F430891

General Info

Members Datasets Scaffolds Average Seq Length
387 236 774 194

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0854746|Ga0436363_0854746_476_1168
Length 230
Sequence LIDRETKRGWLRPRFGTVGKSLMGGKSNWTVRSVITLAALLTASIAPAAAQSREPSGAPAAPAPNIAEKIETCAGCHGADGKPVDKTIPIIWGQLPGYIYIQLRDFKRGDRKSDVMGPIASSFEKADILAIGEYFSKKPWPDLAQPRAPKDVARKALEAEHSVGCTGCHLEQFQGTGIMPRLAGQSRDYLAKTIADFRSRARGNNPGMSDLMVATPENDLAALAEYLAGL

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
98 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
219 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
220 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
221 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
222 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
223 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
225 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
226 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
227 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
228 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
229 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
230 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
231 2906610324
232 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
233 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
234 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
235 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
236 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.15
Metatranscriptomes 0
Isolates 2.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 2.33
Rhizoplane 5.68
Rhizosphere 84.24
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0854746 3300039450 Bacteria 2909
2 JGI25404J52841_10002250 3300003659 Bacteria 3628
3 Ga0070683_100024149 3300005329 Bacteria 5441
4 Ga0070680_100014323 3300005336 Bacteria 6193
5 Ga0070680_100029753 3300005336 Bacteria 4384
6 Ga0070680_100045139 3300005336 Bacteria 3582
7 Ga0070660_100125903 3300005339 Bacteria 2047
8 Ga0070689_100172868 3300005340 Bacteria 1751
9 Ga0070691_10014662 3300005341 Bacteria 3597
10 Ga0070674_100071689 3300005356 Bacteria 2451
11 Ga0070709_10083732 3300005434 Bacteria 2087
12 Ga0070709_10178181 3300005434 Bacteria 1490
13 Ga0070709_10351928 3300005434 Bacteria 1089
14 Ga0070714_100291387 3300005435 Bacteria 1519
15 Ga0070714_100350139 3300005435 Bacteria 1387
16 Ga0070714_100633489 3300005435 Bacteria 1028
17 Ga0070713_100034188 3300005436 Bacteria 4080
18 Ga0070713_100044600 3300005436 Bacteria 3630
19 Ga0070713_100132745 3300005436 Bacteria 2197
20 Ga0070713_100181919 3300005436 Bacteria 1889
21 Ga0070710_10005861 3300005437 Bacteria 5864
22 Ga0070710_10041791 3300005437 Bacteria 2533
23 Ga0070710_10181361 3300005437 Bacteria 1318
24 Ga0070711_100030511 3300005439 Bacteria 3569
25 Ga0070711_100159781 3300005439 Bacteria 1707
26 Ga0070663_100236664 3300005455 Bacteria 1440
27 Ga0070663_101041581 3300005455 Bacteria 713
28 Ga0070681_10047082 3300005458 Bacteria 4310
29 Ga0070681_10169920 3300005458 Bacteria 2102
30 Ga0070706_100068229 3300005467 Bacteria 3288
31 Ga0070706_100905107 3300005467 Bacteria 815
32 Ga0070698_100063594 3300005471 Bacteria 3721
33 Ga0070679_100004616 3300005530 Bacteria 12717
34 Ga0070679_100028438 3300005530 Bacteria 5512
35 Ga0070679_100068684 3300005530 Bacteria 3534
36 Ga0070679_100792548 3300005530 Bacteria 891
37 Ga0070684_100004037 3300005535 Bacteria 11107
38 Ga0070684_100262985 3300005535 Bacteria 1578
39 Ga0068853_100015459 3300005539 Bacteria 6270
40 Ga0068853_100055685 3300005539 Bacteria 3409
41 Ga0068853_100335061 3300005539 Bacteria 1405
42 Ga0070665_100125876 3300005548 Bacteria 2565
43 Ga0068855_100051016 3300005563 Bacteria 4874
44 Ga0068855_100121386 3300005563 Bacteria 2991
45 Ga0068855_100285317 3300005563 Bacteria 1832
46 Ga0068855_100403883 3300005563 Bacteria 1497
47 Ga0070664_100178966 3300005564 Bacteria 1884
48 Ga0068857_100027687 3300005577 Bacteria 4999
49 Ga0068857_100139049 3300005577 Bacteria 2194
50 Ga0068857_100705154 3300005577 Bacteria 959
51 Ga0068857_101046554 3300005577 Bacteria 787
52 Ga0068856_100090326 3300005614 Bacteria 3047
53 Ga0068856_100386060 3300005614 Bacteria 1420
54 Ga0070702_100063488 3300005615 Bacteria 2157
55 Ga0068852_100060973 3300005616 Bacteria 3277
56 Ga0068852_100184000 3300005616 Bacteria 1966
57 Ga0068864_100208077 3300005618 Bacteria 1800
58 Ga0068851_10003067 3300005834 Bacteria 7391
59 Ga0068863_100097629 3300005841 Bacteria 2790
60 Ga0068862_100720081 3300005844 Bacteria 968
61 Ga0081540_1001915 3300005983 Bacteria 17439
62 Ga0081540_1023401 3300005983 Bacteria 3613
63 Ga0070717_10024808 3300006028 Bacteria 4765
64 Ga0070717_10029727 3300006028 Bacteria 4387
65 Ga0070717_10328407 3300006028 Bacteria 1364
66 Ga0070717_10412637 3300006028 Bacteria 1214
67 Ga0070715_10039505 3300006163 Bacteria 1966
68 Ga0070712_100013715 3300006175 Bacteria 5185
69 Ga0070712_100075868 3300006175 Bacteria 2419
70 Ga0097621_100453282 3300006237 Bacteria 1156
71 Ga0075434_100123964 3300006871 Bacteria 2600
72 Ga0075436_100424062 3300006914 Bacteria 966
73 Ga0075435_100788234 3300007076 Bacteria 827
74 Ga0099794_10036295 3300007265 Bacteria 2330
75 Ga0099794_10104958 3300007265 Bacteria 1412
76 Ga0099794_10231119 3300007265 Bacteria 951
77 Ga0099795_10010793 3300007788 Bacteria 2705
78 Ga0099795_10027201 3300007788 Bacteria 1933
79 Ga0105240_10003129 3300009093 Bacteria 26063
80 Ga0105240_10273078 3300009093 Bacteria 1945
81 Ga0105237_10020275 3300009545 Bacteria 6858
82 Ga0105237_10095818 3300009545 Bacteria 2957
83 Ga0105237_10198953 3300009545 Bacteria 2003
84 Ga0105238_10003515 3300009551 Bacteria 15608
85 Ga0099796_10008297 3300010159 Bacteria 2764
86 Ga0099796_10012011 3300010159 Bacteria 2432
87 Ga0099796_10053923 3300010159 Bacteria 1404
88 Ga0105239_10008528 3300010375 Bacteria 11647
89 Ga0157370_10005678 3300013104 Bacteria 13949
90 Ga0157370_10123727 3300013104 Bacteria 2415
91 Ga0157370_11003441 3300013104 Bacteria 756
92 Ga0157369_10006417 3300013105 Bacteria 13630
93 Ga0157369_10020445 3300013105 Bacteria 7400
94 Ga0157369_10059210 3300013105 Bacteria 4130
95 Ga0157369_10230139 3300013105 Bacteria 1938
96 Ga0157374_10805336 3300013296 Bacteria 955
97 Ga0157378_10123849 3300013297 Bacteria 2386
98 Ga0163162_10168134 3300013306 Bacteria 2317
99 Ga0157372_10235242 3300013307 Bacteria 2125
100 Ga0157372_10378227 3300013307 Bacteria 1650
101 Ga0157372_10671195 3300013307 Bacteria 1207
102 Ga0157375_10482691 3300013308 Bacteria 1404
103 Ga0163163_10009677 3300014325 Bacteria 8623
104 Ga0157380_10045919 3300014326 Bacteria 3430
105 Ga0157377_10583802 3300014745 Bacteria 794
106 Ga0157376_10396157 3300014969 Bacteria 1334
107 Ga0209233_1011932 3300025261 Bacteria 2541
108 Ga0207692_10462301 3300025898 Bacteria 800
109 Ga0207647_10275806 3300025904 Bacteria 960
110 Ga0207685_10093944 3300025905 Bacteria 1269
111 Ga0207699_10088659 3300025906 Bacteria 1937
112 Ga0207699_10753925 3300025906 Bacteria 714
113 Ga0207705_10299050 3300025909 Bacteria 1234
114 Ga0207684_10066502 3300025910 Bacteria 3061
115 Ga0207707_10001816 3300025912 Bacteria 19579
116 Ga0207707_10002862 3300025912 Bacteria 15414
117 Ga0207707_10006995 3300025912 Bacteria 9842
118 Ga0207695_10057405 3300025913 Bacteria 4044
119 Ga0207695_10223854 3300025913 Bacteria 1788
120 Ga0207671_10012214 3300025914 Bacteria 6925
121 Ga0207671_10150326 3300025914 Bacteria 1799
122 Ga0207671_10811820 3300025914 Bacteria 741
123 Ga0207693_10016018 3300025915 Bacteria 6001
124 Ga0207693_10045330 3300025915 Bacteria 3455
125 Ga0207693_10113302 3300025915 Bacteria 2127
126 Ga0207663_10000337 3300025916 Bacteria 20534
127 Ga0207660_10002524 3300025917 Bacteria 12025
128 Ga0207660_10066212 3300025917 Bacteria 2613
129 Ga0207657_10001783 3300025919 Bacteria 23230
130 Ga0207657_10115256 3300025919 Bacteria 2215
131 Ga0207649_10419743 3300025920 Bacteria 1004
132 Ga0207652_10001344 3300025921 Bacteria 21832
133 Ga0207652_10023642 3300025921 Bacteria 5092
134 Ga0207652_10028953 3300025921 Bacteria 4625
135 Ga0207694_10011710 3300025924 Bacteria 6617
136 Ga0207694_10538074 3300025924 Bacteria 980
137 Ga0207687_10238615 3300025927 Bacteria 1439
138 Ga0207700_10028072 3300025928 Bacteria 3949
139 Ga0207700_10034092 3300025928 Bacteria 3651
140 Ga0207700_10138854 3300025928 Bacteria 1994
141 Ga0207700_10298507 3300025928 Bacteria 1390
142 Ga0207664_10013551 3300025929 Bacteria 5857
143 Ga0207664_10083438 3300025929 Bacteria 2605
144 Ga0207664_10087568 3300025929 Bacteria 2546
145 Ga0207664_10515493 3300025929 Bacteria 1071
146 Ga0207690_10655180 3300025932 Unclassified 861
147 Ga0207706_11047106 3300025933 Bacteria 684
148 Ga0207670_10054607 3300025936 Bacteria 2696
149 Ga0207670_10177102 3300025936 Bacteria 1603
150 Ga0207665_10000398 3300025939 Bacteria 29930
151 Ga0207665_10021486 3300025939 Bacteria 4244
152 Ga0207665_10119282 3300025939 Bacteria 1862
153 Ga0207691_10102338 3300025940 Bacteria 2555
154 Ga0207661_10069716 3300025944 Bacteria 2867
155 Ga0207661_10115926 3300025944 Bacteria 2273
156 Ga0207667_10004104 3300025949 Bacteria 17899
157 Ga0207667_10841531 3300025949 Bacteria 912
158 Ga0207667_10858660 3300025949 Bacteria 901
159 Ga0207667_10890166 3300025949 Bacteria 882
160 Ga0207668_10107569 3300025972 Bacteria 2085
161 Ga0207703_10420685 3300026035 Bacteria 1243
162 Ga0207639_10010686 3300026041 Bacteria 6357
163 Ga0207639_10401426 3300026041 Bacteria 1235
164 Ga0207678_10056802 3300026067 Bacteria 3369
165 Ga0207678_10057777 3300026067 Bacteria 3339
166 Ga0207702_10324342 3300026078 Bacteria 1467
167 Ga0207702_10350874 3300026078 Bacteria 1412
168 Ga0207702_10456838 3300026078 Bacteria 1240
169 Ga0207676_10591061 3300026095 Bacteria 1065
170 Ga0207674_10037431 3300026116 Bacteria 5046
171 Ga0207674_10095446 3300026116 Bacteria 2960
172 Ga0207698_10037207 3300026142 Bacteria 3582
173 Ga0207698_10845050 3300026142 Bacteria 920
174 Ga0209179_1009606 3300027512 Bacteria 1665
175 Ga0209179_1017967 3300027512 Bacteria 1346
176 Ga0209588_1004035 3300027671 Bacteria 4110
177 Ga0307517_10108926 3300028786 Bacteria 2123
178 Ga0265330_10010442 3300031235 Bacteria 4377
179 Ga0265330_10013107 3300031235 Bacteria 3868
180 Ga0265332_10125371 3300031238 Bacteria 1078
181 Ga0265328_10101326 3300031239 Bacteria 1067
182 Ga0265325_10002837 3300031241 Bacteria 11553
183 Ga0265329_10051710 3300031242 Bacteria 1308
184 Ga0265340_10006880 3300031247 Bacteria 6219
185 Ga0265339_10035726 3300031249 Bacteria 2786
186 Ga0265316_10339761 3300031344 Bacteria 1088
187 Ga0265313_10041326 3300031595 Bacteria 2273
188 Ga0265314_10034676 3300031711 Bacteria 3684
189 Ga0265342_10020399 3300031712 Bacteria 4252
190 Ga0265342_10077087 3300031712 Bacteria 1931
191 Ga0307510_10137997 3300033180 Bacteria 2091
192 Ga0315911_1000007 3300033442 Bacteria 413725
193 Ga0373923_0001770 3300035111 Bacteria 6368
194 Ga0373953_0018158 3300035117 Bacteria 2598
195 Ga0373956_0033027 3300035119 Bacteria 2273
196 Ga0373957_0014162 3300035120 Bacteria 2721
197 Ga0373955_0018370 3300035172 Bacteria 3476
198 Ga0373955_0383127 3300035172 Bacteria 853
199 Ga0373924_0013515 3300035410 Bacteria 3069
200 Ga0373933_0057303 3300035724 Bacteria 2341
201 Ga0373933_0063158 3300035724 Bacteria 2238
202 Ga0373947_0166158 3300035725 Bacteria 1429
203 Ga0373937_0393036 3300036401 Bacteria 1315
204 Ga0373937_1399486 3300036401 Bacteria 647
205 Ga0373925_0163198 3300037068 Bacteria 1756
206 Ga0395899_0099254 3300037312 Bacteria 2104
207 Ga0395900_0118620 3300037418 Bacteria 2715
208 Ga0395900_0288274 3300037418 Bacteria 1631
209 Ga0395900_0890912 3300037418 Bacteria 814
210 Ga0395898_0003446 3300037466 Bacteria 17687
211 Ga0395898_0011234 3300037466 Bacteria 9320
212 Ga0395898_0679575 3300037466 Bacteria 972
213 Ga0395905_0043835 3300037471 Bacteria 4197
214 Ga0395905_0197327 3300037471 Bacteria 1887
215 Ga0436364_0579798 3300037853 Bacteria 4466
216 Ga0395901_0097300 3300038443 Bacteria 3085
217 Ga0395901_0143696 3300038443 Bacteria 2508
218 Ga0395901_0427285 3300038443 Bacteria 1358
219 Ga0395901_0883101 3300038443 Bacteria 877
220 Ga0436365_0209995 3300039437 Bacteria 1151
221 Ga0436365_0507114 3300039437 Bacteria 3637
222 Ga0466966_0389208 3300044684 Bacteria 838
223 Ga0466963_0079418 3300044694 Bacteria 2220
224 Ga0466970_0357663 3300044765 Bacteria 829
225 Ga0466957_0030965 3300044842 Bacteria 3196
226 Ga0466959_0004470 3300045049 Bacteria 9365
227 Ga0466959_0221250 3300045049 Bacteria 1313
228 Ga0466967_0172869 3300045976 Bacteria 2034
229 Ga0495617_017679 3300046452 Bacteria 2410
230 Ga0495617_131057 3300046452 Bacteria 804
231 Ga0495592_0013650 3300046454 Bacteria 6178
232 Ga0495603_0002714 3300046455 Bacteria 10438
233 Ga0495603_0090533 3300046455 Bacteria 1789
234 Ga0495629_0001436 3300046459 Bacteria 18784
235 Ga0495629_0238194 3300046459 Bacteria 1253
236 Ga0495629_0413353 3300046459 Bacteria 916
237 Ga0495638_0050788 3300046460 Bacteria 2589
238 Ga0495651_0045382 3300046462 Bacteria 3405
239 Ga0495651_0123222 3300046462 Bacteria 1901
240 Ga0495651_0157939 3300046462 Bacteria 1628
241 Ga0495580_0009552 3300046472 Bacteria 7620
242 Ga0495605_0024552 3300046474 Bacteria 3153
243 Ga0495639_0012166 3300046475 Bacteria 3710
244 Ga0495584_0013840 3300046491 Bacteria 4112
245 Ga0495584_0030814 3300046491 Bacteria 2716
246 Ga0495585_0015913 3300046492 Bacteria 4363
247 Ga0495594_0006475 3300046499 Bacteria 6027
248 Ga0495594_0458616 3300046499 Bacteria 724
249 Ga0495594_0538274 3300046499 Bacteria 663
250 Ga0495607_0201387 3300046501 Bacteria 985
251 Ga0495583_0022364 3300046506 Bacteria 3227
252 Ga0495608_0196195 3300046511 Bacteria 1273
253 Ga0495616_0131773 3300046513 Bacteria 1145
254 Ga0495618_0050682 3300046514 Bacteria 2623
255 Ga0495630_0286046 3300046517 Bacteria 1260
256 Ga0495630_0526009 3300046517 Bacteria 907
257 Ga0495631_0090115 3300046518 Bacteria 1320
258 Ga0495648_0006991 3300046524 Bacteria 9098
259 Ga0495648_0007863 3300046524 Bacteria 8479
260 Ga0495663_0029137 3300046525 Bacteria 1628
261 Ga0495666_0053207 3300046526 Bacteria 1944
262 Ga0495652_0027917 3300046529 Bacteria 4971
263 Ga0495652_0054626 3300046529 Bacteria 3400
264 Ga0495640_0005630 3300046533 Bacteria 9965
265 Ga0495640_0011809 3300046533 Bacteria 6701
266 Ga0495640_0041476 3300046533 Bacteria 3216
267 Ga0495640_0241572 3300046533 Bacteria 1133
268 Ga0495598_0092671 3300046537 Bacteria 988
269 Ga0495645_0133424 3300046543 Bacteria 1738
270 Ga0495622_0008819 3300046557 Bacteria 4669
271 Ga0495667_0050379 3300046559 Bacteria 2749
272 Ga0495656_0008824 3300046615 Bacteria 3614
273 Ga0495656_0027791 3300046615 Bacteria 2262
274 Ga0495634_0003709 3300046642 Bacteria 12172
275 Ga0495634_0041669 3300046642 Bacteria 3118
276 Ga0495625_0070854 3300046660 Bacteria 2447
277 Ga0495635_0004962 3300046663 Bacteria 9264
278 Ga0495635_0018552 3300046663 Bacteria 4853
279 Ga0495635_0040987 3300046663 Bacteria 3199
280 Ga0495659_0002608 3300046664 Bacteria 5813
281 Ga0495659_0022262 3300046664 Bacteria 2142
282 Ga0495661_0076488 3300046665 Bacteria 1942
283 Ga0495588_0000924 3300046674 Bacteria 12777
284 Ga0495588_0136109 3300046674 Bacteria 1297
285 Ga0495657_0009241 3300046675 Bacteria 7480
286 Ga0495657_0157693 3300046675 Bacteria 1405
287 Ga0495599_0191644 3300046678 Bacteria 1257
288 Ga0495623_0132216 3300046679 Bacteria 1493
289 Ga0495623_0141048 3300046679 Bacteria 1433
290 Ga0495623_0429649 3300046679 Bacteria 706
291 Ga0495646_0041281 3300046680 Bacteria 2835
292 Ga0495646_0065755 3300046680 Bacteria 2146
293 Ga0495669_0018099 3300046684 Bacteria 3026
294 Ga0495613_0013725 3300046689 Bacteria 6010
295 Ga0495613_0060153 3300046689 Bacteria 2783
296 Ga0495624_0007704 3300046690 Bacteria 7555
297 Ga0495670_0010219 3300046691 Bacteria 4615
298 Ga0495670_0061493 3300046691 Bacteria 1888
299 Ga0495671_0044023 3300046692 Bacteria 2239
300 Ga0495589_0027161 3300046794 Bacteria 2895
301 Ga0495589_0169029 3300046794 Bacteria 1040
302 Ga0495600_0001422 3300046809 Bacteria 13229
303 Ga0495600_0028664 3300046809 Bacteria 3602
304 Ga0495581_0030424 3300047315 Bacteria 3128
305 Ga0495581_0165685 3300047315 Bacteria 1292
306 Ga0495604_0039003 3300047317 Bacteria 3734
307 Ga0495604_0111333 3300047317 Bacteria 1996
308 Ga0495636_0043723 3300047318 Bacteria 1864
309 Ga0495674_0067355 3300047319 Bacteria 3102
310 Ga0495674_0178871 3300047319 Bacteria 1767
311 Ga0495676_0014196 3300047321 Bacteria 7132
312 Ga0495680_0021085 3300047322 Bacteria 5460
313 Ga0495680_0762101 3300047322 Bacteria 635
314 Ga0495673_0201454 3300047469 Bacteria 744
315 Ga0495684_0000348 3300047471 Bacteria 37242
316 Ga0495593_0009378 3300047673 Bacteria 5680
317 Ga0495593_0053287 3300047673 Bacteria 2135
318 Ga0495615_0012089 3300048090 Bacteria 1772
319 Ga0496102_0074678 3300048905 Bacteria 3117
320 Ga0496102_0101684 3300048905 Bacteria 2671
321 Ga0496102_0644405 3300048905 Bacteria 983
322 Ga0496104_0015048 3300048907 Bacteria 7001
323 Ga0496105_0001282 3300048908 Bacteria 17583
324 Ga0496105_0106247 3300048908 Bacteria 2317
325 Ga0496106_0015455 3300048909 Bacteria 5650
326 Ga0496106_0365769 3300048909 Bacteria 1159
327 Ga0496107_0436549 3300048910 Bacteria 973
328 Ga0496109_0039879 3300048912 Bacteria 4252
329 Ga0496110_0047084 3300048913 Bacteria 3774
330 Ga0496111_0555739 3300048914 Bacteria 842
331 Ga0496111_0635945 3300048914 Bacteria 779
332 Ga0496112_0002358 3300048915 Bacteria 15172
333 Ga0496112_0476608 3300048915 Bacteria 1185
334 Ga0496113_0023657 3300048916 Bacteria 4358
335 Ga0496113_0161688 3300048916 Bacteria 1770
336 Ga0496114_0249673 3300048917 Bacteria 1561
337 Ga0496114_0249794 3300048917 Bacteria 1561
338 Ga0496115_0108754 3300048918 Bacteria 2276
339 Ga0496115_0120449 3300048918 Bacteria 2159
340 Ga0496115_0165795 3300048918 Bacteria 1827
341 Ga0496117_0148366 3300048920 Bacteria 1392
342 Ga0496118_0064302 3300048921 Bacteria 2693
343 Ga0496118_0330109 3300048921 Bacteria 823
344 Ga0496119_0010363 3300048922 Bacteria 7850
345 Ga0496120_0048930 3300048923 Bacteria 2430
346 Ga0496120_0059301 3300048923 Bacteria 2145
347 Ga0496121_0013906 3300048924 Bacteria 8603
348 Ga0496121_0054715 3300048924 Bacteria 3332
349 Ga0496125_0055471 3300048928 Bacteria 3228
350 Ga0496126_0017854 3300048929 Bacteria 7059
351 Ga0496126_0044096 3300048929 Bacteria 4110
352 Ga0496126_0768454 3300048929 Bacteria 742
353 Ga0496126_0988254 3300048929 Bacteria 632
354 Ga0501070_0022700 3300049586 Bacteria 5254
355 Ga0501073_0094294 3300049589 Bacteria 2079
356 Ga0501074_0373632 3300049590 Bacteria 1011
357 Ga0501080_0888306 3300049742 Bacteria 777
358 Ga0501044_0563373 3300049823 Bacteria 1035
359 nmdc:mga0n895_73172_c1 3300050512 Bacteria 3402
360 nmdc:mga0rr50_297937_c1 3300050513 Bacteria 1348
361 Ga0495601_0004789 3300053077 Bacteria 7848
362 Ga0495601_0217713 3300053077 Bacteria 1247
363 Ga0495601_0472353 3300053077 Bacteria 810
364 Ga0495612_0090927 3300053078 Bacteria 1292
365 Ga0495612_0202650 3300053078 Bacteria 876
366 Ga0495595_0006959 3300053084 Bacteria 4617
367 Ga0495619_0002186 3300053085 Bacteria 12956
368 Ga0495619_0025119 3300053085 Bacteria 3824
369 Ga0500554_038228 3300053102 Bacteria 1459
370 Ga0500595_004174 3300053119 Bacteria 6545
371 Ga0500590_049332 3300053148 Bacteria 2143
372 Ga0500603_000430 3300053150 Bacteria 10897
373 Ga0500627_0203706 3300053158 Bacteria 886
374 Ga0500636_0103033 3300053177 Bacteria 1620
375 Ga0466962_0161412 3300061719 Bacteria 1089
376 2513864206 2513237137 Bacteria 9558895
377 2524467305 2524023210 Bacteria 9029266
378 2745082563 2744054633 Bacteria 8678936
379 2876762705 2876761206 Bacteria 10111113
380 2885379787 2885374607 Bacteria 8927485
381 2885414412 2885409591 Bacteria 9235467
382 2906611913
383 2908740573 2908739725 Bacteria 8628932
384 2935637556 2935630451 Bacteria 8169952
385 2941514071 2941507105 Bacteria 8166816
386 2941522032 2941515067 Bacteria 8166720
387 2941529770 2941523033 Bacteria 8169134
388 Ga0436363_0854746
389 JGI25404J52841_10002250
390 Ga0070683_100024149
391 Ga0070680_100014323
392 Ga0070680_100029753
393 Ga0070680_100045139
394 Ga0070660_100125903
395 Ga0070689_100172868
396 Ga0070691_10014662
397 Ga0070674_100071689
398 Ga0070709_10083732
399 Ga0070709_10178181
400 Ga0070709_10351928
401 Ga0070714_100291387
402 Ga0070714_100350139
403 Ga0070714_100633489
404 Ga0070713_100034188
405 Ga0070713_100044600
406 Ga0070713_100132745
407 Ga0070713_100181919
408 Ga0070710_10005861
409 Ga0070710_10041791
410 Ga0070710_10181361
411 Ga0070711_100030511
412 Ga0070711_100159781
413 Ga0070663_100236664
414 Ga0070663_101041581
415 Ga0070681_10047082
416 Ga0070681_10169920
417 Ga0070706_100068229
418 Ga0070706_100905107
419 Ga0070698_100063594
420 Ga0070679_100004616
421 Ga0070679_100028438
422 Ga0070679_100068684
423 Ga0070679_100792548
424 Ga0070684_100004037
425 Ga0070684_100262985
426 Ga0068853_100015459
427 Ga0068853_100055685
428 Ga0068853_100335061
429 Ga0070665_100125876
430 Ga0068855_100051016
431 Ga0068855_100121386
432 Ga0068855_100285317
433 Ga0068855_100403883
434 Ga0070664_100178966
435 Ga0068857_100027687
436 Ga0068857_100139049
437 Ga0068857_100705154
438 Ga0068857_101046554
439 Ga0068856_100090326
440 Ga0068856_100386060
441 Ga0070702_100063488
442 Ga0068852_100060973
443 Ga0068852_100184000
444 Ga0068864_100208077
445 Ga0068851_10003067
446 Ga0068863_100097629
447 Ga0068862_100720081
448 Ga0081540_1001915
449 Ga0081540_1023401
450 Ga0070717_10024808
451 Ga0070717_10029727
452 Ga0070717_10328407
453 Ga0070717_10412637
454 Ga0070715_10039505
455 Ga0070712_100013715
456 Ga0070712_100075868
457 Ga0097621_100453282
458 Ga0075434_100123964
459 Ga0075436_100424062
460 Ga0075435_100788234
461 Ga0099794_10036295
462 Ga0099794_10104958
463 Ga0099794_10231119
464 Ga0099795_10010793
465 Ga0099795_10027201
466 Ga0105240_10003129
467 Ga0105240_10273078
468 Ga0105237_10020275
469 Ga0105237_10095818
470 Ga0105237_10198953
471 Ga0105238_10003515
472 Ga0099796_10008297
473 Ga0099796_10012011
474 Ga0099796_10053923
475 Ga0105239_10008528
476 Ga0157370_10005678
477 Ga0157370_10123727
478 Ga0157370_11003441
479 Ga0157369_10006417
480 Ga0157369_10020445
481 Ga0157369_10059210
482 Ga0157369_10230139
483 Ga0157374_10805336
484 Ga0157378_10123849
485 Ga0163162_10168134
486 Ga0157372_10235242
487 Ga0157372_10378227
488 Ga0157372_10671195
489 Ga0157375_10482691
490 Ga0163163_10009677
491 Ga0157380_10045919
492 Ga0157377_10583802
493 Ga0157376_10396157
494 Ga0209233_1011932
495 Ga0207692_10462301
496 Ga0207647_10275806
497 Ga0207685_10093944
498 Ga0207699_10088659
499 Ga0207699_10753925
500 Ga0207705_10299050
501 Ga0207684_10066502
502 Ga0207707_10001816
503 Ga0207707_10002862
504 Ga0207707_10006995
505 Ga0207695_10057405
506 Ga0207695_10223854
507 Ga0207671_10012214
508 Ga0207671_10150326
509 Ga0207671_10811820
510 Ga0207693_10016018
511 Ga0207693_10045330
512 Ga0207693_10113302
513 Ga0207663_10000337
514 Ga0207660_10002524
515 Ga0207660_10066212
516 Ga0207657_10001783
517 Ga0207657_10115256
518 Ga0207649_10419743
519 Ga0207652_10001344
520 Ga0207652_10023642
521 Ga0207652_10028953
522 Ga0207694_10011710
523 Ga0207694_10538074
524 Ga0207687_10238615
525 Ga0207700_10028072
526 Ga0207700_10034092
527 Ga0207700_10138854
528 Ga0207700_10298507
529 Ga0207664_10013551
530 Ga0207664_10083438
531 Ga0207664_10087568
532 Ga0207664_10515493
533 Ga0207690_10655180
534 Ga0207706_11047106
535 Ga0207670_10054607
536 Ga0207670_10177102
537 Ga0207665_10000398
538 Ga0207665_10021486
539 Ga0207665_10119282
540 Ga0207691_10102338
541 Ga0207661_10069716
542 Ga0207661_10115926
543 Ga0207667_10004104
544 Ga0207667_10841531
545 Ga0207667_10858660
546 Ga0207667_10890166
547 Ga0207668_10107569
548 Ga0207703_10420685
549 Ga0207639_10010686
550 Ga0207639_10401426
551 Ga0207678_10056802
552 Ga0207678_10057777
553 Ga0207702_10324342
554 Ga0207702_10350874
555 Ga0207702_10456838
556 Ga0207676_10591061
557 Ga0207674_10037431
558 Ga0207674_10095446
559 Ga0207698_10037207
560 Ga0207698_10845050
561 Ga0209179_1009606
562 Ga0209179_1017967
563 Ga0209588_1004035
564 Ga0307517_10108926
565 Ga0265330_10010442
566 Ga0265330_10013107
567 Ga0265332_10125371
568 Ga0265328_10101326
569 Ga0265325_10002837
570 Ga0265329_10051710
571 Ga0265340_10006880
572 Ga0265339_10035726
573 Ga0265316_10339761
574 Ga0265313_10041326
575 Ga0265314_10034676
576 Ga0265342_10020399
577 Ga0265342_10077087
578 Ga0307510_10137997
579 Ga0315911_1000007
580 Ga0373923_0001770
581 Ga0373953_0018158
582 Ga0373956_0033027
583 Ga0373957_0014162
584 Ga0373955_0018370
585 Ga0373955_0383127
586 Ga0373924_0013515
587 Ga0373933_0057303
588 Ga0373933_0063158
589 Ga0373947_0166158
590 Ga0373937_0393036
591 Ga0373937_1399486
592 Ga0373925_0163198
593 Ga0395899_0099254
594 Ga0395900_0118620
595 Ga0395900_0288274
596 Ga0395900_0890912
597 Ga0395898_0003446
598 Ga0395898_0011234
599 Ga0395898_0679575
600 Ga0395905_0043835
601 Ga0395905_0197327
602 Ga0436364_0579798
603 Ga0395901_0097300
604 Ga0395901_0143696
605 Ga0395901_0427285
606 Ga0395901_0883101
607 Ga0436365_0209995
608 Ga0436365_0507114
609 Ga0466966_0389208
610 Ga0466963_0079418
611 Ga0466970_0357663
612 Ga0466957_0030965
613 Ga0466959_0004470
614 Ga0466959_0221250
615 Ga0466967_0172869
616 Ga0495617_017679
617 Ga0495617_131057
618 Ga0495592_0013650
619 Ga0495603_0002714
620 Ga0495603_0090533
621 Ga0495629_0001436
622 Ga0495629_0238194
623 Ga0495629_0413353
624 Ga0495638_0050788
625 Ga0495651_0045382
626 Ga0495651_0123222
627 Ga0495651_0157939
628 Ga0495580_0009552
629 Ga0495605_0024552
630 Ga0495639_0012166
631 Ga0495584_0013840
632 Ga0495584_0030814
633 Ga0495585_0015913
634 Ga0495594_0006475
635 Ga0495594_0458616
636 Ga0495594_0538274
637 Ga0495607_0201387
638 Ga0495583_0022364
639 Ga0495608_0196195
640 Ga0495616_0131773
641 Ga0495618_0050682
642 Ga0495630_0286046
643 Ga0495630_0526009
644 Ga0495631_0090115
645 Ga0495648_0006991
646 Ga0495648_0007863
647 Ga0495663_0029137
648 Ga0495666_0053207
649 Ga0495652_0027917
650 Ga0495652_0054626
651 Ga0495640_0005630
652 Ga0495640_0011809
653 Ga0495640_0041476
654 Ga0495640_0241572
655 Ga0495598_0092671
656 Ga0495645_0133424
657 Ga0495622_0008819
658 Ga0495667_0050379
659 Ga0495656_0008824
660 Ga0495656_0027791
661 Ga0495634_0003709
662 Ga0495634_0041669
663 Ga0495625_0070854
664 Ga0495635_0004962
665 Ga0495635_0018552
666 Ga0495635_0040987
667 Ga0495659_0002608
668 Ga0495659_0022262
669 Ga0495661_0076488
670 Ga0495588_0000924
671 Ga0495588_0136109
672 Ga0495657_0009241
673 Ga0495657_0157693
674 Ga0495599_0191644
675 Ga0495623_0132216
676 Ga0495623_0141048
677 Ga0495623_0429649
678 Ga0495646_0041281
679 Ga0495646_0065755
680 Ga0495669_0018099
681 Ga0495613_0013725
682 Ga0495613_0060153
683 Ga0495624_0007704
684 Ga0495670_0010219
685 Ga0495670_0061493
686 Ga0495671_0044023
687 Ga0495589_0027161
688 Ga0495589_0169029
689 Ga0495600_0001422
690 Ga0495600_0028664
691 Ga0495581_0030424
692 Ga0495581_0165685
693 Ga0495604_0039003
694 Ga0495604_0111333
695 Ga0495636_0043723
696 Ga0495674_0067355
697 Ga0495674_0178871
698 Ga0495676_0014196
699 Ga0495680_0021085
700 Ga0495680_0762101
701 Ga0495673_0201454
702 Ga0495684_0000348
703 Ga0495593_0009378
704 Ga0495593_0053287
705 Ga0495615_0012089
706 Ga0496102_0074678
707 Ga0496102_0101684
708 Ga0496102_0644405
709 Ga0496104_0015048
710 Ga0496105_0001282
711 Ga0496105_0106247
712 Ga0496106_0015455
713 Ga0496106_0365769
714 Ga0496107_0436549
715 Ga0496109_0039879
716 Ga0496110_0047084
717 Ga0496111_0555739
718 Ga0496111_0635945
719 Ga0496112_0002358
720 Ga0496112_0476608
721 Ga0496113_0023657
722 Ga0496113_0161688
723 Ga0496114_0249673
724 Ga0496114_0249794
725 Ga0496115_0108754
726 Ga0496115_0120449
727 Ga0496115_0165795
728 Ga0496117_0148366
729 Ga0496118_0064302
730 Ga0496118_0330109
731 Ga0496119_0010363
732 Ga0496120_0048930
733 Ga0496120_0059301
734 Ga0496121_0013906
735 Ga0496121_0054715
736 Ga0496125_0055471
737 Ga0496126_0017854
738 Ga0496126_0044096
739 Ga0496126_0768454
740 Ga0496126_0988254
741 Ga0501070_0022700
742 Ga0501073_0094294
743 Ga0501074_0373632
744 Ga0501080_0888306
745 Ga0501044_0563373
746 nmdc:mga0n895_73172_c1
747 nmdc:mga0rr50_297937_c1
748 Ga0495601_0004789
749 Ga0495601_0217713
750 Ga0495601_0472353
751 Ga0495612_0090927
752 Ga0495612_0202650
753 Ga0495595_0006959
754 Ga0495619_0002186
755 Ga0495619_0025119
756 Ga0500554_038228
757 Ga0500595_004174
758 Ga0500590_049332
759 Ga0500603_000430
760 Ga0500627_0203706
761 Ga0500636_0103033
762 Ga0466962_0161412
763 2513864206
764 2524467305
765 2745082563
766 2876762705
767 2885379787
768 2885414412
769 2906611913
770 2908740573
771 2935637556
772 2941514071
773 2941522032
774 2941529770

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cno-assembly1.cif.gz_A structure of pseudomonas nautica cytochrome c552, by mad method 0.8581 32 102
5n1t-assembly1.cif.gz_B crystal structure of complex between flavocytochrome c and copper chaperone copc from t. paradoxus 0.8325 29 100
2zzs-assembly29.cif.gz_3 crystal structure of cytochrome c554 from vibrio parahaemolyticus strain rimd2210633 0.8184 26 99
2zzs-assembly1.cif.gz_A crystal structure of cytochrome c554 from vibrio parahaemolyticus strain rimd2210633 0.8096 26 99
1c53-assembly1.cif.gz_A s-class cytochromes c have a variety of folding patterns: structure of cytochrome c-553 from desulfovibrio vulgaris determined by the multi-wavelength anomalous dispersion method 0.8068 28 100
ID Description Score Start End Superfamily
1cnoH00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8583 32 102 1.10.760.10
1h1oB02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8495 36 99 1.10.760.10
3vrdA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8391 28 103 1.10.760.10
1h1oA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8389 34 99 1.10.760.10
5n1tB00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8325 29 100 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A2G6EW04-F1-model_v4 Cytochrome C 0.8743 32 102 GO:0009055
GO:0020037
GO:0046872
AF-A0A395CX97-F1-model_v4 Cytochrome C 0.8724 29 102 GO:0009055
GO:0020037
GO:0046872
AF-A0A2G8DCY2-F1-model_v4 deleted 0.8688 29 102
AF-A0A4R6RF13-F1-model_v4 Cytochrome c553 0.8665 28 102 GO:0009055
GO:0020037
GO:0046872
AF-A0A259KLL8-F1-model_v4 Cytochrome c domain-containing protein 0.8663 28 102 GO:0009055
GO:0020037

Map