F431171

General Info

Members Datasets Scaffolds Average Seq Length
388 215 776 226

Family's Representative Sequence

Representative Sequence 3300032133|Ga0316583_10035823|Ga0316583_100358233
Length 251
Sequence VREVSTETGRLPADGVRRMFDRIAPVYDLMNRVMTAGLDRRWRAVTVAEAVKPGDRVLDACCGTGDLALAALRGGAGSVVGLDFSERMLERARAKAPAVEWLQGDVLALPFEDASFDAATVGFGVRNVEDLEAGLRELRRVLRTDGRLAILEITTPRGALAPFYRLWFDRAIPLLGRILPGGAAYTYLPASVRRFPEPEALAELMTRVGFARVRFRRFAGGIVALHVGEGHGQRLDGAHRQGVETPASPGS

Samples

Sample ID Description Type Environment
1 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
136 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
137 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
138 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
139 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
140 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 3.09
Rhizosphere 94.59
Stem 0
Stem Tuber 0
Unclassified 12.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316583_10035823 3300032133 Bacteria 1762
2 2214776356 2209111006 Bacteria 778
3 ARSoilOldRDRAFT_c002598 3300000044 Bacteria 1583
4 Ga0070676_10545517 3300005328 Bacteria 829
5 Ga0070690_100134515 3300005330 Bacteria 1673
6 Ga0070670_100001190 3300005331 Bacteria 20633
7 Ga0070670_100048004 3300005331 Bacteria 3674
8 Ga0070666_10637596 3300005335 Bacteria 779
9 Ga0070682_100049622 3300005337 Bacteria 2617
10 Ga0068868_100004000 3300005338 Bacteria 10290
11 Ga0068868_100130270 3300005338 Unclassified 2058
12 Ga0068868_100831998 3300005338 Bacteria 835
13 Ga0070660_100128453 3300005339 Bacteria 2027
14 Ga0070689_100042016 3300005340 Bacteria 3510
15 Ga0070689_100068218 3300005340 Unclassified 2774
16 Ga0070691_10010220 3300005341 Bacteria 4279
17 Ga0070692_10099562 3300005345 Unclassified 1592
18 Ga0070692_10100081 3300005345 Bacteria 1588
19 Ga0070675_100089117 3300005354 Bacteria 2583
20 Ga0070675_100092118 3300005354 Bacteria 2540
21 Ga0070675_100359892 3300005354 Unclassified 1292
22 Ga0070671_100033610 3300005355 Bacteria 4243
23 Ga0070674_100021698 3300005356 Bacteria 4129
24 Ga0070674_100039196 3300005356 Bacteria 3198
25 Ga0070674_100315139 3300005356 Unclassified 1252
26 Ga0070673_100094903 3300005364 Bacteria 2446
27 Ga0070688_100030512 3300005365 Bacteria 3236
28 Ga0070688_100081758 3300005365 Bacteria 2093
29 Ga0070659_100198695 3300005366 Bacteria 1650
30 Ga0070709_10063834 3300005434 Bacteria 2353
31 Ga0070714_100072410 3300005435 Bacteria 2983
32 Ga0070701_10013742 3300005438 Bacteria 3691
33 Ga0070705_100434528 3300005440 Bacteria 981
34 Ga0070700_100022889 3300005441 Bacteria 3650
35 Ga0070700_100120292 3300005441 Bacteria 1758
36 Ga0070700_100476159 3300005441 Bacteria 955
37 Ga0070708_100189886 3300005445 Bacteria 1921
38 Ga0070678_100023121 3300005456 Bacteria 4136
39 Ga0070678_100035727 3300005456 Bacteria 3473
40 Ga0070678_100147089 3300005456 Bacteria 1893
41 Ga0070662_100232726 3300005457 Bacteria 1474
42 Ga0070662_100566271 3300005457 Unclassified 953
43 Ga0070681_10696712 3300005458 Bacteria 931
44 Ga0068867_100083124 3300005459 Bacteria 2417
45 Ga0068867_100318475 3300005459 Unclassified 1288
46 Ga0070685_10001337 3300005466 Bacteria 12948
47 Ga0070707_100053170 3300005468 Bacteria 3882
48 Ga0070707_100059264 3300005468 Bacteria 3673
49 Ga0070698_100308668 3300005471 Bacteria 1513
50 Ga0070698_100785114 3300005471 Unclassified 896
51 Ga0070699_100181362 3300005518 Bacteria 1868
52 Ga0070679_100098719 3300005530 Bacteria 2907
53 Ga0070684_100051774 3300005535 Bacteria 3568
54 Ga0070684_100126937 3300005535 Bacteria 2298
55 Ga0070684_100397411 3300005535 Bacteria 1270
56 Ga0070672_100124338 3300005543 Unclassified 2114
57 Ga0070686_100031364 3300005544 Unclassified 3248
58 Ga0070696_100049472 3300005546 Bacteria 2920
59 Ga0070665_100078111 3300005548 Bacteria 3316
60 Ga0070704_100699226 3300005549 Bacteria 899
61 Ga0068855_100689164 3300005563 Bacteria 1094
62 Ga0070664_100028337 3300005564 Bacteria 4658
63 Ga0068857_100021012 3300005577 Bacteria 5744
64 Ga0068857_100098764 3300005577 Bacteria 2619
65 Ga0068857_100296420 3300005577 Bacteria 1490
66 Ga0068856_100033428 3300005614 Bacteria 5035
67 Ga0070702_100079323 3300005615 Bacteria 1962
68 Ga0070702_100156392 3300005615 Bacteria 1469
69 Ga0068859_100126538 3300005617 Bacteria 2624
70 Ga0068864_100172589 3300005618 Bacteria 1972
71 Ga0068861_100056676 3300005719 Bacteria 2992
72 Ga0068861_100138782 3300005719 Bacteria 1982
73 Ga0068870_10004338 3300005840 Bacteria 6106
74 Ga0068870_10011688 3300005840 Bacteria 4080
75 Ga0068870_10197081 3300005840 Bacteria 1219
76 Ga0068863_100561613 3300005841 Archaea 1127
77 Ga0068858_100179755 3300005842 Unclassified 1997
78 Ga0068860_100316290 3300005843 Bacteria 1532
79 Ga0081455_10006824 3300005937 Bacteria 12170
80 Ga0081455_10243030 3300005937 Bacteria 1321
81 Ga0070717_10014727 3300006028 Bacteria 6016
82 Ga0075365_10132758 3300006038 Bacteria 1724
83 Ga0075365_10333860 3300006038 Bacteria 1068
84 Ga0075364_10005764 3300006051 Bacteria 7225
85 Ga0075432_10010570 3300006058 Bacteria 3134
86 Ga0075432_10023525 3300006058 Bacteria 2110
87 Ga0075427_10010780 3300006194 Bacteria 1372
88 Ga0097621_100647877 3300006237 Bacteria 969
89 Ga0075370_10064072 3300006353 Bacteria 2096
90 Ga0075428_100002419 3300006844 Bacteria 20291
91 Ga0075428_100005689 3300006844 Bacteria 13858
92 Ga0075428_100048051 3300006844 Bacteria 4685
93 Ga0075428_100181993 3300006844 Bacteria 2274
94 Ga0075428_100528533 3300006844 Bacteria 1261
95 Ga0075428_100810516 3300006844 Bacteria 995
96 Ga0075430_100004839 3300006846 Bacteria 11334
97 Ga0075430_100091002 3300006846 Bacteria 2551
98 Ga0075430_100311578 3300006846 Bacteria 1302
99 Ga0075430_100345619 3300006846 Unclassified 1229
100 Ga0075431_100002834 3300006847 Bacteria 16774
101 Ga0075431_100105464 3300006847 Bacteria 2908
102 Ga0075431_100140212 3300006847 Unclassified 2492
103 Ga0075431_100563281 3300006847 Bacteria 1126
104 Ga0075433_10003637 3300006852 Bacteria 11914
105 Ga0075433_10140342 3300006852 Bacteria 2148
106 Ga0075434_100005136 3300006871 Bacteria 11887
107 Ga0075434_100444253 3300006871 Bacteria 1318
108 Ga0075429_100248418 3300006880 Bacteria 1558
109 Ga0075429_100264369 3300006880 Bacteria 1506
110 Ga0075429_100269855 3300006880 Unclassified 1490
111 Ga0068865_100087277 3300006881 Unclassified 2254
112 Ga0075436_100115274 3300006914 Bacteria 1877
113 Ga0097620_100126538 3300006931 Bacteria 2624
114 Ga0075435_100041873 3300007076 Bacteria 3662
115 Ga0075435_100491113 3300007076 Bacteria 1061
116 Ga0111539_10006004 3300009094 Bacteria 15692
117 Ga0111539_10082985 3300009094 Bacteria 3769
118 Ga0111539_10394553 3300009094 Bacteria 1612
119 Ga0111539_10988595 3300009094 Bacteria 978
120 Ga0111539_11009608 3300009094 Bacteria 967
121 Ga0111539_11647073 3300009094 Unclassified 744
122 Ga0105245_10010821 3300009098 Bacteria 7937
123 Ga0105245_10044686 3300009098 Bacteria 3955
124 Ga0105245_10047370 3300009098 Bacteria 3843
125 Ga0105245_10061295 3300009098 Unclassified 3390
126 Ga0114129_10007212 3300009147 Bacteria 15822
127 Ga0114129_10009551 3300009147 Bacteria 13837
128 Ga0114129_10035139 3300009147 Bacteria 7081
129 Ga0114129_10055571 3300009147 Bacteria 5547
130 Ga0114129_10144567 3300009147 Bacteria 3258
131 Ga0114129_10308566 3300009147 Bacteria 2107
132 Ga0114129_10446061 3300009147 Bacteria 1698
133 Ga0114129_10759386 3300009147 Bacteria 1241
134 Ga0114129_10995580 3300009147 Bacteria 1056
135 Ga0114129_11004260 3300009147 Bacteria 1051
136 Ga0105243_10266369 3300009148 Bacteria 1536
137 Ga0105243_10483684 3300009148 Bacteria 1169
138 Ga0105242_10097773 3300009176 Unclassified 2482
139 Ga0105242_10376512 3300009176 Bacteria 1318
140 Ga0105242_10569423 3300009176 Bacteria 1089
141 Ga0105248_10785896 3300009177 Bacteria 1074
142 Ga0105249_10064249 3300009553 Bacteria 3374
143 Ga0105249_10380447 3300009553 Bacteria 1437
144 Ga0105239_10636301 3300010375 Bacteria 1218
145 Ga0105239_10974867 3300010375 Bacteria 974
146 Ga0105239_11141067 3300010375 Unclassified 898
147 Ga0105246_10004777 3300011119 Bacteria 8249
148 Ga0105246_10090482 3300011119 Bacteria 2204
149 Ga0105246_10117447 3300011119 Bacteria 1965
150 Ga0105246_10617354 3300011119 Bacteria 939
151 Ga0105246_10636062 3300011119 Bacteria 927
152 Ga0157369_10639847 3300013105 Bacteria 1097
153 Ga0157375_10056097 3300013308 Bacteria 3887
154 Ga0157375_10289001 3300013308 Unclassified 1802
155 Ga0163163_10013088 3300014325 Bacteria 7579
156 Ga0163163_10352330 3300014325 Bacteria 1528
157 Ga0157380_10085557 3300014326 Unclassified 2588
158 Ga0157380_10473771 3300014326 Bacteria 1209
159 Ga0157377_10010355 3300014745 Bacteria 4610
160 Ga0157377_10046913 3300014745 Bacteria 2418
161 Ga0157379_10093795 3300014968 Bacteria 2693
162 Ga0157376_10128632 3300014969 Unclassified 2257
163 Ga0213871_10017307 3300021441 Bacteria 1750
164 Ga0207688_10054591 3300025901 Bacteria 2242
165 Ga0207688_10178825 3300025901 Bacteria 1265
166 Ga0207699_10061793 3300025906 Bacteria 2255
167 Ga0207643_10006332 3300025908 Bacteria 6338
168 Ga0207643_10029049 3300025908 Bacteria 3075
169 Ga0207643_10063933 3300025908 Bacteria 2106
170 Ga0207693_10305229 3300025915 Bacteria 1246
171 Ga0207657_10247455 3300025919 Bacteria 1422
172 Ga0207646_10039682 3300025922 Bacteria 4236
173 Ga0207646_10062596 3300025922 Bacteria 3322
174 Ga0207650_10064076 3300025925 Bacteria 2750
175 Ga0207650_10182171 3300025925 Bacteria 1674
176 Ga0207687_10049661 3300025927 Bacteria 2918
177 Ga0207687_10204059 3300025927 Unclassified 1547
178 Ga0207690_10088379 3300025932 Bacteria 2183
179 Ga0207706_10124394 3300025933 Bacteria 2269
180 Ga0207686_10074819 3300025934 Unclassified 2190
181 Ga0207709_10048298 3300025935 Unclassified 2592
182 Ga0207709_10141085 3300025935 Bacteria 1656
183 Ga0207669_10013709 3300025937 Bacteria 4038
184 Ga0207669_10036380 3300025937 Bacteria 2813
185 Ga0207669_10233360 3300025937 Bacteria 1359
186 Ga0207704_10099994 3300025938 Unclassified 1930
187 Ga0207691_10045221 3300025940 Bacteria 4048
188 Ga0207691_10069860 3300025940 Bacteria 3172
189 Ga0207711_10025332 3300025941 Bacteria 4977
190 Ga0207679_10162331 3300025945 Unclassified 1830
191 Ga0207651_10030904 3300025960 Bacteria 3417
192 Ga0207712_10222129 3300025961 Bacteria 1511
193 Ga0207677_10125143 3300026023 Unclassified 1941
194 Ga0207677_10414290 3300026023 Bacteria 1146
195 Ga0207708_10048767 3300026075 Bacteria 3224
196 Ga0207708_10104947 3300026075 Unclassified 2190
197 Ga0207648_10088235 3300026089 Unclassified 2708
198 Ga0207648_10106564 3300026089 Bacteria 2460
199 Ga0207676_10178289 3300026095 Bacteria 1858
200 Ga0207674_10017344 3300026116 Bacteria 7856
201 Ga0207674_10431461 3300026116 Unclassified 1274
202 Ga0207674_10584960 3300026116 Bacteria 1078
203 Ga0207675_100033529 3300026118 Bacteria 4785
204 Ga0207675_100091931 3300026118 Bacteria 2853
205 Ga0207683_10005180 3300026121 Bacteria 11193
206 Ga0207683_10181288 3300026121 Bacteria 1910
207 Ga0207683_10265481 3300026121 Bacteria 1568
208 Ga0207428_10001019 3300027907 Bacteria 31027
209 Ga0207428_10004534 3300027907 Bacteria 13175
210 Ga0207428_10015672 3300027907 Bacteria 6549
211 Ga0268266_10199191 3300028379 Unclassified 1832
212 Ga0265319_1033271 3300028563 Bacteria 1782
213 Ga0265336_10001834 3300028666 Bacteria 9253
214 Ga0265338_10019636 3300028800 Bacteria 7153
215 Ga0265338_10029615 3300028800 Bacteria 5420
216 Ga0265338_10039071 3300028800 Bacteria 4484
217 Ga0265327_10029471 3300031251 Bacteria 3122
218 Ga0265327_10073342 3300031251 Bacteria 1707
219 Ga0307408_100045535 3300031548 Bacteria 3134
220 Ga0265313_10009729 3300031595 Bacteria 6198
221 Ga0307405_10011984 3300031731 Bacteria 4568
222 Ga0307413_10004621 3300031824 Bacteria 6019
223 Ga0307409_100002713 3300031995 Bacteria 9345
224 Ga0307409_101266346 3300031995 Bacteria 762
225 Ga0307416_100017743 3300032002 Bacteria 4990
226 Ga0307416_100427447 3300032002 Bacteria 1371
227 Ga0307414_10032019 3300032004 Bacteria 3457
228 Ga0307415_100006868 3300032126 Bacteria 6179
229 Ga0373937_0452572 3300036401 Unclassified 1219
230 Ga0395899_0004709 3300037312 Bacteria 10642
231 Ga0395899_0022428 3300037312 Bacteria 4788
232 Ga0395899_0118317 3300037312 Bacteria 1900
233 Ga0395900_0025797 3300037418 Bacteria 6015
234 Ga0395900_0027359 3300037418 Bacteria 5840
235 Ga0395900_0124757 3300037418 Bacteria 2641
236 Ga0395900_0301909 3300037418 Bacteria 1587
237 Ga0395900_0690609 3300037418 Unclassified 955
238 Ga0395898_0028986 3300037466 Bacteria 5547
239 Ga0395898_0597509 3300037466 Bacteria 1046
240 Ga0395898_0633831 3300037466 Bacteria 1011
241 Ga0395905_0025094 3300037471 Bacteria 5622
242 Ga0395905_0455414 3300037471 Bacteria 1178
243 Ga0395905_0491701 3300037471 Bacteria 1127
244 Ga0395905_1083681 3300037471 Unclassified 704
245 Ga0395901_0089485 3300038443 Bacteria 3221
246 Ga0395901_0503105 3300038443 Bacteria 1233
247 Ga0395901_0596424 3300038443 Bacteria 1114
248 Ga0436360_1011292 3300039438 Bacteria 4080
249 Ga0451833_1400516 3300041491 Unclassified 991
250 Ga0451835_0036970 3300041492 Bacteria 2928
251 Ga0451847_0824102 3300041503 Bacteria 1765
252 Ga0451855_1143191 3300041511 Bacteria 1647
253 Ga0450915_001094 3300042119 Unclassified 1194
254 Ga0450920_008471 3300042122 Bacteria 1880
255 Ga0466972_0210940 3300044658 Bacteria 909
256 Ga0466965_0205842 3300044683 Bacteria 1045
257 Ga0466961_0002876 3300044693 Bacteria 10682
258 Ga0466963_0002540 3300044694 Bacteria 10221
259 Ga0466963_0055073 3300044694 Bacteria 2644
260 Ga0466964_0058805 3300044706 Bacteria 1594
261 Ga0466968_0019646 3300044735 Bacteria 2721
262 Ga0466968_0037821 3300044735 Bacteria 2026
263 Ga0466957_0080879 3300044842 Bacteria 2023
264 Ga0466960_0001940 3300044901 Bacteria 7647
265 Ga0466958_0033356 3300045836 Bacteria 3067
266 Ga0466958_0103576 3300045836 Bacteria 1772
267 Ga0466967_0025752 3300045976 Bacteria 4854
268 Ga0495592_0005957 3300046454 Bacteria 9058
269 Ga0495651_0136326 3300046462 Unclassified 1785
270 Ga0495664_0033214 3300046477 Bacteria 3032
271 Ga0495620_0053360 3300046515 Bacteria 1712
272 Ga0495628_0084770 3300046516 Bacteria 2458
273 Ga0495628_0353318 3300046516 Bacteria 1080
274 Ga0495663_0070277 3300046525 Bacteria 1114
275 Ga0495652_0132679 3300046529 Bacteria 1969
276 Ga0495587_0049932 3300046536 Bacteria 2475
277 Ga0495645_0207349 3300046543 Bacteria 1325
278 Ga0495659_0044544 3300046664 Bacteria 1596
279 Ga0495659_0096262 3300046664 Unclassified 1142
280 Ga0495657_0200697 3300046675 Bacteria 1216
281 Ga0495657_0424019 3300046675 Bacteria 781
282 Ga0495599_0231690 3300046678 Bacteria 1127
283 Ga0495623_0048761 3300046679 Bacteria 2685
284 Ga0495624_0010063 3300046690 Bacteria 6526
285 Ga0495660_0105948 3300046810 Bacteria 1441
286 Ga0495674_0047392 3300047319 Bacteria 3812
287 Ga0495676_0328026 3300047321 Bacteria 1027
288 Ga0495680_0100681 3300047322 Bacteria 2153
289 Ga0495680_0452792 3300047322 Bacteria 878
290 Ga0495684_0170137 3300047471 Bacteria 1621
291 Ga0495684_0618891 3300047471 Bacteria 728
292 Ga0495626_0096969 3300048091 Bacteria 1290
293 Ga0496100_0050820 3300048903 Bacteria 2688
294 Ga0496100_0630237 3300048903 Archaea 834
295 Ga0496103_0002645 3300048906 Bacteria 11207
296 Ga0496107_0531431 3300048910 Bacteria 872
297 Ga0496108_0216623 3300048911 Unclassified 1663
298 Ga0496109_0100036 3300048912 Bacteria 2690
299 Ga0496109_0152992 3300048912 Unclassified 2160
300 Ga0496109_0254156 3300048912 Bacteria 1655
301 Ga0496109_0305621 3300048912 Bacteria 1500
302 Ga0496109_0464207 3300048912 Bacteria 1196
303 Ga0496110_0070936 3300048913 Bacteria 3088
304 Ga0496114_0000923 3300048917 Bacteria 21968
305 Ga0501031_0175127 3300049568 Bacteria 1401
306 Ga0501031_0402181 3300049568 Bacteria 886
307 Ga0501036_0003342 3300049572 Bacteria 12817
308 Ga0501037_0080152 3300049573 Bacteria 2369
309 Ga0501037_0203546 3300049573 Bacteria 1398
310 Ga0501039_0036023 3300049575 Bacteria 3817
311 Ga0501039_0067929 3300049575 Bacteria 2767
312 Ga0501039_0655717 3300049575 Bacteria 822
313 Ga0501040_0047488 3300049576 Bacteria 2932
314 Ga0501040_0079754 3300049576 Bacteria 2266
315 Ga0501041_0035665 3300049577 Bacteria 3013
316 Ga0501042_0028954 3300049578 Bacteria 3906
317 Ga0501042_0287929 3300049578 Bacteria 1187
318 Ga0501046_0159742 3300049580 Bacteria 1696
319 Ga0501046_0235949 3300049580 Bacteria 1350
320 Ga0501048_0205287 3300049582 Unclassified 1397
321 Ga0501067_0029984 3300049583 Bacteria 3016
322 Ga0501067_0116443 3300049583 Bacteria 1486
323 Ga0501068_0056543 3300049584 Bacteria 2379
324 Ga0501068_0243265 3300049584 Bacteria 1145
325 Ga0501069_0065394 3300049585 Bacteria 2033
326 Ga0501071_0017345 3300049587 Bacteria 4963
327 Ga0501071_0059707 3300049587 Bacteria 2760
328 Ga0501071_0081928 3300049587 Bacteria 2362
329 Ga0501071_0720972 3300049587 Unclassified 768
330 Ga0501072_0030125 3300049588 Bacteria 4242
331 Ga0501072_0043562 3300049588 Bacteria 3527
332 Ga0501072_0651544 3300049588 Bacteria 829
333 Ga0501075_0016865 3300049591 Bacteria 5266
334 Ga0501075_0149441 3300049591 Bacteria 1781
335 Ga0501075_0166256 3300049591 Bacteria 1683
336 Ga0501076_0017835 3300049592 Bacteria 5398
337 Ga0501076_0070445 3300049592 Bacteria 2795
338 Ga0501076_0073982 3300049592 Bacteria 2728
339 Ga0501077_0079654 3300049593 Bacteria 2075
340 Ga0501079_0010538 3300049741 Bacteria 7028
341 Ga0501079_0056958 3300049741 Bacteria 3016
342 Ga0501080_0043303 3300049742 Bacteria 4192
343 Ga0501080_0531575 3300049742 Bacteria 1048
344 Ga0501081_0255323 3300049743 Bacteria 1280
345 Ga0501081_0638921 3300049743 Bacteria 798
346 Ga0501044_0130631 3300049823 Bacteria 2506
347 Ga0501045_0019226 3300049824 Bacteria 4866
348 Ga0501045_0095086 3300049824 Bacteria 2204
349 nmdc:mga0yw44_45971_c1 3300050492 Bacteria 2620
350 nmdc:mga05p37_1231598_c1 3300050507 Bacteria 770
351 nmdc:mga05p37_12526_c2 3300050507 Bacteria 7351
352 nmdc:mga05p37_2220_c1 3300050507 Bacteria 19240
353 nmdc:mga05p37_222389_c1 3300050507 Bacteria 2278
354 nmdc:mga05p37_284457_c1 3300050507 Bacteria 1971
355 nmdc:mga05p37_338284_c1 3300050507 Unclassified 1776
356 nmdc:mga05p37_462026_c1 3300050507 Bacteria 1467
357 nmdc:mga05p37_831128_c1 3300050507 Bacteria 1006
358 nmdc:mga05p37_9033_c1 3300050507 Bacteria 11787
359 nmdc:mga09592_185818_c1 3300050508 Bacteria 1798
360 nmdc:mga09592_50414_c1 3300050508 Bacteria 3511
361 nmdc:mga0qj67_378193_c1 3300050509 Unclassified 1144
362 nmdc:mga06r32_395492_c1 3300050510 Unclassified 1364
363 nmdc:mga06r32_599130_c1 3300050510 Bacteria 1073
364 nmdc:mga06r32_76390_c1 3300050510 Bacteria 3253
365 nmdc:mga08y16_135001_c1 3300050511 Bacteria 2564
366 nmdc:mga08y16_295662_c1 3300050511 Bacteria 1669
367 nmdc:mga08y16_556209_c1 3300050511 Bacteria 1161
368 nmdc:mga08y16_72139_c1 3300050511 Bacteria 3598
369 nmdc:mga08y16_74758_c1 3300050511 Bacteria 3532
370 nmdc:mga08y16_950328_c1 3300050511 Bacteria 843
371 nmdc:mga0n895_176262_c1 3300050512 Bacteria 2169
372 nmdc:mga0rr50_388340_c1 3300050513 Bacteria 1178
373 nmdc:mga0rr50_74964_c1 3300050513 Bacteria 2592
374 nmdc:mga08x19_113772_c1 3300050514 Bacteria 1807
375 nmdc:mga0a205_129130_c1 3300050515 Bacteria 2428
376 nmdc:mga0a205_2238_c1 3300050515 Bacteria 17045
377 nmdc:mga0a205_528669_c1 3300050515 Unclassified 1035
378 Ga0495601_0033021 3300053077 Bacteria 3223
379 Ga0495595_0040767 3300053084 Bacteria 2122
380 Ga0495619_0027566 3300053085 Bacteria 3659
381 Ga0495619_0079452 3300053085 Bacteria 2206
382 Ga0495619_0546218 3300053085 Bacteria 795
383 Ga0501084_0004416 3300054114 Bacteria 11476
384 Ga0501082_0043146 3300060353 Bacteria 3888
385 Ga0501082_0043897 3300060353 Bacteria 3856
386 Ga0501082_0252259 3300060353 Bacteria 1535
387 Ga0530510_0033054 3300061734 Bacteria 3723
388 Ga0530510_0097876 3300061734 Bacteria 2145
389 Ga0316583_10035823
390 2214776356
391 ARSoilOldRDRAFT_c002598
392 Ga0070676_10545517
393 Ga0070690_100134515
394 Ga0070670_100001190
395 Ga0070670_100048004
396 Ga0070666_10637596
397 Ga0070682_100049622
398 Ga0068868_100004000
399 Ga0068868_100130270
400 Ga0068868_100831998
401 Ga0070660_100128453
402 Ga0070689_100042016
403 Ga0070689_100068218
404 Ga0070691_10010220
405 Ga0070692_10099562
406 Ga0070692_10100081
407 Ga0070675_100089117
408 Ga0070675_100092118
409 Ga0070675_100359892
410 Ga0070671_100033610
411 Ga0070674_100021698
412 Ga0070674_100039196
413 Ga0070674_100315139
414 Ga0070673_100094903
415 Ga0070688_100030512
416 Ga0070688_100081758
417 Ga0070659_100198695
418 Ga0070709_10063834
419 Ga0070714_100072410
420 Ga0070701_10013742
421 Ga0070705_100434528
422 Ga0070700_100022889
423 Ga0070700_100120292
424 Ga0070700_100476159
425 Ga0070708_100189886
426 Ga0070678_100023121
427 Ga0070678_100035727
428 Ga0070678_100147089
429 Ga0070662_100232726
430 Ga0070662_100566271
431 Ga0070681_10696712
432 Ga0068867_100083124
433 Ga0068867_100318475
434 Ga0070685_10001337
435 Ga0070707_100053170
436 Ga0070707_100059264
437 Ga0070698_100308668
438 Ga0070698_100785114
439 Ga0070699_100181362
440 Ga0070679_100098719
441 Ga0070684_100051774
442 Ga0070684_100126937
443 Ga0070684_100397411
444 Ga0070672_100124338
445 Ga0070686_100031364
446 Ga0070696_100049472
447 Ga0070665_100078111
448 Ga0070704_100699226
449 Ga0068855_100689164
450 Ga0070664_100028337
451 Ga0068857_100021012
452 Ga0068857_100098764
453 Ga0068857_100296420
454 Ga0068856_100033428
455 Ga0070702_100079323
456 Ga0070702_100156392
457 Ga0068859_100126538
458 Ga0068864_100172589
459 Ga0068861_100056676
460 Ga0068861_100138782
461 Ga0068870_10004338
462 Ga0068870_10011688
463 Ga0068870_10197081
464 Ga0068863_100561613
465 Ga0068858_100179755
466 Ga0068860_100316290
467 Ga0081455_10006824
468 Ga0081455_10243030
469 Ga0070717_10014727
470 Ga0075365_10132758
471 Ga0075365_10333860
472 Ga0075364_10005764
473 Ga0075432_10010570
474 Ga0075432_10023525
475 Ga0075427_10010780
476 Ga0097621_100647877
477 Ga0075370_10064072
478 Ga0075428_100002419
479 Ga0075428_100005689
480 Ga0075428_100048051
481 Ga0075428_100181993
482 Ga0075428_100528533
483 Ga0075428_100810516
484 Ga0075430_100004839
485 Ga0075430_100091002
486 Ga0075430_100311578
487 Ga0075430_100345619
488 Ga0075431_100002834
489 Ga0075431_100105464
490 Ga0075431_100140212
491 Ga0075431_100563281
492 Ga0075433_10003637
493 Ga0075433_10140342
494 Ga0075434_100005136
495 Ga0075434_100444253
496 Ga0075429_100248418
497 Ga0075429_100264369
498 Ga0075429_100269855
499 Ga0068865_100087277
500 Ga0075436_100115274
501 Ga0097620_100126538
502 Ga0075435_100041873
503 Ga0075435_100491113
504 Ga0111539_10006004
505 Ga0111539_10082985
506 Ga0111539_10394553
507 Ga0111539_10988595
508 Ga0111539_11009608
509 Ga0111539_11647073
510 Ga0105245_10010821
511 Ga0105245_10044686
512 Ga0105245_10047370
513 Ga0105245_10061295
514 Ga0114129_10007212
515 Ga0114129_10009551
516 Ga0114129_10035139
517 Ga0114129_10055571
518 Ga0114129_10144567
519 Ga0114129_10308566
520 Ga0114129_10446061
521 Ga0114129_10759386
522 Ga0114129_10995580
523 Ga0114129_11004260
524 Ga0105243_10266369
525 Ga0105243_10483684
526 Ga0105242_10097773
527 Ga0105242_10376512
528 Ga0105242_10569423
529 Ga0105248_10785896
530 Ga0105249_10064249
531 Ga0105249_10380447
532 Ga0105239_10636301
533 Ga0105239_10974867
534 Ga0105239_11141067
535 Ga0105246_10004777
536 Ga0105246_10090482
537 Ga0105246_10117447
538 Ga0105246_10617354
539 Ga0105246_10636062
540 Ga0157369_10639847
541 Ga0157375_10056097
542 Ga0157375_10289001
543 Ga0163163_10013088
544 Ga0163163_10352330
545 Ga0157380_10085557
546 Ga0157380_10473771
547 Ga0157377_10010355
548 Ga0157377_10046913
549 Ga0157379_10093795
550 Ga0157376_10128632
551 Ga0213871_10017307
552 Ga0207688_10054591
553 Ga0207688_10178825
554 Ga0207699_10061793
555 Ga0207643_10006332
556 Ga0207643_10029049
557 Ga0207643_10063933
558 Ga0207693_10305229
559 Ga0207657_10247455
560 Ga0207646_10039682
561 Ga0207646_10062596
562 Ga0207650_10064076
563 Ga0207650_10182171
564 Ga0207687_10049661
565 Ga0207687_10204059
566 Ga0207690_10088379
567 Ga0207706_10124394
568 Ga0207686_10074819
569 Ga0207709_10048298
570 Ga0207709_10141085
571 Ga0207669_10013709
572 Ga0207669_10036380
573 Ga0207669_10233360
574 Ga0207704_10099994
575 Ga0207691_10045221
576 Ga0207691_10069860
577 Ga0207711_10025332
578 Ga0207679_10162331
579 Ga0207651_10030904
580 Ga0207712_10222129
581 Ga0207677_10125143
582 Ga0207677_10414290
583 Ga0207708_10048767
584 Ga0207708_10104947
585 Ga0207648_10088235
586 Ga0207648_10106564
587 Ga0207676_10178289
588 Ga0207674_10017344
589 Ga0207674_10431461
590 Ga0207674_10584960
591 Ga0207675_100033529
592 Ga0207675_100091931
593 Ga0207683_10005180
594 Ga0207683_10181288
595 Ga0207683_10265481
596 Ga0207428_10001019
597 Ga0207428_10004534
598 Ga0207428_10015672
599 Ga0268266_10199191
600 Ga0265319_1033271
601 Ga0265336_10001834
602 Ga0265338_10019636
603 Ga0265338_10029615
604 Ga0265338_10039071
605 Ga0265327_10029471
606 Ga0265327_10073342
607 Ga0307408_100045535
608 Ga0265313_10009729
609 Ga0307405_10011984
610 Ga0307413_10004621
611 Ga0307409_100002713
612 Ga0307409_101266346
613 Ga0307416_100017743
614 Ga0307416_100427447
615 Ga0307414_10032019
616 Ga0307415_100006868
617 Ga0373937_0452572
618 Ga0395899_0004709
619 Ga0395899_0022428
620 Ga0395899_0118317
621 Ga0395900_0025797
622 Ga0395900_0027359
623 Ga0395900_0124757
624 Ga0395900_0301909
625 Ga0395900_0690609
626 Ga0395898_0028986
627 Ga0395898_0597509
628 Ga0395898_0633831
629 Ga0395905_0025094
630 Ga0395905_0455414
631 Ga0395905_0491701
632 Ga0395905_1083681
633 Ga0395901_0089485
634 Ga0395901_0503105
635 Ga0395901_0596424
636 Ga0436360_1011292
637 Ga0451833_1400516
638 Ga0451835_0036970
639 Ga0451847_0824102
640 Ga0451855_1143191
641 Ga0450915_001094
642 Ga0450920_008471
643 Ga0466972_0210940
644 Ga0466965_0205842
645 Ga0466961_0002876
646 Ga0466963_0002540
647 Ga0466963_0055073
648 Ga0466964_0058805
649 Ga0466968_0019646
650 Ga0466968_0037821
651 Ga0466957_0080879
652 Ga0466960_0001940
653 Ga0466958_0033356
654 Ga0466958_0103576
655 Ga0466967_0025752
656 Ga0495592_0005957
657 Ga0495651_0136326
658 Ga0495664_0033214
659 Ga0495620_0053360
660 Ga0495628_0084770
661 Ga0495628_0353318
662 Ga0495663_0070277
663 Ga0495652_0132679
664 Ga0495587_0049932
665 Ga0495645_0207349
666 Ga0495659_0044544
667 Ga0495659_0096262
668 Ga0495657_0200697
669 Ga0495657_0424019
670 Ga0495599_0231690
671 Ga0495623_0048761
672 Ga0495624_0010063
673 Ga0495660_0105948
674 Ga0495674_0047392
675 Ga0495676_0328026
676 Ga0495680_0100681
677 Ga0495680_0452792
678 Ga0495684_0170137
679 Ga0495684_0618891
680 Ga0495626_0096969
681 Ga0496100_0050820
682 Ga0496100_0630237
683 Ga0496103_0002645
684 Ga0496107_0531431
685 Ga0496108_0216623
686 Ga0496109_0100036
687 Ga0496109_0152992
688 Ga0496109_0254156
689 Ga0496109_0305621
690 Ga0496109_0464207
691 Ga0496110_0070936
692 Ga0496114_0000923
693 Ga0501031_0175127
694 Ga0501031_0402181
695 Ga0501036_0003342
696 Ga0501037_0080152
697 Ga0501037_0203546
698 Ga0501039_0036023
699 Ga0501039_0067929
700 Ga0501039_0655717
701 Ga0501040_0047488
702 Ga0501040_0079754
703 Ga0501041_0035665
704 Ga0501042_0028954
705 Ga0501042_0287929
706 Ga0501046_0159742
707 Ga0501046_0235949
708 Ga0501048_0205287
709 Ga0501067_0029984
710 Ga0501067_0116443
711 Ga0501068_0056543
712 Ga0501068_0243265
713 Ga0501069_0065394
714 Ga0501071_0017345
715 Ga0501071_0059707
716 Ga0501071_0081928
717 Ga0501071_0720972
718 Ga0501072_0030125
719 Ga0501072_0043562
720 Ga0501072_0651544
721 Ga0501075_0016865
722 Ga0501075_0149441
723 Ga0501075_0166256
724 Ga0501076_0017835
725 Ga0501076_0070445
726 Ga0501076_0073982
727 Ga0501077_0079654
728 Ga0501079_0010538
729 Ga0501079_0056958
730 Ga0501080_0043303
731 Ga0501080_0531575
732 Ga0501081_0255323
733 Ga0501081_0638921
734 Ga0501044_0130631
735 Ga0501045_0019226
736 Ga0501045_0095086
737 nmdc:mga0yw44_45971_c1
738 nmdc:mga05p37_1231598_c1
739 nmdc:mga05p37_12526_c2
740 nmdc:mga05p37_2220_c1
741 nmdc:mga05p37_222389_c1
742 nmdc:mga05p37_284457_c1
743 nmdc:mga05p37_338284_c1
744 nmdc:mga05p37_462026_c1
745 nmdc:mga05p37_831128_c1
746 nmdc:mga05p37_9033_c1
747 nmdc:mga09592_185818_c1
748 nmdc:mga09592_50414_c1
749 nmdc:mga0qj67_378193_c1
750 nmdc:mga06r32_395492_c1
751 nmdc:mga06r32_599130_c1
752 nmdc:mga06r32_76390_c1
753 nmdc:mga08y16_135001_c1
754 nmdc:mga08y16_295662_c1
755 nmdc:mga08y16_556209_c1
756 nmdc:mga08y16_72139_c1
757 nmdc:mga08y16_74758_c1
758 nmdc:mga08y16_950328_c1
759 nmdc:mga0n895_176262_c1
760 nmdc:mga0rr50_388340_c1
761 nmdc:mga0rr50_74964_c1
762 nmdc:mga08x19_113772_c1
763 nmdc:mga0a205_129130_c1
764 nmdc:mga0a205_2238_c1
765 nmdc:mga0a205_528669_c1
766 Ga0495601_0033021
767 Ga0495595_0040767
768 Ga0495619_0027566
769 Ga0495619_0079452
770 Ga0495619_0546218
771 Ga0501084_0004416
772 Ga0501082_0043146
773 Ga0501082_0043897
774 Ga0501082_0252259
775 Ga0530510_0033054
776 Ga0530510_0097876

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

58

150

0.96

PF13649

Methyltransf_25

Methyltransferase domain

57

146

0.95

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

6

230

0.94

PF08242

Methyltransf_12

Methyltransferase domain

58

148

0.93

PF13847

Methyltransf_31

Methyltransferase domain

51

169

0.91

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

44

101

0.9

PF01728

FtsJ

FtsJ-like methyltransferase

38

129

0.88

PF07021

MetW

Methionine biosynthesis protein MetW

41

152

0.83

PF13489

Methyltransf_23

Methyltransferase domain

29

214

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.9112 20 227
5hek-assembly2.cif.gz_A crystal structure of m1.hpyavi 0.8685 37 91
5hek-assembly2.cif.gz_C crystal structure of m1.hpyavi 0.8639 37 91
1g60-assembly1.cif.gz_B crystal structure of methyltransferase mboiia (moraxella bovis) 0.8625 37 91
5hek-assembly3.cif.gz_B crystal structure of m1.hpyavi 0.862 35 91
ID Description Score Start End Superfamily
af_Q2FYG5_1_193_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9497 45 227 3.40.50.150
af_Q4D3E1_216_398_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9422 37 85 3.40.50.150
af_A0A0P0Y1E1_35_188_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9257 37 146 3.40.50.150
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9166 20 227 3.40.50.150
af_Q9VYF8_68_301_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9078 20 227 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V5KGP3-F1-model_v4 Methyltransferase 0.9371 105 227 GO:0008168
GO:0032259
AF-A0A2V0NZW4-F1-model_v4 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) 0.9336 13 227 GO:0008425
GO:0031314
GO:0032259
AF-A0A0R1YH47-F1-model_v4 Ubiquinone menaquinone biosynthesis methyltransferase ubie 0.9326 56 227 GO:0008168
GO:0009234
GO:0032259
AF-A0A0D8Y6T8-F1-model_v4 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) 0.9314 11 226 GO:0008425
GO:0031314
GO:0032259
AF-A0A7X1TTZ2-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9302 11 226 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770

Map