F430867

General Info

Members Datasets Scaffolds Average Seq Length
387 235 774 309

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100072181|Ga0307408_1000721812
Length 334
Sequence MTVSEEAGGRRHDRGGRPPSITDVYRELRPLIFSIAYRMLSSASDAEDTVQEAFVRYHTAVDGGVVIESPKAYLSALVTRISIDRLRSAVVRRERYVGQWLPEPLLTDAPEADPQELAELGDTLSMAFLLVLERLSPVERAVFLLHDVFGYGYDEIASIVHKSQANCRQLATRARRHVRAQKPRFEATREQRDQLADRFFAAFTDGNLDGLVAMLADDAVTYGDGGGKAPQWSTPIMGAERIARLFVAMSKQLSAHELSVQRHEVNGQPGAIVRNQRGELINVFTLDIADGQVQAVRSVINPDKLRHLGPVADLGAMRRQARSGSTDSAPPASS

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
165 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
166 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
167 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
174 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
233 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
234 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
235 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 0.26
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 7.75
Rhizosphere 90.18
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100072181 3300031548 Bacteria 2555
2 Ga0070658_10001262 3300005327 Bacteria 21661
3 Ga0070658_10079930 3300005327 Bacteria 2685
4 Ga0070676_10020614 3300005328 Bacteria 3683
5 Ga0070690_100033459 3300005330 Bacteria 3218
6 Ga0070670_100004007 3300005331 Bacteria 12291
7 Ga0070670_100363101 3300005331 Bacteria 1274
8 Ga0068869_100000969 3300005334 Bacteria 16688
9 Ga0070680_100082846 3300005336 Bacteria 2648
10 Ga0070680_100268632 3300005336 Bacteria 1444
11 Ga0070682_100023933 3300005337 Bacteria 3630
12 Ga0068868_100022106 3300005338 Bacteria 4797
13 Ga0068868_100028079 3300005338 Bacteria 4298
14 Ga0070660_100083786 3300005339 Bacteria 2505
15 Ga0070660_100193599 3300005339 Bacteria 1647
16 Ga0070660_100312760 3300005339 Bacteria 1289
17 Ga0070689_100035339 3300005340 Bacteria 3819
18 Ga0070689_100067212 3300005340 Bacteria 2794
19 Ga0070691_10003885 3300005341 Bacteria 6756
20 Ga0070687_100039290 3300005343 Bacteria 2377
21 Ga0070661_100124564 3300005344 Bacteria 1932
22 Ga0070661_100127487 3300005344 Bacteria 1910
23 Ga0070661_100244880 3300005344 Bacteria 1382
24 Ga0070692_10015974 3300005345 Bacteria 3562
25 Ga0070668_100002619 3300005347 Bacteria 13224
26 Ga0070669_100028156 3300005353 Bacteria 4046
27 Ga0070669_100143168 3300005353 Bacteria 1845
28 Ga0070675_100021574 3300005354 Bacteria 5147
29 Ga0070675_100040279 3300005354 Bacteria 3813
30 Ga0070671_100001223 3300005355 Bacteria 19238
31 Ga0070671_100052648 3300005355 Bacteria 3384
32 Ga0070674_100138047 3300005356 Bacteria 1826
33 Ga0070673_100039965 3300005364 Bacteria 3595
34 Ga0070688_100013880 3300005365 Bacteria 4555
35 Ga0070688_100088998 3300005365 Bacteria 2014
36 Ga0070659_100028629 3300005366 Bacteria 4304
37 Ga0070667_100126994 3300005367 Bacteria 2223
38 Ga0070709_10012420 3300005434 Bacteria 4768
39 Ga0070709_10043704 3300005434 Bacteria 2772
40 Ga0070714_100045551 3300005435 Bacteria 3718
41 Ga0070714_100122110 3300005435 Bacteria 2318
42 Ga0070714_100217013 3300005435 Bacteria 1756
43 Ga0070713_100190559 3300005436 Bacteria 1847
44 Ga0070710_10069486 3300005437 Bacteria 2026
45 Ga0070711_100014641 3300005439 Bacteria 4944
46 Ga0070705_100050422 3300005440 Bacteria 2422
47 Ga0070708_100112758 3300005445 Bacteria 2501
48 Ga0070663_100003519 3300005455 Bacteria 9035
49 Ga0070678_100052831 3300005456 Bacteria 2952
50 Ga0070678_100109845 3300005456 Bacteria 2155
51 Ga0070678_100132353 3300005456 Bacteria 1983
52 Ga0070662_100008259 3300005457 Bacteria 6780
53 Ga0070662_100256438 3300005457 Bacteria 1408
54 Ga0070681_10007623 3300005458 Bacteria 10580
55 Ga0070685_10015183 3300005466 Bacteria 4089
56 Ga0070685_10064562 3300005466 Bacteria 2153
57 Ga0070679_100071181 3300005530 Bacteria 3468
58 Ga0070679_100253468 3300005530 Bacteria 1716
59 Ga0070684_100053581 3300005535 Bacteria 3513
60 Ga0068853_100015552 3300005539 Bacteria 6250
61 Ga0068853_100126048 3300005539 Bacteria 2287
62 Ga0070672_100021237 3300005543 Bacteria 4747
63 Ga0070672_100045342 3300005543 Bacteria 3400
64 Ga0070696_100450549 3300005546 Bacteria 1015
65 Ga0070693_100004019 3300005547 Bacteria 6915
66 Ga0070693_100028202 3300005547 Bacteria 3050
67 Ga0070665_100013864 3300005548 Bacteria 8107
68 Ga0068855_100003880 3300005563 Bacteria 18270
69 Ga0068855_100010555 3300005563 Bacteria 11138
70 Ga0068855_100011274 3300005563 Bacteria 10795
71 Ga0070664_100001438 3300005564 Bacteria 18981
72 Ga0068857_100027337 3300005577 Bacteria 5032
73 Ga0068854_100006803 3300005578 Bacteria 7288
74 Ga0068856_100032630 3300005614 Bacteria 5099
75 Ga0068856_100068491 3300005614 Bacteria 3508
76 Ga0070702_100000604 3300005615 Bacteria 13188
77 Ga0070702_100140268 3300005615 Bacteria 1539
78 Ga0068852_100017290 3300005616 Bacteria 5654
79 Ga0068859_100005325 3300005617 Bacteria 13084
80 Ga0068859_100272187 3300005617 Bacteria 1786
81 Ga0068864_100041414 3300005618 Bacteria 3939
82 Ga0068864_100167457 3300005618 Bacteria 2001
83 Ga0068861_100003996 3300005719 Bacteria 9877
84 Ga0068851_10126860 3300005834 Bacteria 1376
85 Ga0068870_10000494 3300005840 Bacteria 14926
86 Ga0068870_10008060 3300005840 Bacteria 4720
87 Ga0068863_100022275 3300005841 Bacteria 6049
88 Ga0068858_100018367 3300005842 Bacteria 6549
89 Ga0068860_100016012 3300005843 Bacteria 7315
90 Ga0068860_100056510 3300005843 Bacteria 3730
91 Ga0068862_100180755 3300005844 Bacteria 1893
92 Ga0068862_100544666 3300005844 Bacteria 1107
93 Ga0081455_10003341 3300005937 Bacteria 18499
94 Ga0081455_10003470 3300005937 Bacteria 18116
95 Ga0081455_10064237 3300005937 Bacteria 3075
96 Ga0081538_10000007 3300005981 Bacteria 175313
97 Ga0081538_10000631 3300005981 Bacteria 39014
98 Ga0081538_10010345 3300005981 Bacteria 7654
99 Ga0081540_1000710 3300005983 Bacteria 30907
100 Ga0081539_10000489 3300005985 Bacteria 83671
101 Ga0070715_10006458 3300006163 Bacteria 3990
102 Ga0070716_100069728 3300006173 Bacteria 2061
103 Ga0070712_100067635 3300006175 Bacteria 2542
104 Ga0070712_100330994 3300006175 Bacteria 1241
105 Ga0097621_100023391 3300006237 Bacteria 4811
106 Ga0097621_100383003 3300006237 Bacteria 1257
107 Ga0075430_100009958 3300006846 Bacteria 8041
108 Ga0075430_100079246 3300006846 Bacteria 2753
109 Ga0075431_100000897 3300006847 Bacteria 26266
110 Ga0075431_100007266 3300006847 Bacteria 11026
111 Ga0075431_100010699 3300006847 Bacteria 9219
112 Ga0075431_100020036 3300006847 Bacteria 6830
113 Ga0075431_100459629 3300006847 Bacteria 1268
114 Ga0075431_100470348 3300006847 Bacteria 1251
115 Ga0075433_10104408 3300006852 Bacteria 2511
116 Ga0075434_100001471 3300006871 Bacteria 19825
117 Ga0075434_100014299 3300006871 Bacteria 7585
118 Ga0075429_100004574 3300006880 Bacteria 11888
119 Ga0075429_100099583 3300006880 Bacteria 2536
120 Ga0068865_100047251 3300006881 Bacteria 2956
121 Ga0068865_100180977 3300006881 Bacteria 1623
122 Ga0075436_100111158 3300006914 Bacteria 1913
123 Ga0097620_100005325 3300006931 Bacteria 13084
124 Ga0097620_100272195 3300006931 Bacteria 1786
125 Ga0075435_100001727 3300007076 Bacteria 14199
126 Ga0075435_100041120 3300007076 Bacteria 3694
127 Ga0105240_10168185 3300009093 Bacteria 2599
128 Ga0111539_10002896 3300009094 Bacteria 22784
129 Ga0111539_10008294 3300009094 Bacteria 13226
130 Ga0111539_10023611 3300009094 Bacteria 7557
131 Ga0111539_10148238 3300009094 Bacteria 2747
132 Ga0105245_10006200 3300009098 Bacteria 10518
133 Ga0105245_10035908 3300009098 Bacteria 4401
134 Ga0105245_10080946 3300009098 Bacteria 2967
135 Ga0105247_10012827 3300009101 Bacteria 5029
136 Ga0105247_10044279 3300009101 Bacteria 2729
137 Ga0114129_10031646 3300009147 Bacteria 7478
138 Ga0114129_10121853 3300009147 Bacteria 3588
139 Ga0114129_10744150 3300009147 Bacteria 1256
140 Ga0105241_10002679 3300009174 Bacteria 13347
141 Ga0105241_10034224 3300009174 Bacteria 3816
142 Ga0105242_10017706 3300009176 Bacteria 5557
143 Ga0105248_10039158 3300009177 Bacteria 5308
144 Ga0105248_10461996 3300009177 Bacteria 1431
145 Ga0105237_10014748 3300009545 Bacteria 8156
146 Ga0105237_10032203 3300009545 Bacteria 5309
147 Ga0105237_10392439 3300009545 Bacteria 1393
148 Ga0105238_10220831 3300009551 Bacteria 1871
149 Ga0105249_10012716 3300009553 Bacteria 7419
150 Ga0105249_10259312 3300009553 Bacteria 1727
151 Ga0105239_10026577 3300010375 Bacteria 6371
152 Ga0105239_10116277 3300010375 Bacteria 2968
153 Ga0105246_10000743 3300011119 Bacteria 18528
154 Ga0105246_10137876 3300011119 Bacteria 1830
155 Ga0157373_10154093 3300013100 Bacteria 1617
156 Ga0157371_10026108 3300013102 Bacteria 4249
157 Ga0157370_10183963 3300013104 Bacteria 1941
158 Ga0157369_10236569 3300013105 Bacteria 1908
159 Ga0157374_10092255 3300013296 Bacteria 2889
160 Ga0163162_10023522 3300013306 Bacteria 6081
161 Ga0157372_10020892 3300013307 Bacteria 7067
162 Ga0157375_10098065 3300013308 Bacteria 3006
163 Ga0157375_10115261 3300013308 Bacteria 2790
164 Ga0163163_10003531 3300014325 Bacteria 13282
165 Ga0182008_10005453 3300014497 Bacteria 7243
166 Ga0182008_10013302 3300014497 Bacteria 4327
167 Ga0157379_10066279 3300014968 Bacteria 3228
168 Ga0163161_10004981 3300017792 Bacteria 9242
169 Ga0206356_10344641 3300020070 Bacteria 1885
170 Ga0207656_10039533 3300025321 Bacteria 1995
171 Ga0207688_10000271 3300025901 Bacteria 23580
172 Ga0207688_10007946 3300025901 Bacteria 5770
173 Ga0207688_10099883 3300025901 Bacteria 1674
174 Ga0207647_10080030 3300025904 Bacteria 1960
175 Ga0207643_10000443 3300025908 Bacteria 27022
176 Ga0207705_10035239 3300025909 Bacteria 3581
177 Ga0207654_10007942 3300025911 Bacteria 5349
178 Ga0207654_10040600 3300025911 Bacteria 2623
179 Ga0207707_10062102 3300025912 Bacteria 3251
180 Ga0207695_10164698 3300025913 Bacteria 2146
181 Ga0207671_10078859 3300025914 Bacteria 2467
182 Ga0207693_10000914 3300025915 Bacteria 26485
183 Ga0207662_10055227 3300025918 Bacteria 2370
184 Ga0207662_10070481 3300025918 Bacteria 2114
185 Ga0207657_10004397 3300025919 Bacteria 14909
186 Ga0207657_10053653 3300025919 Bacteria 3491
187 Ga0207649_10002268 3300025920 Bacteria 10819
188 Ga0207652_10049244 3300025921 Bacteria 3606
189 Ga0207652_10220586 3300025921 Bacteria 1709
190 Ga0207681_10045310 3300025923 Bacteria 2952
191 Ga0207681_10123758 3300025923 Bacteria 1901
192 Ga0207694_10053137 3300025924 Bacteria 3141
193 Ga0207650_10001732 3300025925 Bacteria 15512
194 Ga0207650_10159489 3300025925 Bacteria 1786
195 Ga0207659_10008282 3300025926 Bacteria 6446
196 Ga0207659_10119616 3300025926 Bacteria 2016
197 Ga0207687_10004820 3300025927 Bacteria 8970
198 Ga0207687_10006085 3300025927 Bacteria 7988
199 Ga0207700_10074926 3300025928 Bacteria 2620
200 Ga0207664_10030231 3300025929 Bacteria 4136
201 Ga0207664_10116044 3300025929 Bacteria 2233
202 Ga0207664_10255077 3300025929 Bacteria 1532
203 Ga0207644_10016649 3300025931 Bacteria 4949
204 Ga0207706_10016036 3300025933 Bacteria 6772
205 Ga0207706_10067254 3300025933 Bacteria 3152
206 Ga0207686_10026222 3300025934 Bacteria 3399
207 Ga0207686_10318959 3300025934 Bacteria 1160
208 Ga0207670_10123418 3300025936 Bacteria 1886
209 Ga0207704_10097197 3300025938 Bacteria 1952
210 Ga0207665_10001407 3300025939 Bacteria 16190
211 Ga0207665_10067759 3300025939 Bacteria 2431
212 Ga0207691_10023211 3300025940 Bacteria 5842
213 Ga0207691_10057090 3300025940 Bacteria 3554
214 Ga0207689_10001802 3300025942 Bacteria 20226
215 Ga0207661_10003755 3300025944 Bacteria 10572
216 Ga0207661_10047479 3300025944 Bacteria 3409
217 Ga0207679_10001328 3300025945 Bacteria 15634
218 Ga0207679_10016363 3300025945 Bacteria 4925
219 Ga0207667_10009549 3300025949 Bacteria 11416
220 Ga0207667_10010006 3300025949 Bacteria 11121
221 Ga0207651_10009626 3300025960 Bacteria 5305
222 Ga0207651_10174031 3300025960 Bacteria 1701
223 Ga0207651_10541286 3300025960 Bacteria 1011
224 Ga0207712_10002047 3300025961 Bacteria 13232
225 Ga0207668_10019763 3300025972 Bacteria 4265
226 Ga0207640_10282190 3300025981 Bacteria 1305
227 Ga0207658_10194667 3300025986 Bacteria 1688
228 Ga0207677_10002172 3300026023 Bacteria 10306
229 Ga0207677_10020705 3300026023 Bacteria 4000
230 Ga0207703_10056686 3300026035 Bacteria 3192
231 Ga0207678_10001529 3300026067 Bacteria 21228
232 Ga0207678_10031398 3300026067 Bacteria 4633
233 Ga0207708_10014797 3300026075 Bacteria 5840
234 Ga0207702_10001472 3300026078 Bacteria 23350
235 Ga0207702_10115174 3300026078 Bacteria 2397
236 Ga0207641_10080606 3300026088 Bacteria 2824
237 Ga0207648_10160163 3300026089 Bacteria 1988
238 Ga0207676_10001142 3300026095 Bacteria 20012
239 Ga0207676_10360919 3300026095 Bacteria 1346
240 Ga0207674_10018463 3300026116 Bacteria 7579
241 Ga0207674_10383718 3300026116 Bacteria 1358
242 Ga0207675_100258502 3300026118 Bacteria 1687
243 Ga0207683_10004887 3300026121 Bacteria 11538
244 Ga0207683_10047907 3300026121 Bacteria 3742
245 Ga0207683_10162532 3300026121 Bacteria 2020
246 Ga0207698_10173243 3300026142 Bacteria 1903
247 Ga0207428_10001258 3300027907 Bacteria 27141
248 Ga0207428_10011917 3300027907 Bacteria 7654
249 Ga0268266_10021257 3300028379 Bacteria 5528
250 Ga0268266_10144750 3300028379 Bacteria 2136
251 Ga0268265_10052821 3300028380 Bacteria 3076
252 Ga0268265_10372050 3300028380 Bacteria 1312
253 Ga0307413_10246604 3300031824 Bacteria 1322
254 Ga0307410_10030398 3300031852 Bacteria 3452
255 Ga0326468_10000094 3300031889 Bacteria 7752
256 Ga0307406_10119559 3300031901 Bacteria 1829
257 Ga0307407_10016464 3300031903 Bacteria 3681
258 Ga0307412_10022549 3300031911 Bacteria 3862
259 Ga0307414_10050947 3300032004 Bacteria 2871
260 Ga0307411_10029739 3300032005 Bacteria 3341
261 Ga0307415_100022074 3300032126 Bacteria 3923
262 Ga0373938_0016097 3300034957 Bacteria 1457
263 Ga0373940_0001891 3300035088 Bacteria 3942
264 Ga0373932_0007906 3300035112 Bacteria 2538
265 Ga0373942_0023626 3300035207 Bacteria 1571
266 Ga0373925_0318399 3300037068 Bacteria 1258
267 Ga0395901_0301872 3300038443 Bacteria 1660
268 Ga0395901_0351212 3300038443 Bacteria 1522
269 Ga0400483_014030 3300039062 Bacteria 3950
270 Ga0400483_246168 3300039062 Bacteria 8497
271 Ga0436365_1314030 3300039437 Bacteria 7439
272 Ga0439448_0031852 3300042005 Bacteria 1676
273 Ga0439463_013615 3300042016 Bacteria 2003
274 Ga0439463_022321 3300042016 Bacteria 1584
275 Ga0439459_0003720 3300042438 Bacteria 2433
276 Ga0466965_0105144 3300044683 Bacteria 1447
277 Ga0466961_0021520 3300044693 Bacteria 4150
278 Ga0466961_0119987 3300044693 Bacteria 1651
279 Ga0466963_0000733 3300044694 Bacteria 16137
280 Ga0466963_0005231 3300044694 Bacteria 7578
281 Ga0466963_0006466 3300044694 Bacteria 6932
282 Ga0466963_0036296 3300044694 Bacteria 3214
283 Ga0466963_0136635 3300044694 Bacteria 1697
284 Ga0466963_0195347 3300044694 Bacteria 1414
285 Ga0466964_0003472 3300044706 Bacteria 5753
286 Ga0466970_0140941 3300044765 Bacteria 1328
287 Ga0466957_0060363 3300044842 Bacteria 2325
288 Ga0466960_0022647 3300044901 Bacteria 2811
289 Ga0466960_0133049 3300044901 Bacteria 1315
290 Ga0466959_0202090 3300045049 Bacteria 1383
291 Ga0466958_0000842 3300045836 Bacteria 13605
292 Ga0466967_0002731 3300045976 Bacteria 11157
293 Ga0466967_0010007 3300045976 Bacteria 7082
294 Ga0466967_0025779 3300045976 Bacteria 4853
295 Ga0466967_0032829 3300045976 Bacteria 4388
296 Ga0466967_0037108 3300045976 Bacteria 4167
297 Ga0466967_0037942 3300045976 Bacteria 4128
298 Ga0466967_0105709 3300045976 Bacteria 2579
299 Ga0466967_0206601 3300045976 Bacteria 1861
300 Ga0466967_0273931 3300045976 Bacteria 1618
301 Ga0495592_0033437 3300046454 Bacteria 3878
302 Ga0495618_0304041 3300046514 Unclassified 991
303 Ga0495609_0047802 3300046538 Bacteria 1914
304 Ga0495674_0124292 3300047319 Bacteria 2178
305 Ga0496100_0013482 3300048903 Bacteria 4716
306 Ga0496100_0128706 3300048903 Bacteria 1780
307 Ga0496101_0076332 3300048904 Bacteria 2468
308 Ga0496102_0042499 3300048905 Bacteria 4119
309 Ga0496102_0049697 3300048905 Bacteria 3816
310 Ga0496102_0094234 3300048905 Bacteria 2774
311 Ga0496102_0318968 3300048905 Bacteria 1464
312 Ga0496102_0606009 3300048905 Bacteria 1018
313 Ga0496103_0105114 3300048906 Bacteria 1790
314 Ga0496104_0046364 3300048907 Bacteria 4093
315 Ga0496105_0017295 3300048908 Bacteria 5777
316 Ga0496105_0113371 3300048908 Bacteria 2237
317 Ga0496105_0284582 3300048908 Bacteria 1332
318 Ga0496106_0001577 3300048909 Bacteria 17141
319 Ga0496106_0008457 3300048909 Bacteria 7616
320 Ga0496107_0015836 3300048910 Bacteria 5289
321 Ga0496107_0048383 3300048910 Bacteria 3063
322 Ga0496108_0014815 3300048911 Bacteria 6361
323 Ga0496109_0003843 3300048912 Bacteria 12544
324 Ga0496109_0150424 3300048912 Bacteria 2179
325 Ga0496109_0443168 3300048912 Bacteria 1227
326 Ga0496110_0007063 3300048913 Bacteria 8935
327 Ga0496110_0353995 3300048913 Bacteria 1337
328 Ga0496111_0001371 3300048914 Bacteria 13808
329 Ga0496111_0022558 3300048914 Bacteria 4409
330 Ga0496112_0038265 3300048915 Bacteria 4683
331 Ga0496112_0048418 3300048915 Bacteria 4167
332 Ga0496113_0077229 3300048916 Bacteria 2546
333 Ga0496114_0054225 3300048917 Bacteria 3343
334 Ga0496115_0044554 3300048918 Bacteria 3539
335 Ga0501031_0032965 3300049568 Bacteria 3378
336 Ga0501039_0290839 3300049575 Bacteria 1284
337 Ga0501040_0002378 3300049576 Bacteria 12089
338 Ga0501041_0044616 3300049577 Bacteria 2694
339 Ga0501048_0006010 3300049582 Bacteria 9244
340 Ga0501067_0044369 3300049583 Bacteria 2470
341 Ga0501071_0029683 3300049587 Bacteria 3861
342 Ga0501072_0006610 3300049588 Bacteria 8823
343 Ga0501072_0120947 3300049588 Bacteria 2086
344 Ga0501075_0005211 3300049591 Bacteria 8889
345 Ga0501075_0031882 3300049591 Bacteria 3915
346 Ga0501076_0003685 3300049592 Bacteria 10773
347 Ga0501077_0008224 3300049593 Bacteria 6450
348 Ga0501079_0001681 3300049741 Bacteria 15735
349 Ga0501079_0073256 3300049741 Bacteria 2647
350 Ga0501081_0038829 3300049743 Bacteria 3255
351 Ga0501083_0050009 3300049744 Bacteria 2815
352 Ga0501045_0143099 3300049824 Bacteria 1778
353 Ga0501045_0322273 3300049824 Bacteria 1150
354 nmdc:mga06z11_109199_c1 3300050494 Bacteria 1529
355 nmdc:mga05p37_128_c1 3300050507 Bacteria 69414
356 nmdc:mga05p37_32526_c1 3300050507 Bacteria 6379
357 nmdc:mga09592_210531_c1 3300050508 Bacteria 1684
358 nmdc:mga09592_441_c1 3300050508 Bacteria 30631
359 nmdc:mga0qj67_20903_c1 3300050509 Bacteria 5015
360 nmdc:mga0qj67_22389_c1 3300050509 Bacteria 4854
361 nmdc:mga0qj67_224186_c1 3300050509 Bacteria 1526
362 nmdc:mga0qj67_289506_c1 3300050509 Bacteria 1328
363 nmdc:mga06r32_179_c1 3300050510 Bacteria 49581
364 nmdc:mga06r32_25427_c1 3300050510 Bacteria 5509
365 nmdc:mga06r32_431593_c1 3300050510 Bacteria 1298
366 nmdc:mga06r32_440776_c1 3300050510 Bacteria 1283
367 nmdc:mga06r32_674_c1 3300050510 Bacteria 29761
368 nmdc:mga06r32_72364_c1 3300050510 Bacteria 3338
369 nmdc:mga08y16_11185_c1 3300050511 Bacteria 9427
370 nmdc:mga08y16_11275_c1 3300050511 Bacteria 9390
371 nmdc:mga08y16_18276_c1 3300050511 Bacteria 7386
372 nmdc:mga08y16_277781_c1 3300050511 Bacteria 1728
373 nmdc:mga08y16_73552_c1 3300050511 Bacteria 3562
374 nmdc:mga0n895_577522_c1 3300050512 Bacteria 1128
375 nmdc:mga0n895_8557_c1 3300050512 Bacteria 8871
376 nmdc:mga0rr50_21344_c1 3300050513 Bacteria 4419
377 nmdc:mga0rr50_21871_c1 3300050513 Bacteria 4377
378 nmdc:mga0rr50_7149_c1 3300050513 Bacteria 6859
379 nmdc:mga08x19_11280_c1 3300050514 Bacteria 5380
380 nmdc:mga0a205_148548_c1 3300050515 Bacteria 2244
381 Ga0500588_0005695 3300053146 Bacteria 2780
382 Ga0466962_0198869 3300061719 Bacteria 979
383 Ga0530510_0020662 3300061734 Bacteria 4681
384 Ga0530510_0038764 3300061734 Bacteria 3441
385 2816507439 2816332139 Bacteria 9138787
386 2870789989 2870782633 Bacteria 9624083
387 3006327511 3006321560 Bacteria 8247479
388 Ga0307408_100072181
389 Ga0070658_10001262
390 Ga0070658_10079930
391 Ga0070676_10020614
392 Ga0070690_100033459
393 Ga0070670_100004007
394 Ga0070670_100363101
395 Ga0068869_100000969
396 Ga0070680_100082846
397 Ga0070680_100268632
398 Ga0070682_100023933
399 Ga0068868_100022106
400 Ga0068868_100028079
401 Ga0070660_100083786
402 Ga0070660_100193599
403 Ga0070660_100312760
404 Ga0070689_100035339
405 Ga0070689_100067212
406 Ga0070691_10003885
407 Ga0070687_100039290
408 Ga0070661_100124564
409 Ga0070661_100127487
410 Ga0070661_100244880
411 Ga0070692_10015974
412 Ga0070668_100002619
413 Ga0070669_100028156
414 Ga0070669_100143168
415 Ga0070675_100021574
416 Ga0070675_100040279
417 Ga0070671_100001223
418 Ga0070671_100052648
419 Ga0070674_100138047
420 Ga0070673_100039965
421 Ga0070688_100013880
422 Ga0070688_100088998
423 Ga0070659_100028629
424 Ga0070667_100126994
425 Ga0070709_10012420
426 Ga0070709_10043704
427 Ga0070714_100045551
428 Ga0070714_100122110
429 Ga0070714_100217013
430 Ga0070713_100190559
431 Ga0070710_10069486
432 Ga0070711_100014641
433 Ga0070705_100050422
434 Ga0070708_100112758
435 Ga0070663_100003519
436 Ga0070678_100052831
437 Ga0070678_100109845
438 Ga0070678_100132353
439 Ga0070662_100008259
440 Ga0070662_100256438
441 Ga0070681_10007623
442 Ga0070685_10015183
443 Ga0070685_10064562
444 Ga0070679_100071181
445 Ga0070679_100253468
446 Ga0070684_100053581
447 Ga0068853_100015552
448 Ga0068853_100126048
449 Ga0070672_100021237
450 Ga0070672_100045342
451 Ga0070696_100450549
452 Ga0070693_100004019
453 Ga0070693_100028202
454 Ga0070665_100013864
455 Ga0068855_100003880
456 Ga0068855_100010555
457 Ga0068855_100011274
458 Ga0070664_100001438
459 Ga0068857_100027337
460 Ga0068854_100006803
461 Ga0068856_100032630
462 Ga0068856_100068491
463 Ga0070702_100000604
464 Ga0070702_100140268
465 Ga0068852_100017290
466 Ga0068859_100005325
467 Ga0068859_100272187
468 Ga0068864_100041414
469 Ga0068864_100167457
470 Ga0068861_100003996
471 Ga0068851_10126860
472 Ga0068870_10000494
473 Ga0068870_10008060
474 Ga0068863_100022275
475 Ga0068858_100018367
476 Ga0068860_100016012
477 Ga0068860_100056510
478 Ga0068862_100180755
479 Ga0068862_100544666
480 Ga0081455_10003341
481 Ga0081455_10003470
482 Ga0081455_10064237
483 Ga0081538_10000007
484 Ga0081538_10000631
485 Ga0081538_10010345
486 Ga0081540_1000710
487 Ga0081539_10000489
488 Ga0070715_10006458
489 Ga0070716_100069728
490 Ga0070712_100067635
491 Ga0070712_100330994
492 Ga0097621_100023391
493 Ga0097621_100383003
494 Ga0075430_100009958
495 Ga0075430_100079246
496 Ga0075431_100000897
497 Ga0075431_100007266
498 Ga0075431_100010699
499 Ga0075431_100020036
500 Ga0075431_100459629
501 Ga0075431_100470348
502 Ga0075433_10104408
503 Ga0075434_100001471
504 Ga0075434_100014299
505 Ga0075429_100004574
506 Ga0075429_100099583
507 Ga0068865_100047251
508 Ga0068865_100180977
509 Ga0075436_100111158
510 Ga0097620_100005325
511 Ga0097620_100272195
512 Ga0075435_100001727
513 Ga0075435_100041120
514 Ga0105240_10168185
515 Ga0111539_10002896
516 Ga0111539_10008294
517 Ga0111539_10023611
518 Ga0111539_10148238
519 Ga0105245_10006200
520 Ga0105245_10035908
521 Ga0105245_10080946
522 Ga0105247_10012827
523 Ga0105247_10044279
524 Ga0114129_10031646
525 Ga0114129_10121853
526 Ga0114129_10744150
527 Ga0105241_10002679
528 Ga0105241_10034224
529 Ga0105242_10017706
530 Ga0105248_10039158
531 Ga0105248_10461996
532 Ga0105237_10014748
533 Ga0105237_10032203
534 Ga0105237_10392439
535 Ga0105238_10220831
536 Ga0105249_10012716
537 Ga0105249_10259312
538 Ga0105239_10026577
539 Ga0105239_10116277
540 Ga0105246_10000743
541 Ga0105246_10137876
542 Ga0157373_10154093
543 Ga0157371_10026108
544 Ga0157370_10183963
545 Ga0157369_10236569
546 Ga0157374_10092255
547 Ga0163162_10023522
548 Ga0157372_10020892
549 Ga0157375_10098065
550 Ga0157375_10115261
551 Ga0163163_10003531
552 Ga0182008_10005453
553 Ga0182008_10013302
554 Ga0157379_10066279
555 Ga0163161_10004981
556 Ga0206356_10344641
557 Ga0207656_10039533
558 Ga0207688_10000271
559 Ga0207688_10007946
560 Ga0207688_10099883
561 Ga0207647_10080030
562 Ga0207643_10000443
563 Ga0207705_10035239
564 Ga0207654_10007942
565 Ga0207654_10040600
566 Ga0207707_10062102
567 Ga0207695_10164698
568 Ga0207671_10078859
569 Ga0207693_10000914
570 Ga0207662_10055227
571 Ga0207662_10070481
572 Ga0207657_10004397
573 Ga0207657_10053653
574 Ga0207649_10002268
575 Ga0207652_10049244
576 Ga0207652_10220586
577 Ga0207681_10045310
578 Ga0207681_10123758
579 Ga0207694_10053137
580 Ga0207650_10001732
581 Ga0207650_10159489
582 Ga0207659_10008282
583 Ga0207659_10119616
584 Ga0207687_10004820
585 Ga0207687_10006085
586 Ga0207700_10074926
587 Ga0207664_10030231
588 Ga0207664_10116044
589 Ga0207664_10255077
590 Ga0207644_10016649
591 Ga0207706_10016036
592 Ga0207706_10067254
593 Ga0207686_10026222
594 Ga0207686_10318959
595 Ga0207670_10123418
596 Ga0207704_10097197
597 Ga0207665_10001407
598 Ga0207665_10067759
599 Ga0207691_10023211
600 Ga0207691_10057090
601 Ga0207689_10001802
602 Ga0207661_10003755
603 Ga0207661_10047479
604 Ga0207679_10001328
605 Ga0207679_10016363
606 Ga0207667_10009549
607 Ga0207667_10010006
608 Ga0207651_10009626
609 Ga0207651_10174031
610 Ga0207651_10541286
611 Ga0207712_10002047
612 Ga0207668_10019763
613 Ga0207640_10282190
614 Ga0207658_10194667
615 Ga0207677_10002172
616 Ga0207677_10020705
617 Ga0207703_10056686
618 Ga0207678_10001529
619 Ga0207678_10031398
620 Ga0207708_10014797
621 Ga0207702_10001472
622 Ga0207702_10115174
623 Ga0207641_10080606
624 Ga0207648_10160163
625 Ga0207676_10001142
626 Ga0207676_10360919
627 Ga0207674_10018463
628 Ga0207674_10383718
629 Ga0207675_100258502
630 Ga0207683_10004887
631 Ga0207683_10047907
632 Ga0207683_10162532
633 Ga0207698_10173243
634 Ga0207428_10001258
635 Ga0207428_10011917
636 Ga0268266_10021257
637 Ga0268266_10144750
638 Ga0268265_10052821
639 Ga0268265_10372050
640 Ga0307413_10246604
641 Ga0307410_10030398
642 Ga0326468_10000094
643 Ga0307406_10119559
644 Ga0307407_10016464
645 Ga0307412_10022549
646 Ga0307414_10050947
647 Ga0307411_10029739
648 Ga0307415_100022074
649 Ga0373938_0016097
650 Ga0373940_0001891
651 Ga0373932_0007906
652 Ga0373942_0023626
653 Ga0373925_0318399
654 Ga0395901_0301872
655 Ga0395901_0351212
656 Ga0400483_014030
657 Ga0400483_246168
658 Ga0436365_1314030
659 Ga0439448_0031852
660 Ga0439463_013615
661 Ga0439463_022321
662 Ga0439459_0003720
663 Ga0466965_0105144
664 Ga0466961_0021520
665 Ga0466961_0119987
666 Ga0466963_0000733
667 Ga0466963_0005231
668 Ga0466963_0006466
669 Ga0466963_0036296
670 Ga0466963_0136635
671 Ga0466963_0195347
672 Ga0466964_0003472
673 Ga0466970_0140941
674 Ga0466957_0060363
675 Ga0466960_0022647
676 Ga0466960_0133049
677 Ga0466959_0202090
678 Ga0466958_0000842
679 Ga0466967_0002731
680 Ga0466967_0010007
681 Ga0466967_0025779
682 Ga0466967_0032829
683 Ga0466967_0037108
684 Ga0466967_0037942
685 Ga0466967_0105709
686 Ga0466967_0206601
687 Ga0466967_0273931
688 Ga0495592_0033437
689 Ga0495618_0304041
690 Ga0495609_0047802
691 Ga0495674_0124292
692 Ga0496100_0013482
693 Ga0496100_0128706
694 Ga0496101_0076332
695 Ga0496102_0042499
696 Ga0496102_0049697
697 Ga0496102_0094234
698 Ga0496102_0318968
699 Ga0496102_0606009
700 Ga0496103_0105114
701 Ga0496104_0046364
702 Ga0496105_0017295
703 Ga0496105_0113371
704 Ga0496105_0284582
705 Ga0496106_0001577
706 Ga0496106_0008457
707 Ga0496107_0015836
708 Ga0496107_0048383
709 Ga0496108_0014815
710 Ga0496109_0003843
711 Ga0496109_0150424
712 Ga0496109_0443168
713 Ga0496110_0007063
714 Ga0496110_0353995
715 Ga0496111_0001371
716 Ga0496111_0022558
717 Ga0496112_0038265
718 Ga0496112_0048418
719 Ga0496113_0077229
720 Ga0496114_0054225
721 Ga0496115_0044554
722 Ga0501031_0032965
723 Ga0501039_0290839
724 Ga0501040_0002378
725 Ga0501041_0044616
726 Ga0501048_0006010
727 Ga0501067_0044369
728 Ga0501071_0029683
729 Ga0501072_0006610
730 Ga0501072_0120947
731 Ga0501075_0005211
732 Ga0501075_0031882
733 Ga0501076_0003685
734 Ga0501077_0008224
735 Ga0501079_0001681
736 Ga0501079_0073256
737 Ga0501081_0038829
738 Ga0501083_0050009
739 Ga0501045_0143099
740 Ga0501045_0322273
741 nmdc:mga06z11_109199_c1
742 nmdc:mga05p37_128_c1
743 nmdc:mga05p37_32526_c1
744 nmdc:mga09592_210531_c1
745 nmdc:mga09592_441_c1
746 nmdc:mga0qj67_20903_c1
747 nmdc:mga0qj67_22389_c1
748 nmdc:mga0qj67_224186_c1
749 nmdc:mga0qj67_289506_c1
750 nmdc:mga06r32_179_c1
751 nmdc:mga06r32_25427_c1
752 nmdc:mga06r32_431593_c1
753 nmdc:mga06r32_440776_c1
754 nmdc:mga06r32_674_c1
755 nmdc:mga06r32_72364_c1
756 nmdc:mga08y16_11185_c1
757 nmdc:mga08y16_11275_c1
758 nmdc:mga08y16_18276_c1
759 nmdc:mga08y16_277781_c1
760 nmdc:mga08y16_73552_c1
761 nmdc:mga0n895_577522_c1
762 nmdc:mga0n895_8557_c1
763 nmdc:mga0rr50_21344_c1
764 nmdc:mga0rr50_21871_c1
765 nmdc:mga0rr50_7149_c1
766 nmdc:mga08x19_11280_c1
767 nmdc:mga0a205_148548_c1
768 Ga0500588_0005695
769 Ga0466962_0198869
770 Ga0530510_0020662
771 Ga0530510_0038764
772 2816507439
773 2870789989
774 3006327511

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

125

178

0.96

PF04542

Sigma70_r2

Sigma-70 region 2

24

91

0.93

PF12680

SnoaL_2

SnoaL-like domain

196

300

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9354 114 163
2h27-assembly2.cif.gz_D crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna 0.9345 114 166
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.928 114 163
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.9214 108 165
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9116 114 164
ID Description Score Start End Superfamily
1or7A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9503 114 165 1.10.10.10
af_P0AGB6_121_191_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9469 114 165 1.10.10.10
af_P9WGH3_4_93_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9446 5 81 1.10.1740.10
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9354 114 163 1.10.10.10
2h27D00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9345 114 166 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W3ZLP2-F1-model_v4 RNA polymerase sigma-70 factor 0.9686 179 293 GO:0016987
AF-A0A656KVT4-F1-model_v4 deleted 0.9635 175 293
AF-A0A7Y4HW88-F1-model_v4 Uncharacterized protein 0.9393 191 308 GO:0016987
AF-A0A7W3ZLP2-F1-model_v4 RNA polymerase sigma-70 factor 0.9292 179 293 GO:0016987
AF-A0A2V7J9K7-F1-model_v4 SnoaL-like domain-containing protein 0.9082 182 297 GO:0016987

Map