga0316580_10000070 3300032139 Bacteria 17522
287 Ga0316580_10000418 3300032139 Bacteria 9678
288 Ga0316580_10000947 3300032139 Bacteria 7208
289 Ga0316580_10008291 3300032139 Bacteria 3110
290 Ga0316580_10054099 3300032139 Bacteria 1235
291 Ga0316593_10000082 3300032168 Bacteria 11664
292 Ga0316593_10001388 3300032168 Bacteria 5304
293 Ga0316593_10003226 3300032168 Bacteria 4011
294 Ga0316593_10014791 3300032168 Bacteria 2336
295 Ga0316593_10025352 3300032168 Bacteria 1887
296 Ga0316593_10034942 3300032168 Bacteria 1651
297 Ga0316593_10104895 3300032168 Bacteria 1006
298 Ga0316592_1000005 3300033524 Bacteria 14827
299 Ga0316592_1000270 3300033524 Bacteria 6502
300 Ga0316592_1000272 3300033524 Bacteria 6488
301 Ga0316592_1037970 3300033524 Bacteria 1061
302 Ga0316588_1000130 3300033528 Bacteria 7801
303 Ga0316588_1001879 3300033528 Bacteria 3567
304 Ga0316587_1013180 3300033529 Bacteria 1352
305 Ga0316596_1000125 3300033541 Bacteria 10166
306 Ga0316596_1000127 3300033541 Bacteria 10149
307 Ga0316596_1010079 3300033541 Bacteria 2280
308 Ga0316574_0000116 3300035398 Bacteria 24245
309 Ga0316574_0000298 3300035398 Bacteria 18690
310 Ga0316574_0000648 3300035398 Bacteria 14604
311 Ga0316574_0018382 3300035398 Bacteria 4106
312 Ga0316574_0044265 3300035398 Bacteria 2753
313 Ga0316574_0148195 3300035398 Bacteria 1512
314 Ga0316574_0349861 3300035398 Bacteria 935
315 Ga0316574_0355944 3300035398 Bacteria 926
316 Ga0373937_0185334 3300036401 Bacteria 1955
317 Ga0316582_0000363 3300036647 Bacteria 16182
318 Ga0316582_0001750 3300036647 Bacteria 9770
319 Ga0316582_0002177 3300036647 Bacteria 9092
320 Ga0316582_0009421 3300036647 Bacteria 5302
321 Ga0316582_0028338 3300036647 Bacteria 3392
322 Ga0316582_0034522 3300036647 Bacteria 3116
323 Ga0316582_0041032 3300036647 Bacteria 2890
324 Ga0316582_0046314 3300036647 Bacteria 2741
325 Ga0316582_0050985 3300036647 Bacteria 2624
326 Ga0316582_0124137 3300036647 Bacteria 1730
327 Ga0316582_0134439 3300036647 Bacteria 1663
328 Ga0316584_0000744 3300036712 Bacteria 18135
329 Ga0316584_0001073 3300036712 Bacteria 15985
330 Ga0316584_0003237 3300036712 Bacteria 10542
331 Ga0316584_0006315 3300036712 Bacteria 8027
332 Ga0316584_0007256 3300036712 Bacteria 7564
333 Ga0316584_0011925 3300036712 Bacteria 6123
334 Ga0316584_0014401 3300036712 Bacteria 5628
335 Ga0316584_0014476 3300036712 Bacteria 5616
336 Ga0316584_0039194 3300036712 Bacteria 3527
337 Ga0316584_0048900 3300036712 Bacteria 3160
338 Ga0316584_0058508 3300036712 Bacteria 2886
339 Ga0316584_0179567 3300036712 Bacteria 1567
340 Ga0316584_0213700 3300036712 Bacteria 1419
341 Ga0395899_0017913 3300037312 Bacteria 5390
342 Ga0395898_0280788 3300037466 Bacteria 1589
343 Ga0395905_0530843 3300037471 Bacteria 1077
344 Ga0316581_0004089 3300037588 Bacteria 3689
345 Ga0316581_0004304 3300037588 Bacteria 3619
346 Ga0316581_0016885 3300037588 Bacteria 2101
347 Ga0316581_0018647 3300037588 Unclassified 2017
348 Ga0316581_0031658 3300037588 Bacteria 1594
349 Ga0316581_0102472 3300037588 Bacteria 881
350 Ga0400484_32133 3300038725 Bacteria 5955
351 Ga0400490_02970 3300038726 Bacteria 31362
352 Ga0400488_53472 3300038741 Bacteria 4218
353 Ga0400483_102738 3300039062 Bacteria 1171
354 Ga0400483_121927 3300039062 Bacteria 7186
355 Ga0400483_229392 3300039062 Bacteria 19504
356 Ga0400487_17883 3300039110 Bacteria 1726
357 Ga0400487_59796 3300039110 Bacteria 1896
358 Ga0436361_0841601 3300039447 Bacteria 9504
359 Ga0436361_0855472 3300039447 Bacteria 2276
360 Ga0450890_005450 3300042127 Bacteria 1635
361 Ga0439459_0000437 3300042438 Bacteria 5352
362 Ga0466969_0011855 3300044656 Bacteria 4609
363 Ga0466965_0010841 3300044683 Bacteria 4264
364 Ga0466961_0001772 3300044693 Bacteria 13371
365 Ga0453684_0522162 3300044712 Bacteria 1312
366 Ga0466960_0049085 3300044901 Bacteria 2031
367 Ga0466959_0013479 3300045049 Bacteria 5924
368 Ga0466959_0013603 3300045049 Bacteria 5901
369 Ga0451576_0001221 3300045051 Bacteria 45670
370 Ga0451576_0009050 3300045051 Bacteria 11594
371 Ga0451576_0009263 3300045051 Bacteria 11438
372 Ga0451576_0021815 3300045051 Bacteria 6952
373 Ga0451576_0307269 3300045051 Bacteria 1659
374 Ga0495641_0014222 3300046461 Bacteria 4317
375 Ga0495670_0021926 3300046691 Bacteria 3153
376 Ga0501047_0727053 3300049581 Bacteria 809
377 nmdc:mga06r32_405953_c1 3300050510 Bacteria 1344
378 Ga0500622_0002493 3300053156 Bacteria 13244
379 Ga0501082_0574712 3300060353 Bacteria 986
380 2644219634 2643221639 Bacteria 6649903
381 2739054543 2738541337 Bacteria 6183410
382 2831868639 2831864461 Bacteria 6502356
383 2839144623 2839138175 Bacteria 6549354
384 2842721262 2842718218 Bacteria 4560148
385 2886852549 2886848708 Bacteria 5632523
386 2974322645 2974320154 Bacteria 4571377
387 2998345147 2998344455 Bacteria 4222996
388 8001524606 8001522603 Bacteria 4726425
389 Ga0400484_39743
390 JGI24740J21852_10039879
391 JGI24737J22298_10003306
392 JGI24737J22298_10023519
393 JGI24743J22301_10014014
394 JGI24735J21928_10003935
395 JGI24735J21928_10017727
396 JGI24744J21845_10010492
397 JGI25165J46597_1000120
398 rootH1_10003920
399 rootL2_10001141
400 rootH1_10022861
401 rootH1_10069761
402 rootH1_10069782
403 JGI25161J50226_1011213
404 Ga0055542_1001687
405 Ga0055529_1011821
406 Ga0055526_1006257
407 Ga0055524_1000162
408 Ga0055524_1002935
409 Ga0055540_1032214
410 Ga0055531_10002797
411 Ga0055531_10011443
412 Ga0055543_1006127
413 Ga0065165_1000086
414 Ga0065165_1000562
415 Ga0070658_10018792
416 Ga0070658_10185533
417 Ga0070676_10000539
418 Ga0070676_10006059
419 Ga0070670_100008429
420 Ga0070670_100015819
421 Ga0070670_100062033
422 Ga0070670_100145297
423 Ga0070677_10035188
424 Ga0068869_100000897
425 Ga0070666_10221508
426 Ga0068868_100000016
427 Ga0070660_100001721
428 Ga0070660_100049891
429 Ga0070660_100200717
430 Ga0070689_100069946
431 Ga0070668_100001367
432 Ga0070669_100023943
433 Ga0070675_100004924
434 Ga0070675_100019654
435 Ga0070671_100014742
436 Ga0070671_100619518
437 Ga0070674_100242916
438 Ga0070673_100000017
439 Ga0070673_100127461
440 Ga0070688_100273452
441 Ga0070667_100571777
442 Ga0070667_100717135
443 Ga0070700_100100570
444 Ga0070678_100032821
445 Ga0070678_100064341
446 Ga0070662_100048570
447 Ga0070662_100060998
448 Ga0070662_100120562
449 Ga0068867_100000013
450 Ga0068867_100132292
451 Ga0070685_10263533
452 Ga0070679_100209364
453 Ga0068853_100050705
454 Ga0068853_100406584
455 Ga0070672_100321746
456 Ga0070665_100398091
457 Ga0068855_100004632
458 Ga0070664_100383780
459 Ga0068854_100005926
460 Ga0068854_100096007
461 Ga0068856_100019299
462 Ga0068852_100265717
463 Ga0068859_100054658
464 Ga0068859_100674822
465 Ga0068864_100018158
466 Ga0068866_10024751
467 Ga0068866_10079490
468 Ga0068861_100046630
469 Ga0068861_100144861
470 Ga0068851_10028717
471 Ga0068863_100001846
472 Ga0068863_100170797
473 Ga0068863_100407583
474 Ga0068860_100282523
475 Ga0068862_100055667
476 Ga0068862_100069256
477 Ga0081539_10070811
478 Ga0097621_100032868
479 Ga0097621_100099327
480 Ga0097621_100206118
481 Ga0075370_10055415
482 Ga0068871_100001748
483 Ga0068871_100011649
484 Ga0068871_100497054
485 Ga0075428_100030959
486 Ga0075430_100497348
487 Ga0068865_100000007
488 Ga0097620_100054660
489 Ga0097620_100674789
490 Ga0099823_1000003
491 Ga0099794_10098771
492 Ga0105240_10102596
493 Ga0105245_10001117
494 Ga0105243_10000118
495 Ga0105243_10179864
496 Ga0105242_10000196
497 Ga0105248_10256277
498 Ga0105237_10436119
499 Ga0105249_10063336
500 Ga0105239_10033901
501 Ga0105239_10855087
502 Ga0105246_10000135
503 Ga0157319_1000002
504 Ga0157373_10049689
505 Ga0157373_10437764
506 Ga0157370_10029399
507 Ga0157369_10051381
508 Ga0157369_10504769
509 Ga0157374_10000189
510 Ga0157378_10000264
511 Ga0163162_10229603
512 Ga0163162_10534751
513 Ga0157375_10000436
514 Ga0157375_10039912
515 Ga0157375_10133327
516 Ga0163163_10161259
517 Ga0157380_10111346
518 Ga0157377_10013436
519 Ga0157376_10000081
520 Ga0157376_10024520
521 Ga0157376_10109738
522 Ga0163161_10054090
523 Ga0163161_10064509
524 Ga0163161_10351872
525 Ga0213872_10039993
526 Ga0213872_10046011
527 Ga0207427_101184
528 Ga0209026_1003769
529 Ga0209148_1000074
530 Ga0209148_1002129
531 Ga0209233_1000003
532 Ga0209455_1000386
533 Ga0209673_1004964
534 Ga0209564_1000229
535 Ga0209050_1004234
536 Ga0209256_1000072
537 Ga0209256_1002034
538 Ga0209051_1001591
539 Ga0209257_1000385
540 Ga0207682_10043601
541 Ga0207682_10139052
542 Ga0207642_10029237
543 Ga0207647_10019833
544 Ga0207647_10179558
545 Ga0207645_10004550
546 Ga0207645_10010378
547 Ga0207643_10058612
548 Ga0207705_10000110
549 Ga0207705_10089917
550 Ga0207695_10122326
551 Ga0207671_10023258
552 Ga0207662_10290235
553 Ga0207657_10002766
554 Ga0207657_10022183
555 Ga0207681_10209602
556 Ga0207681_10363747
557 Ga0207650_10008253
558 Ga0207650_10022993
559 Ga0207650_10050037
560 Ga0207650_10106750
561 Ga0207659_10005412
562 Ga0207659_10063809
563 Ga0207659_10318918
564 Ga0207687_10006851
565 Ga0207644_10775574
566 Ga0207706_10023251
567 Ga0207706_10075599
568 Ga0207709_10000156
569 Ga0207669_10104710
570 Ga0207669_10503734
571 Ga0207704_10000017
572 Ga0207691_10004057
573 Ga0207691_10103857
574 Ga0207689_10002708
575 Ga0207667_10000071
576 Ga0207667_10204213
577 Ga0207651_10000011
578 Ga0207651_10058055
579 Ga0207651_10065062
580 Ga0207651_10069246
581 Ga0207712_10022196
582 Ga0207712_10062749
583 Ga0207668_10060955
584 Ga0207640_10000131
585 Ga0207640_10008747
586 Ga0207677_10000173
587 Ga0207677_10550032
588 Ga0207639_10010755
589 Ga0207678_10003032
590 Ga0207708_10189833
591 Ga0207702_10098999
592 Ga0207641_10025194
593 Ga0207641_10098669
594 Ga0207641_10392413
595 Ga0207648_10000045
596 Ga0207648_10176001
597 Ga0207648_10185153
598 Ga0207676_10026849
599 Ga0207676_10031849
600 Ga0207676_10204660
601 Ga0207675_100130009
602 Ga0207675_100181952
603 Ga0207683_10018920
604 Ga0207683_10206974
605 Ga0207698_10337848
606 Ga0209389_1000243
607 Ga0209371_1026534
608 Ga0209371_1026732
609 Ga0209974_10001429
610 Ga0268265_10104713
611 Ga0268265_10548453
612 Ga0268264_10090550
613 Ga0307515_10030134
614 Ga0268256_1030170
615 Ga0268256_1030430
616 Ga0307408_100008251
617 Ga0316575_10000396
618 Ga0316579_10000419
619 Ga0316579_10000678
620 Ga0316579_10000847
621 Ga0316579_10004486
622 Ga0316579_10005146
623 Ga0316579_10011365
624 Ga0316579_10033651
625 Ga0316579_10053351
626 Ga0316579_10096867
627 Ga0316576_10000787
628 Ga0316576_10001135
629 Ga0316576_10003059
630 Ga0316576_10003257
631 Ga0316576_10003496
632 Ga0316576_10004363
633 Ga0316576_10006862
634 Ga0316576_10012388
635 Ga0316576_10015172
636 Ga0316576_10019214
637 Ga0316576_10020039
638 Ga0316576_10110166
639 Ga0316576_10243921
640 Ga0316578_10000029
641 Ga0316578_10000804
642 Ga0316578_10000970
643 Ga0316578_10003679
644 Ga0316578_10006551
645 Ga0316578_10013147
646 Ga0316578_10032577
647 Ga0316578_10048193
648 Ga0316578_10091456
649 Ga0316578_10094400
650 Ga0316577_10000654
651 Ga0316577_10001473
652 Ga0316577_10004532
653 Ga0316577_10012103
654 Ga0316577_10016494
655 Ga0316577_10019211
656 Ga0316577_10035236
657 Ga0316577_10037156
658 Ga0316577_10046667
659 Ga0316577_10077817
660 Ga0316577_10132278
661 Ga0316583_10001064
662 Ga0316583_10001833
663 Ga0316583_10005035
664 Ga0316583_10029078
665 Ga0316583_10034623
666 Ga0316585_10000035
667 Ga0316585_10000116
668 Ga0316585_10001630
669 Ga0316585_10002514
670 Ga0316585_10013651
671 Ga0316585_10016089
672 Ga0316585_10031766
673 Ga0316585_10032766
674 Ga0316580_10000070
675 Ga0316580_10000418
676 Ga0316580_10000947
677 Ga0316580_10008291
678 Ga0316580_10054099
679 Ga0316593_10000082
680 Ga0316593_10001388
681 Ga0316593_10003226
682 Ga0316593_10014791
683 Ga0316593_10025352
684 Ga0316593_10034942
685 Ga0316593_10104895
686 Ga0316592_1000005
687 Ga0316592_1000270
688 Ga0316592_1000272
689 Ga0316592_1037970
690 Ga0316588_1000130
691 Ga0316588_1001879
692 Ga0316587_1013180
693 Ga0316596_1000125
694 Ga0316596_1000127
695 Ga0316596_1010079
696 Ga0316574_0000116
697 Ga0316574_0000298
698 Ga0316574_0000648
699 Ga0316574_0018382
700 Ga0316574_0044265
701 Ga0316574_0148195
702 Ga0316574_0349861
703 Ga0316574_0355944
704 Ga0373937_0185334
705 Ga0316582_0000363
706 Ga0316582_0001750
707 Ga0316582_0002177
708 Ga0316582_0009421
709 Ga0316582_0028338
710 Ga0316582_0034522
711 Ga0316582_0041032
712 Ga0316582_0046314
713 Ga0316582_0050985
714 Ga0316582_0124137
715 Ga0316582_0134439
716 Ga0316584_0000744
717 Ga0316584_0001073
718 Ga0316584_0003237
719 Ga0316584_0006315
720 Ga0316584_0007256
721 Ga0316584_0011925
722 Ga0316584_0014401
723 Ga0316584_0014476
724 Ga0316584_0039194
725 Ga0316584_0048900
726 Ga0316584_0058508
727 Ga0316584_0179567
728 Ga0316584_0213700
729 Ga0395899_0017913
730 Ga0395898_0280788
731 Ga0395905_0530843
732 Ga0316581_0004089
733 Ga0316581_0004304
734 Ga0316581_0016885
735 Ga0316581_0018647
736 Ga0316581_0031658
737 Ga0316581_0102472
738 Ga0400484_32133
739 Ga0400490_02970
740 Ga0400488_53472
741 Ga0400483_102738
742 Ga0400483_121927
743 Ga0400483_229392
744 Ga0400487_17883
745 Ga0400487_59796
746 Ga0436361_0841601
747 Ga0436361_0855472
748 Ga0450890_005450
749 Ga0439459_0000437
750 Ga0466969_0011855
751 Ga0466965_0010841
752 Ga0466961_0001772
753 Ga0453684_0522162
754 Ga0466960_0049085
755 Ga0466959_0013479
756 Ga0466959_0013603
757 Ga0451576_0001221
758 Ga0451576_0009050
759 Ga0451576_0009263
760 Ga0451576_0021815
761 Ga0451576_0307269
762 Ga0495641_0014222
763 Ga0495670_0021926
764 Ga0501047_0727053
765 nmdc:mga06r32_405953_c1
766 Ga0500622_0002493
767 Ga0501082_0574712
768 2644219634
769 2739054543
770 2831868639
771 2839144623
772 2842721262
773 2886852549
774 2974322645
775 2998345147
776 8001524606

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00227

Proteasome

Proteasome subunit

45

242

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nyw-assembly2.cif.gz_O anbu (ancestral beta-subunit) from yersinia bercovieri 0.9378 3 241
5nyw-assembly1.cif.gz_A anbu (ancestral beta-subunit) from yersinia bercovieri 0.9349 3 241
5nyw-assembly2.cif.gz_2 anbu (ancestral beta-subunit) from yersinia bercovieri 0.9281 3 243
5loy-assembly2.cif.gz_D helical assembly of a designed anbu protein 0.9272 3 243
5nyw-assembly2.cif.gz_1 anbu (ancestral beta-subunit) from yersinia bercovieri 0.925 3 241
ID Description Score Start End Superfamily
5fmgX00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.7739 3 214 3.60.20.10
af_Q966I8_19_219_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.767 2 217 3.60.20.10
5fmgX00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.7592 3 214 3.60.20.10
af_A4HV47_25_244_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.7538 2 213 3.60.20.10
af_Q8T915_50_270_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.7456 3 243 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A2N3E885-F1-model_v4 Peptidase 0.9951 163 243
AF-A0A2M7FWY5-F1-model_v4 Peptidase 0.9844 169 243
AF-A0A3D5URQ7-F1-model_v4 Peptidase 0.9836 132 243
AF-H1S9T8-F1-model_v4 Putative proteasome-type protease 0.9796 164 243 GO:0000502
GO:0006508
GO:0008233
AF-A0A258Q1V9-F1-model_v4 deleted 0.9792 133 243

Map