F431033

General Info

Members Datasets Scaffolds Average Seq Length
388 242 776 190

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100434839|Ga0070673_1004348391
Length 223
Sequence MPTPPDFDPRTAGQPAAPTRLTAGPGPRLTTRMTHTDAVTVALARDGDSEAFRALVEHHSRAVYRLAHRMTGNPSDAEDVVQETFLRAYKQLGRFESRANFGTWLHRIAVNCAIDLIRSRPKRESGHDATDLELIGAPPATSKAVEASPERLMLSAEVRQRITGAMSSLSQMERAAFVLRHFEGHSIDEISRTLGLKVNAAKHSIFRAVKKMRVALEPFVPAD

Samples

Sample ID Description Type Environment
1 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
151 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
152 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
175 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
176 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
177 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
178 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
179 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
180 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 1.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.61
Nodule 0
Rhizoplane 2.06
Rhizosphere 93.3
Stem 0
Stem Tuber 0
Unclassified 23.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070673_100434839 3300005364 Bacteria 1178
2 Ga0065715_10020317 3300005293 Unclassified 1448
3 Ga0065715_10196206 3300005293 Bacteria 1386
4 Ga0070658_10690713 3300005327 Bacteria 886
5 Ga0070683_100158399 3300005329 Unclassified 2148
6 Ga0070683_100443273 3300005329 Bacteria 1239
7 Ga0070690_100273602 3300005330 Bacteria 1202
8 Ga0068869_100026383 3300005334 Bacteria 4044
9 Ga0070666_10053277 3300005335 Unclassified 2728
10 Ga0070680_100000158 3300005336 Bacteria 42501
11 Ga0070660_100128545 3300005339 Unclassified 2026
12 Ga0070660_100271623 3300005339 Bacteria 1386
13 Ga0070689_100015268 3300005340 Bacteria 5597
14 Ga0070691_10026619 3300005341 Unclassified 2697
15 Ga0070687_100035750 3300005343 Unclassified 2470
16 Ga0070661_100571093 3300005344 Bacteria 912
17 Ga0070669_100065529 3300005353 Unclassified 2676
18 Ga0070675_100061571 3300005354 Bacteria 3099
19 Ga0070671_100049603 3300005355 Bacteria 3492
20 Ga0070674_100012558 3300005356 Bacteria 5205
21 Ga0070673_100001720 3300005364 Bacteria 13007
22 Ga0070688_100404416 3300005365 Bacteria 1011
23 Ga0070688_100448878 3300005365 Bacteria 964
24 Ga0070659_100138925 3300005366 Bacteria 1977
25 Ga0070659_100141306 3300005366 Bacteria 1960
26 Ga0070659_100589863 3300005366 Unclassified 954
27 Ga0070667_100052413 3300005367 Unclassified 3443
28 Ga0070714_100353629 3300005435 Bacteria 1380
29 Ga0070713_100006211 3300005436 Bacteria 8265
30 Ga0070713_100141183 3300005436 Unclassified 2134
31 Ga0070710_10503658 3300005437 Bacteria 829
32 Ga0070701_10036365 3300005438 Bacteria 2480
33 Ga0070711_100084653 3300005439 Bacteria 2269
34 Ga0070711_100104651 3300005439 Unclassified 2065
35 Ga0070705_100588190 3300005440 Bacteria 859
36 Ga0070700_100015316 3300005441 Bacteria 4346
37 Ga0070694_100018801 3300005444 Bacteria 4391
38 Ga0070694_100338421 3300005444 Bacteria 1163
39 Ga0070694_100985952 3300005444 Bacteria 699
40 Ga0070708_100037736 3300005445 Unclassified 4218
41 Ga0070708_100069814 3300005445 Bacteria 3159
42 Ga0070678_100127491 3300005456 Unclassified 2017
43 Ga0070678_100957430 3300005456 Bacteria 785
44 Ga0070662_100088038 3300005457 Unclassified 2326
45 Ga0070681_10051574 3300005458 Bacteria 4104
46 Ga0070681_10505327 3300005458 Unclassified 1122
47 Ga0070681_10567322 3300005458 Bacteria 1049
48 Ga0070681_10760272 3300005458 Bacteria 886
49 Ga0068867_100010387 3300005459 Bacteria 6569
50 Ga0070706_100163675 3300005467 Unclassified 2077
51 Ga0070706_100187265 3300005467 Bacteria 1934
52 Ga0070706_100341021 3300005467 Bacteria 1397
53 Ga0070706_100570056 3300005467 Bacteria 1053
54 Ga0070707_100869612 3300005468 Bacteria 866
55 Ga0070698_100077289 3300005471 Unclassified 3329
56 Ga0070698_100667332 3300005471 Unclassified 981
57 Ga0070698_100703211 3300005471 Bacteria 953
58 Ga0070699_100060231 3300005518 Bacteria 3289
59 Ga0070699_100164792 3300005518 Unclassified 1963
60 Ga0070699_100335592 3300005518 Bacteria 1360
61 Ga0070684_100034887 3300005535 Unclassified 4303
62 Ga0070697_100260544 3300005536 Bacteria 1484
63 Ga0070697_100318984 3300005536 Bacteria 1338
64 Ga0070697_100698789 3300005536 Bacteria 895
65 Ga0070672_100011524 3300005543 Bacteria 6169
66 Ga0070695_100075251 3300005545 Unclassified 2220
67 Ga0070695_100109268 3300005545 Bacteria 1874
68 Ga0070695_100119741 3300005545 Bacteria 1799
69 Ga0070695_100804857 3300005545 Unclassified 753
70 Ga0070693_100004546 3300005547 Bacteria 6577
71 Ga0070704_100137862 3300005549 Unclassified 1900
72 Ga0068855_100095620 3300005563 Unclassified 3424
73 Ga0068855_100259337 3300005563 Bacteria 1937
74 Ga0068855_100937906 3300005563 Bacteria 912
75 Ga0070664_100089259 3300005564 Bacteria 2667
76 Ga0070664_100106565 3300005564 Unclassified 2442
77 Ga0070664_100155312 3300005564 Unclassified 2022
78 Ga0070664_100259351 3300005564 Bacteria 1564
79 Ga0070664_100416328 3300005564 Bacteria 1230
80 Ga0068856_100004191 3300005614 Bacteria 14401
81 Ga0068852_100035324 3300005616 Unclassified 4168
82 Ga0068859_100029611 3300005617 Bacteria 5493
83 Ga0068859_100597196 3300005617 Bacteria 1197
84 Ga0068866_10112569 3300005718 Bacteria 1521
85 Ga0068861_100031012 3300005719 Bacteria 3922
86 Ga0068861_100607116 3300005719 Unclassified 1005
87 Ga0068863_100186059 3300005841 Bacteria 1995
88 Ga0068860_100262264 3300005843 Unclassified 1684
89 Ga0068862_100086880 3300005844 Unclassified 2720
90 Ga0068862_100178060 3300005844 Bacteria 1907
91 Ga0081455_10013468 3300005937 Bacteria 8078
92 Ga0081538_10130850 3300005981 Bacteria 1179
93 Ga0070717_10006143 3300006028 Bacteria 8819
94 Ga0070717_10170438 3300006028 Bacteria 1893
95 Ga0075368_10057016 3300006042 Bacteria 1559
96 Ga0075363_100171902 3300006048 Bacteria 1230
97 Ga0075364_10053564 3300006051 Bacteria 2637
98 Ga0075364_10301944 3300006051 Bacteria 1090
99 Ga0070712_100551423 3300006175 Bacteria 971
100 Ga0075367_10045769 3300006178 Bacteria 2568
101 Ga0075366_10274874 3300006195 Bacteria 1029
102 Ga0097621_100268366 3300006237 Bacteria 1499
103 Ga0068871_100598561 3300006358 Bacteria 1002
104 Ga0075428_100187333 3300006844 Bacteria 2239
105 Ga0075430_100007662 3300006846 Bacteria 9118
106 Ga0075431_100008757 3300006847 Bacteria 10138
107 Ga0075431_100021874 3300006847 Bacteria 6538
108 Ga0075433_10043781 3300006852 Bacteria 3887
109 Ga0075433_10045005 3300006852 Bacteria 3835
110 Ga0075433_10326474 3300006852 Bacteria 1357
111 Ga0075434_100133470 3300006871 Bacteria 2502
112 Ga0075434_100135572 3300006871 Bacteria 2481
113 Ga0075429_100040384 3300006880 Bacteria 4062
114 Ga0075436_100016064 3300006914 Bacteria 5125
115 Ga0097620_100029611 3300006931 Bacteria 5493
116 Ga0097620_100597194 3300006931 Bacteria 1197
117 Ga0075435_100000582 3300007076 Bacteria 22326
118 Ga0075435_100027428 3300007076 Bacteria 4456
119 Ga0075435_100152618 3300007076 Bacteria 1943
120 Ga0075435_100350644 3300007076 Bacteria 1265
121 Ga0111539_10212742 3300009094 Bacteria 2252
122 Ga0111539_10417253 3300009094 Unclassified 1563
123 Ga0111539_10498723 3300009094 Bacteria 1418
124 Ga0111539_10590674 3300009094 Bacteria 1293
125 Ga0111539_11236063 3300009094 Bacteria 867
126 Ga0105245_10028446 3300009098 Bacteria 4931
127 Ga0114129_10002928 3300009147 Bacteria 23878
128 Ga0114129_10573071 3300009147 Bacteria 1466
129 Ga0114129_10640774 3300009147 Bacteria 1372
130 Ga0105243_10061342 3300009148 Unclassified 3007
131 Ga0105241_10013172 3300009174 Bacteria 6065
132 Ga0105242_10008339 3300009176 Bacteria 7962
133 Ga0105242_10998656 3300009176 Bacteria 844
134 Ga0105248_10290954 3300009177 Unclassified 1839
135 Ga0105248_10329194 3300009177 Bacteria 1720
136 Ga0105248_10340674 3300009177 Bacteria 1688
137 Ga0105248_10353183 3300009177 Bacteria 1655
138 Ga0105248_10945496 3300009177 Bacteria 973
139 Ga0105249_10078134 3300009553 Bacteria 3071
140 Ga0105239_10014643 3300010375 Bacteria 8697
141 Ga0105239_10682198 3300010375 Bacteria 1174
142 Ga0157369_10000985 3300013105 Bacteria 36013
143 Ga0157374_10012210 3300013296 Bacteria 7465
144 Ga0157374_10341516 3300013296 Unclassified 1486
145 Ga0157378_10060418 3300013297 Bacteria 3382
146 Ga0157378_10076451 3300013297 Bacteria 3017
147 Ga0163162_10522878 3300013306 Unclassified 1316
148 Ga0163162_11136554 3300013306 Bacteria 885
149 Ga0157372_10730326 3300013307 Bacteria 1152
150 Ga0157372_11185053 3300013307 Unclassified 883
151 Ga0157375_11138279 3300013308 Bacteria 914
152 Ga0157375_11449305 3300013308 Bacteria 809
153 Ga0182008_10249220 3300014497 Bacteria 916
154 Ga0157379_11073038 3300014968 Unclassified 770
155 Ga0157376_10130664 3300014969 Bacteria 2240
156 Ga0157376_10247661 3300014969 Bacteria 1663
157 Ga0206356_10613013 3300020070 Bacteria 2816
158 Ga0206356_11471368 3300020070 Unclassified 841
159 Ga0206356_11770390 3300020070 Unclassified 819
160 Ga0206352_11100255 3300020078 Unclassified 1676
161 Ga0206354_11491130 3300020081 Bacteria 1016
162 Ga0213876_10012756 3300021384 Bacteria 4468
163 Ga0207697_10074039 3300025315 Bacteria 1430
164 Ga0207688_10018670 3300025901 Bacteria 3771
165 Ga0207680_10420584 3300025903 Bacteria 946
166 Ga0207647_10172215 3300025904 Unclassified 1260
167 Ga0207645_10036904 3300025907 Bacteria 3139
168 Ga0207705_10083333 3300025909 Unclassified 2333
169 Ga0207684_10159653 3300025910 Bacteria 1941
170 Ga0207684_10471097 3300025910 Unclassified 1078
171 Ga0207654_10044805 3300025911 Bacteria 2515
172 Ga0207654_10499774 3300025911 Bacteria 858
173 Ga0207663_10044978 3300025916 Unclassified 2713
174 Ga0207663_10238969 3300025916 Bacteria 1331
175 Ga0207663_10765225 3300025916 Bacteria 768
176 Ga0207660_10010636 3300025917 Bacteria 5979
177 Ga0207662_10001822 3300025918 Bacteria 10466
178 Ga0207657_10149647 3300025919 Unclassified 1902
179 Ga0207649_10013464 3300025920 Bacteria 4566
180 Ga0207649_10420826 3300025920 Bacteria 1003
181 Ga0207652_10029578 3300025921 Bacteria 4583
182 Ga0207681_10033312 3300025923 Bacteria 3377
183 Ga0207650_10131374 3300025925 Bacteria 1959
184 Ga0207687_10078811 3300025927 Unclassified 2373
185 Ga0207700_10075206 3300025928 Unclassified 2616
186 Ga0207644_10014835 3300025931 Bacteria 5223
187 Ga0207690_10121127 3300025932 Bacteria 1901
188 Ga0207690_10151267 3300025932 Unclassified 1721
189 Ga0207690_10218877 3300025932 Unclassified 1456
190 Ga0207706_10058198 3300025933 Unclassified 3404
191 Ga0207706_10153435 3300025933 Bacteria 2026
192 Ga0207670_10028874 3300025936 Bacteria 3527
193 Ga0207669_10025048 3300025937 Bacteria 3217
194 Ga0207665_10282652 3300025939 Bacteria 1235
195 Ga0207691_10005877 3300025940 Bacteria 11855
196 Ga0207711_10008843 3300025941 Bacteria 8419
197 Ga0207711_10111360 3300025941 Unclassified 2435
198 Ga0207711_10324470 3300025941 Bacteria 1423
199 Ga0207711_10568735 3300025941 Bacteria 1057
200 Ga0207711_10867154 3300025941 Unclassified 840
201 Ga0207689_10040733 3300025942 Bacteria 3844
202 Ga0207661_10003446 3300025944 Bacteria 10979
203 Ga0207679_10153650 3300025945 Bacteria 1877
204 Ga0207679_10193380 3300025945 Unclassified 1694
205 Ga0207679_10874398 3300025945 Bacteria 821
206 Ga0207667_10048586 3300025949 Unclassified 4486
207 Ga0207667_10291032 3300025949 Bacteria 1669
208 Ga0207667_10627111 3300025949 Bacteria 1082
209 Ga0207651_10129872 3300025960 Unclassified 1926
210 Ga0207708_10120118 3300026075 Unclassified 2047
211 Ga0207708_10923806 3300026075 Unclassified 756
212 Ga0207702_10010618 3300026078 Bacteria 7697
213 Ga0207641_10122332 3300026088 Bacteria 2324
214 Ga0207648_10007184 3300026089 Bacteria 10980
215 Ga0207683_10048429 3300026121 Unclassified 3722
216 Ga0207683_10984376 3300026121 Bacteria 783
217 Ga0207698_10026470 3300026142 Unclassified 4103
218 Ga0207698_10310074 3300026142 Unclassified 1473
219 Ga0268265_10166298 3300028380 Unclassified 1880
220 Ga0265338_10057091 3300028800 Bacteria 3456
221 Ga0265332_10118804 3300031238 Unclassified 1111
222 Ga0265320_10004619 3300031240 Bacteria 9002
223 Ga0265325_10131771 3300031241 Bacteria 1196
224 Ga0307408_100128476 3300031548 Bacteria 1974
225 Ga0316578_10404295 3300031728 Bacteria 809
226 Ga0307413_10233908 3300031824 Bacteria 1351
227 Ga0307410_10026433 3300031852 Bacteria 3655
228 Ga0307410_10040818 3300031852 Bacteria 3057
229 Ga0307410_10064748 3300031852 Bacteria 2512
230 Ga0307406_10016450 3300031901 Bacteria 4298
231 Ga0307407_10000929 3300031903 Bacteria 9913
232 Ga0307407_10212794 3300031903 Unclassified 1302
233 Ga0307407_10352310 3300031903 Unclassified 1043
234 Ga0307412_10176713 3300031911 Bacteria 1601
235 Ga0307409_100010774 3300031995 Bacteria 5713
236 Ga0307409_100133393 3300031995 Unclassified 2126
237 Ga0307416_100007299 3300032002 Bacteria 7010
238 Ga0307416_100024454 3300032002 Bacteria 4410
239 Ga0307416_100121624 3300032002 Bacteria 2328
240 Ga0307416_100572063 3300032002 Unclassified 1206
241 Ga0307416_101775051 3300032002 Bacteria 721
242 Ga0307414_10017805 3300032004 Bacteria 4356
243 Ga0307411_10130104 3300032005 Unclassified 1838
244 Ga0307415_100008829 3300032126 Bacteria 5611
245 Ga0373930_0038319 3300034816 Unclassified 1012
246 Ga0373958_0015576 3300034819 Unclassified 1345
247 Ga0373940_0117660 3300035088 Unclassified 822
248 Ga0373951_0027328 3300035091 Unclassified 1332
249 Ga0373953_0092972 3300035117 Bacteria 1263
250 Ga0373954_0218056 3300035118 Bacteria 938
251 Ga0373954_0655372 3300035118 Bacteria 520
252 Ga0373956_0069996 3300035119 Bacteria 1600
253 Ga0373957_0188573 3300035120 Unclassified 856
254 Ga0373943_0031239 3300035170 Bacteria 2526
255 Ga0373946_0446230 3300035171 Bacteria 658
256 Ga0373955_0152558 3300035172 Unclassified 1360
257 Ga0373955_0387603 3300035172 Unclassified 848
258 Ga0373942_0042003 3300035207 Unclassified 1252
259 Ga0373961_0026957 3300035241 Bacteria 1574
260 Ga0373962_0086229 3300035242 Unclassified 961
261 Ga0373931_0450502 3300035691 Bacteria 823
262 Ga0373935_0118595 3300035692 Bacteria 1765
263 Ga0373927_0006156 3300035695 Bacteria 8204
264 Ga0373927_0916503 3300035695 Unclassified 578
265 Ga0373933_0111981 3300035724 Bacteria 1703
266 Ga0373933_0276763 3300035724 Bacteria 1084
267 Ga0373937_0006182 3300036401 Bacteria 10312
268 Ga0373937_0018372 3300036401 Bacteria 6244
269 Ga0373937_0105586 3300036401 Unclassified 2618
270 Ga0373925_0001816 3300037068 Bacteria 17822
271 Ga0395898_0939687 3300037466 Unclassified 802
272 Ga0436364_0832811 3300037853 Bacteria 2317
273 Ga0436365_1059056 3300039437 Bacteria 21532
274 Ga0436365_1803248 3300039437 Unclassified 1436
275 Ga0436361_0414794 3300039447 Bacteria 1411
276 Ga0439443_117218 3300042003 Unclassified 520
277 Ga0439449_0099141 3300042007 Bacteria 1076
278 Ga0439454_039151 3300042011 Bacteria 770
279 Ga0450919_021241 3300042121 Bacteria 733
280 Ga0439435_0060657 3300042436 Bacteria 1101
281 Ga0439459_0044400 3300042438 Bacteria 956
282 Ga0439460_0057183 3300042461 Bacteria 1183
283 Ga0453683_0080768 3300044673 Bacteria 2037
284 Ga0466963_0568544 3300044694 Bacteria 801
285 Ga0466957_0202287 3300044842 Bacteria 1305
286 Ga0451576_0111471 3300045051 Bacteria 2847
287 Ga0451576_0788558 3300045051 Bacteria 998
288 Ga0451576_1048684 3300045051 Bacteria 854
289 Ga0451576_1319346 3300045051 Unclassified 752
290 Ga0466967_0074365 3300045976 Bacteria 3052
291 Ga0466967_1028724 3300045976 Bacteria 820
292 Ga0495580_0137090 3300046472 Bacteria 1697
293 Ga0495580_0150585 3300046472 Bacteria 1612
294 Ga0495580_0557901 3300046472 Bacteria 760
295 Ga0495582_0400223 3300046473 Bacteria 792
296 Ga0495630_0237919 3300046517 Bacteria 1391
297 Ga0495652_0849577 3300046529 Bacteria 605
298 Ga0495645_0585281 3300046543 Bacteria 688
299 Ga0495674_0335956 3300047319 Bacteria 1228
300 Ga0495602_0082206 3300048088 Bacteria 2704
301 Ga0495602_0673669 3300048088 Unclassified 704
302 Ga0495615_0024579 3300048090 Bacteria 1391
303 Ga0496100_0344113 3300048903 Bacteria 1125
304 Ga0496104_0537985 3300048907 Bacteria 1079
305 Ga0496105_0540942 3300048908 Bacteria 910
306 Ga0496106_0083203 3300048909 Bacteria 2461
307 Ga0496106_0266637 3300048909 Bacteria 1371
308 Ga0496106_0697700 3300048909 Bacteria 809
309 Ga0496114_0410867 3300048917 Unclassified 1199
310 Ga0496115_0030122 3300048918 Bacteria 4267
311 Ga0501290_033290 3300049513 Bacteria 747
312 Ga0501031_0441176 3300049568 Unclassified 841
313 Ga0501034_0331105 3300049571 Bacteria 1454
314 Ga0501036_0066667 3300049572 Bacteria 3046
315 Ga0501036_0349214 3300049572 Bacteria 1235
316 Ga0501040_0006057 3300049576 Bacteria 7835
317 Ga0501040_0180363 3300049576 Archaea 1497
318 Ga0501041_0015200 3300049577 Unclassified 4570
319 Ga0501043_0402189 3300049579 Bacteria 1035
320 Ga0501046_0165413 3300049580 Bacteria 1662
321 Ga0501047_0082857 3300049581 Bacteria 3083
322 Ga0501067_0038765 3300049583 Unclassified 2646
323 Ga0501069_0812739 3300049585 Bacteria 567
324 Ga0501071_0107595 3300049587 Bacteria 2059
325 Ga0501072_0047977 3300049588 Bacteria 3363
326 Ga0501072_0134195 3300049588 Bacteria 1974
327 Ga0501072_0194987 3300049588 Archaea 1615
328 Ga0501075_0097113 3300049591 Bacteria 2236
329 Ga0501075_0127976 3300049591 Bacteria 1934
330 Ga0501076_0009254 3300049592 Bacteria 7267
331 Ga0501076_0072136 3300049592 Bacteria 2763
332 Ga0501077_0020597 3300049593 Bacteria 4175
333 Ga0501079_0140368 3300049741 Bacteria 1882
334 Ga0501080_0074300 3300049742 Unclassified 3162
335 Ga0501080_0276026 3300049742 Bacteria 1529
336 Ga0501081_0046731 3300049743 Bacteria 2977
337 Ga0501081_0401161 3300049743 Unclassified 1015
338 Ga0501083_0099424 3300049744 Bacteria 1919
339 Ga0501083_0258089 3300049744 Bacteria 1134
340 Ga0501045_0005071 3300049824 Bacteria 9116
341 Ga0501045_0057574 3300049824 Bacteria 2844
342 Ga0501045_0672165 3300049824 Bacteria 765
343 nmdc:mga03n38_309607_c1 3300050490 Bacteria 850
344 nmdc:mga00v17_331507_c1 3300050491 Bacteria 989
345 nmdc:mga00v17_53454_c1 3300050491 Bacteria 2462
346 nmdc:mga0yw44_598859_c1 3300050492 Bacteria 749
347 nmdc:mga0k408_62020_c1 3300050493 Bacteria 2173
348 nmdc:mga06z11_21785_c1 3300050494 Bacteria 2983
349 nmdc:mga06z11_40945_c1 3300050494 Bacteria 2315
350 nmdc:mga07m45_7377_c1 3300050496 Bacteria 5616
351 nmdc:mga05p37_1135533_c1 3300050507 Bacteria 814
352 nmdc:mga05p37_191984_c1 3300050507 Bacteria 2479
353 nmdc:mga05p37_2518_c1 3300050507 Bacteria 21290
354 nmdc:mga05p37_941627_c1 3300050507 Bacteria 926
355 nmdc:mga09592_45518_c1 3300050508 Bacteria 3696
356 nmdc:mga0qj67_5556_c1 3300050509 Bacteria 9219
357 nmdc:mga06r32_12757_c1 3300050510 Bacteria 7597
358 nmdc:mga06r32_153681_c1 3300050510 Unclassified 2281
359 nmdc:mga08y16_1897925_c1 3300050511 Bacteria 547
360 nmdc:mga08y16_377706_c1 3300050511 Bacteria 1453
361 nmdc:mga0n895_169410_c1 3300050512 Bacteria 2216
362 nmdc:mga0n895_17960_c1 3300050512 Bacteria 6536
363 nmdc:mga0rr50_109823_c1 3300050513 Bacteria 2181
364 nmdc:mga0rr50_524306_c1 3300050513 Bacteria 1008
365 nmdc:mga0rr50_8202_c1 3300050513 Bacteria 6490
366 nmdc:mga08x19_1353_c1 3300050514 Bacteria 15190
367 nmdc:mga0a205_28896_c1 3300050515 Bacteria 5302
368 nmdc:mga0a205_79245_c2 3300050515 Bacteria 2537
369 Ga0501084_0156127 3300054114 Unclassified 1924
370 Ga0501084_0428987 3300054114 Bacteria 1117
371 Ga0590071_000178 3300059421 Bacteria 18418
372 Ga0590071_001524 3300059421 Bacteria 6077
373 Ga0590071_004688 3300059421 Bacteria 3302
374 Ga0590071_005166 3300059421 Bacteria 3149
375 Ga0590071_015060 3300059421 Bacteria 1814
376 Ga0590074_002129 3300059423 Bacteria 3240
377 Ga0590074_014434 3300059423 Bacteria 1336
378 Ga0590074_033961 3300059423 Bacteria 906
379 Ga0590075_000076 3300059424 Bacteria 25188
380 Ga0590075_000325 3300059424 Bacteria 13243
381 Ga0590075_010679 3300059424 Bacteria 2214
382 Ga0590075_031485 3300059424 Unclassified 1345
383 Ga0590075_120259 3300059424 Bacteria 687
384 Ga0590077_000056 3300059426 Bacteria 27300
385 Ga0590077_000280 3300059426 Bacteria 14465
386 Ga0590077_025283 3300059426 Bacteria 1279
387 Ga0501082_0013278 3300060353 Bacteria 7083
388 Ga0530510_0002025 3300061734 Bacteria 13919
389 Ga0070673_100434839
390 Ga0065715_10020317
391 Ga0065715_10196206
392 Ga0070658_10690713
393 Ga0070683_100158399
394 Ga0070683_100443273
395 Ga0070690_100273602
396 Ga0068869_100026383
397 Ga0070666_10053277
398 Ga0070680_100000158
399 Ga0070660_100128545
400 Ga0070660_100271623
401 Ga0070689_100015268
402 Ga0070691_10026619
403 Ga0070687_100035750
404 Ga0070661_100571093
405 Ga0070669_100065529
406 Ga0070675_100061571
407 Ga0070671_100049603
408 Ga0070674_100012558
409 Ga0070673_100001720
410 Ga0070688_100404416
411 Ga0070688_100448878
412 Ga0070659_100138925
413 Ga0070659_100141306
414 Ga0070659_100589863
415 Ga0070667_100052413
416 Ga0070714_100353629
417 Ga0070713_100006211
418 Ga0070713_100141183
419 Ga0070710_10503658
420 Ga0070701_10036365
421 Ga0070711_100084653
422 Ga0070711_100104651
423 Ga0070705_100588190
424 Ga0070700_100015316
425 Ga0070694_100018801
426 Ga0070694_100338421
427 Ga0070694_100985952
428 Ga0070708_100037736
429 Ga0070708_100069814
430 Ga0070678_100127491
431 Ga0070678_100957430
432 Ga0070662_100088038
433 Ga0070681_10051574
434 Ga0070681_10505327
435 Ga0070681_10567322
436 Ga0070681_10760272
437 Ga0068867_100010387
438 Ga0070706_100163675
439 Ga0070706_100187265
440 Ga0070706_100341021
441 Ga0070706_100570056
442 Ga0070707_100869612
443 Ga0070698_100077289
444 Ga0070698_100667332
445 Ga0070698_100703211
446 Ga0070699_100060231
447 Ga0070699_100164792
448 Ga0070699_100335592
449 Ga0070684_100034887
450 Ga0070697_100260544
451 Ga0070697_100318984
452 Ga0070697_100698789
453 Ga0070672_100011524
454 Ga0070695_100075251
455 Ga0070695_100109268
456 Ga0070695_100119741
457 Ga0070695_100804857
458 Ga0070693_100004546
459 Ga0070704_100137862
460 Ga0068855_100095620
461 Ga0068855_100259337
462 Ga0068855_100937906
463 Ga0070664_100089259
464 Ga0070664_100106565
465 Ga0070664_100155312
466 Ga0070664_100259351
467 Ga0070664_100416328
468 Ga0068856_100004191
469 Ga0068852_100035324
470 Ga0068859_100029611
471 Ga0068859_100597196
472 Ga0068866_10112569
473 Ga0068861_100031012
474 Ga0068861_100607116
475 Ga0068863_100186059
476 Ga0068860_100262264
477 Ga0068862_100086880
478 Ga0068862_100178060
479 Ga0081455_10013468
480 Ga0081538_10130850
481 Ga0070717_10006143
482 Ga0070717_10170438
483 Ga0075368_10057016
484 Ga0075363_100171902
485 Ga0075364_10053564
486 Ga0075364_10301944
487 Ga0070712_100551423
488 Ga0075367_10045769
489 Ga0075366_10274874
490 Ga0097621_100268366
491 Ga0068871_100598561
492 Ga0075428_100187333
493 Ga0075430_100007662
494 Ga0075431_100008757
495 Ga0075431_100021874
496 Ga0075433_10043781
497 Ga0075433_10045005
498 Ga0075433_10326474
499 Ga0075434_100133470
500 Ga0075434_100135572
501 Ga0075429_100040384
502 Ga0075436_100016064
503 Ga0097620_100029611
504 Ga0097620_100597194
505 Ga0075435_100000582
506 Ga0075435_100027428
507 Ga0075435_100152618
508 Ga0075435_100350644
509 Ga0111539_10212742
510 Ga0111539_10417253
511 Ga0111539_10498723
512 Ga0111539_10590674
513 Ga0111539_11236063
514 Ga0105245_10028446
515 Ga0114129_10002928
516 Ga0114129_10573071
517 Ga0114129_10640774
518 Ga0105243_10061342
519 Ga0105241_10013172
520 Ga0105242_10008339
521 Ga0105242_10998656
522 Ga0105248_10290954
523 Ga0105248_10329194
524 Ga0105248_10340674
525 Ga0105248_10353183
526 Ga0105248_10945496
527 Ga0105249_10078134
528 Ga0105239_10014643
529 Ga0105239_10682198
530 Ga0157369_10000985
531 Ga0157374_10012210
532 Ga0157374_10341516
533 Ga0157378_10060418
534 Ga0157378_10076451
535 Ga0163162_10522878
536 Ga0163162_11136554
537 Ga0157372_10730326
538 Ga0157372_11185053
539 Ga0157375_11138279
540 Ga0157375_11449305
541 Ga0182008_10249220
542 Ga0157379_11073038
543 Ga0157376_10130664
544 Ga0157376_10247661
545 Ga0206356_10613013
546 Ga0206356_11471368
547 Ga0206356_11770390
548 Ga0206352_11100255
549 Ga0206354_11491130
550 Ga0213876_10012756
551 Ga0207697_10074039
552 Ga0207688_10018670
553 Ga0207680_10420584
554 Ga0207647_10172215
555 Ga0207645_10036904
556 Ga0207705_10083333
557 Ga0207684_10159653
558 Ga0207684_10471097
559 Ga0207654_10044805
560 Ga0207654_10499774
561 Ga0207663_10044978
562 Ga0207663_10238969
563 Ga0207663_10765225
564 Ga0207660_10010636
565 Ga0207662_10001822
566 Ga0207657_10149647
567 Ga0207649_10013464
568 Ga0207649_10420826
569 Ga0207652_10029578
570 Ga0207681_10033312
571 Ga0207650_10131374
572 Ga0207687_10078811
573 Ga0207700_10075206
574 Ga0207644_10014835
575 Ga0207690_10121127
576 Ga0207690_10151267
577 Ga0207690_10218877
578 Ga0207706_10058198
579 Ga0207706_10153435
580 Ga0207670_10028874
581 Ga0207669_10025048
582 Ga0207665_10282652
583 Ga0207691_10005877
584 Ga0207711_10008843
585 Ga0207711_10111360
586 Ga0207711_10324470
587 Ga0207711_10568735
588 Ga0207711_10867154
589 Ga0207689_10040733
590 Ga0207661_10003446
591 Ga0207679_10153650
592 Ga0207679_10193380
593 Ga0207679_10874398
594 Ga0207667_10048586
595 Ga0207667_10291032
596 Ga0207667_10627111
597 Ga0207651_10129872
598 Ga0207708_10120118
599 Ga0207708_10923806
600 Ga0207702_10010618
601 Ga0207641_10122332
602 Ga0207648_10007184
603 Ga0207683_10048429
604 Ga0207683_10984376
605 Ga0207698_10026470
606 Ga0207698_10310074
607 Ga0268265_10166298
608 Ga0265338_10057091
609 Ga0265332_10118804
610 Ga0265320_10004619
611 Ga0265325_10131771
612 Ga0307408_100128476
613 Ga0316578_10404295
614 Ga0307413_10233908
615 Ga0307410_10026433
616 Ga0307410_10040818
617 Ga0307410_10064748
618 Ga0307406_10016450
619 Ga0307407_10000929
620 Ga0307407_10212794
621 Ga0307407_10352310
622 Ga0307412_10176713
623 Ga0307409_100010774
624 Ga0307409_100133393
625 Ga0307416_100007299
626 Ga0307416_100024454
627 Ga0307416_100121624
628 Ga0307416_100572063
629 Ga0307416_101775051
630 Ga0307414_10017805
631 Ga0307411_10130104
632 Ga0307415_100008829
633 Ga0373930_0038319
634 Ga0373958_0015576
635 Ga0373940_0117660
636 Ga0373951_0027328
637 Ga0373953_0092972
638 Ga0373954_0218056
639 Ga0373954_0655372
640 Ga0373956_0069996
641 Ga0373957_0188573
642 Ga0373943_0031239
643 Ga0373946_0446230
644 Ga0373955_0152558
645 Ga0373955_0387603
646 Ga0373942_0042003
647 Ga0373961_0026957
648 Ga0373962_0086229
649 Ga0373931_0450502
650 Ga0373935_0118595
651 Ga0373927_0006156
652 Ga0373927_0916503
653 Ga0373933_0111981
654 Ga0373933_0276763
655 Ga0373937_0006182
656 Ga0373937_0018372
657 Ga0373937_0105586
658 Ga0373925_0001816
659 Ga0395898_0939687
660 Ga0436364_0832811
661 Ga0436365_1059056
662 Ga0436365_1803248
663 Ga0436361_0414794
664 Ga0439443_117218
665 Ga0439449_0099141
666 Ga0439454_039151
667 Ga0450919_021241
668 Ga0439435_0060657
669 Ga0439459_0044400
670 Ga0439460_0057183
671 Ga0453683_0080768
672 Ga0466963_0568544
673 Ga0466957_0202287
674 Ga0451576_0111471
675 Ga0451576_0788558
676 Ga0451576_1048684
677 Ga0451576_1319346
678 Ga0466967_0074365
679 Ga0466967_1028724
680 Ga0495580_0137090
681 Ga0495580_0150585
682 Ga0495580_0557901
683 Ga0495582_0400223
684 Ga0495630_0237919
685 Ga0495652_0849577
686 Ga0495645_0585281
687 Ga0495674_0335956
688 Ga0495602_0082206
689 Ga0495602_0673669
690 Ga0495615_0024579
691 Ga0496100_0344113
692 Ga0496104_0537985
693 Ga0496105_0540942
694 Ga0496106_0083203
695 Ga0496106_0266637
696 Ga0496106_0697700
697 Ga0496114_0410867
698 Ga0496115_0030122
699 Ga0501290_033290
700 Ga0501031_0441176
701 Ga0501034_0331105
702 Ga0501036_0066667
703 Ga0501036_0349214
704 Ga0501040_0006057
705 Ga0501040_0180363
706 Ga0501041_0015200
707 Ga0501043_0402189
708 Ga0501046_0165413
709 Ga0501047_0082857
710 Ga0501067_0038765
711 Ga0501069_0812739
712 Ga0501071_0107595
713 Ga0501072_0047977
714 Ga0501072_0134195
715 Ga0501072_0194987
716 Ga0501075_0097113
717 Ga0501075_0127976
718 Ga0501076_0009254
719 Ga0501076_0072136
720 Ga0501077_0020597
721 Ga0501079_0140368
722 Ga0501080_0074300
723 Ga0501080_0276026
724 Ga0501081_0046731
725 Ga0501081_0401161
726 Ga0501083_0099424
727 Ga0501083_0258089
728 Ga0501045_0005071
729 Ga0501045_0057574
730 Ga0501045_0672165
731 nmdc:mga03n38_309607_c1
732 nmdc:mga00v17_331507_c1
733 nmdc:mga00v17_53454_c1
734 nmdc:mga0yw44_598859_c1
735 nmdc:mga0k408_62020_c1
736 nmdc:mga06z11_21785_c1
737 nmdc:mga06z11_40945_c1
738 nmdc:mga07m45_7377_c1
739 nmdc:mga05p37_1135533_c1
740 nmdc:mga05p37_191984_c1
741 nmdc:mga05p37_2518_c1
742 nmdc:mga05p37_941627_c1
743 nmdc:mga09592_45518_c1
744 nmdc:mga0qj67_5556_c1
745 nmdc:mga06r32_12757_c1
746 nmdc:mga06r32_153681_c1
747 nmdc:mga08y16_1897925_c1
748 nmdc:mga08y16_377706_c1
749 nmdc:mga0n895_169410_c1
750 nmdc:mga0n895_17960_c1
751 nmdc:mga0rr50_109823_c1
752 nmdc:mga0rr50_524306_c1
753 nmdc:mga0rr50_8202_c1
754 nmdc:mga08x19_1353_c1
755 nmdc:mga0a205_28896_c1
756 nmdc:mga0a205_79245_c2
757 Ga0501084_0156127
758 Ga0501084_0428987
759 Ga0590071_000178
760 Ga0590071_001524
761 Ga0590071_004688
762 Ga0590071_005166
763 Ga0590071_015060
764 Ga0590074_002129
765 Ga0590074_014434
766 Ga0590074_033961
767 Ga0590075_000076
768 Ga0590075_000325
769 Ga0590075_010679
770 Ga0590075_031485
771 Ga0590075_120259
772 Ga0590077_000056
773 Ga0590077_000280
774 Ga0590077_025283
775 Ga0501082_0013278
776 Ga0530510_0002025

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

165

214

0.98

PF04542

Sigma70_r2

Sigma-70 region 2

55

123

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

159

212

0.96

PF07638

Sigma70_ECF

ECF sigma factor

37

217

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1je8-assembly2.cif.gz_E two-component response regulator narl/dna complex: dna bending found in a high affinity site 0.949 134 179
5or5-assembly1.cif.gz_A nmr structure of the complex formed by an engineered region 2 of sigmae in complex with gtaaaa 0.9303 1 91
1h3l-assembly1.cif.gz_A n-terminal fragment of sigr from streptomyces coelicolor 0.9241 20 82
8hnp-assembly1.cif.gz_B archaeal transcription factor mutant 0.9057 135 181
2mao-assembly1.cif.gz_A nmr structure of region 2 of e. coli sigmae 0.9027 1 89
ID Description Score Start End Superfamily
1or7B01 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9691 5 87 1.10.1740.10
af_P9WGH7_10_94_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9458 5 86 1.10.1740.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.943 135 179 1.10.10.10
2mapA00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9353 1 88 1.10.1740.10
4cxfA01 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9337 5 83 1.10.1740.10
ID Description Score Start End GO Terms
AF-A0A2V7JX47-F1-model_v4 RNA polymerase sigma factor 0.5812 2 152 GO:0003677
GO:0006352
GO:0016987
AF-A0A7V0JHJ5-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.5562 5 163 GO:0003677
GO:0006352
GO:0016987
AF-A0A1H8HBN9-F1-model_v4 RNA polymerase sigma factor 0.5464 1 187 GO:0003677
GO:0006352
GO:0016987
AF-A0A0M2XW00-F1-model_v4 HTH luxR-type domain-containing protein 0.5461 5 177 GO:0003677
GO:0006352
GO:0016987
AF-A0A6M1DZP0-F1-model_v4 RNA polymerase sigma factor 0.5444 1 184 GO:0003677
GO:0006352
GO:0016987

Map