metagRoot

F430755

General Info

Members	Datasets	Scaffolds	Average Seq Length
387	285	347	193

Family's Representative Sequence

Representative Sequence	3300005457\|Ga0070662_100250081\|Ga0070662_1002500811
Length	223
Sequence	VQGTTIWENVSYSAVLALRLQSDVRTRMSDRILVFYGSYRSNRQGIRLAEYLVRAFQGRGEDAELIDAKAVGLPILDRMYKEYPRGDAPVALEVLAGKIRAADAFVFVTGEYNWGIQPGLKNLTDHFLEEWFWRPAAIASYSAGRFSGARAALAWHGTLSEMGMVVISSSLAVGGIGNSFDTEGNPSGEGGASLARAFPRFADDLAWWSEAARVQRGRKAPPY

Samples

	Sample ID	Description	Type	Environment
1	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
2	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
3	2599185354	Sphingomonas sp. NFR15	Isolate	Rhizoplane
4	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
5	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
6	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
7	2751185897	Sphingomonas panacis DCY99	Isolate	Unclassified
8	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
9	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
10	2830075706	Sphingomonas jinjuensis DSM 21457	Isolate	Rhizosphere
11	2848297114	Croceibacterium ferulae EGI 63111	Isolate	Unclassified
12	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
13	2882806704	Pelagerythrobacter rhizovicinus AY-3R	Isolate	Rhizosphere
14	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
15	2885429604	Sphingomonas sp. WZY 27	Isolate	Rhizosphere
16	2903748898	Bradyrhizobium uaiense UFLA 03-164	Isolate	Nodule
17	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
18	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
19	2906610324
20	2908739725	Bradyrhizobium sp. UFLA03-84	Isolate	Nodule
21	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
22	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
23	2928027323	Sphingomonas sp. 1185	Isolate	Unclassified
24	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
25	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
26	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
27	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
28	2984555340	Sphingomonas sp. SORGH_AS789	Isolate	Aerial Root
29	2984564862	Sphingomonas sp. SORGH_AS870	Isolate	Aerial Root
30	2993356040	Sphingomonas sp. SORGH_AS742	Isolate	Aerial Root
31	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
32	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
33	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
34	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
35	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
36	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
37	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
38	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
39	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
40	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
41	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
42	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
43	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
44	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
45	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
46	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
47	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
48	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
49	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
50	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
51	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
52	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
53	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
54	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
55	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
56	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
57	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
58	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
59	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
60	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
61	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
62	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
63	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
64	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
65	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
66	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
67	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
68	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
69	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
70	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
71	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
72	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
73	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
74	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
75	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
76	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
77	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
78	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
79	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
80	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
81	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
82	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
83	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
85	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
87	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
88	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
89	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
90	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
91	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
92	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
93	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
94	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
95	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
96	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
97	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
98	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
99	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
100	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
101	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
102	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
103	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
104	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
105	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
106	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
107	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
108	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
109	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
110	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
111	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
112	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
113	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
114	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
115	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
116	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
117	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
118	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
119	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
120	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
121	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
122	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
123	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
124	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
125	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
126	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
127	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
128	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
158	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
159	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
160	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
161	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
162	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
163	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
164	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
165	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
166	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
167	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
168	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
169	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
170	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
171	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
172	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
173	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
174	3300033546	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2	Metagenome	Unclassified
175	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
176	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
177	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
178	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
179	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
180	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
181	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
182	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
183	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
184	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
185	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
186	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
187	3300041441	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG	Metagenome	Rhizoplane
188	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
189	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
190	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
191	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
192	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
193	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
194	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
195	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
196	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
197	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
198	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
199	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
200	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
201	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
202	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
203	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
204	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
205	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
206	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
207	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
208	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
209	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
210	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
211	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
212	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
213	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
214	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
215	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
216	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
217	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
218	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
219	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
220	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
221	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
222	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
223	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
224	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
225	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
226	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
227	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
228	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
229	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
230	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
231	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
232	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
233	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
234	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
235	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
236	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
237	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
238	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
239	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
240	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
241	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
242	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
243	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
244	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
245	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
246	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
247	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
248	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
249	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
250	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
251	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
252	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
253	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
254	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
255	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
256	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
257	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
258	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
259	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
260	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
261	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
262	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
263	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
264	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
265	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
266	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
267	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
268	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
269	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
270	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
271	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
272	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
273	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
274	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
275	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
276	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
277	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
278	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
279	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
280	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
281	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
282	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
283	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
284	8054563764	Acuticoccus kalidii M5D2P5	Isolate	Unclassified
285	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	89.64
Metatranscriptomes	0.26
Isolates	10.1

Biome Distribution

Category	Percentage (%)
Aerial Root	0.78
Bulb	0
Endosphere	10.59
Nodule	4.39
Rhizoplane	10.08
Rhizosphere	60.21
Stem	0
Stem Tuber	0
Unclassified	13.95

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24736J21556_1008100	3300001904	Bacteria	1750
2	JGI24740J21852_10019393	3300001979	Bacteria	2395
3	JGI24740J21852_10026889	3300001979	Bacteria	1921
4	JGI24735J21928_10037746	3300002067	Bacteria	1415
5	JGI24750J21931_1000216	3300002070	Bacteria	9795
6	JGI25155J39150_1000011	3300002704	Bacteria	207685
7	JGI25156J39149_1000030	3300002705	Bacteria	126029
8	JGI25154J39366_1000289	3300002738	Bacteria	30213
9	JGI25157J39369_1000010	3300002741	Bacteria	207685
10	JGI25153J46596_10009181	3300003215	Bacteria	4630
11	rootH1_10051085	3300003316	Bacteria	5908
12	rootL2_10075208	3300003322	Bacteria	17065
13	rootH1_10126725	3300003323	Bacteria	3119
14	JGI25160J50197_1000438	3300003354	Bacteria	26112
15	Ga0006562J51391_1138168	3300003578	Bacteria	1830
16	Ga0055542_1027555	3300003762	Bacteria	755
17	Ga0070690_100000552	3300005330	Bacteria	18704
18	Ga0070666_10000834	3300005335	Bacteria	18704
19	Ga0068868_100411872	3300005338	Bacteria	1169
20	Ga0070661_100057150	3300005344	Bacteria	2859
21	Ga0070668_100513968	3300005347	Bacteria	1038
22	Ga0070671_100019201	3300005355	Bacteria	5561
23	Ga0070671_100213061	3300005355	Bacteria	1638
24	Ga0070659_100215650	3300005366	Bacteria	1583
25	Ga0070667_100061433	3300005367	Bacteria	3181
26	Ga0070667_100389993	3300005367	Bacteria	1266
27	Ga0070714_100368527	3300005435	Bacteria	1352
28	Ga0070714_100608473	3300005435	Bacteria	1050
29	Ga0070662_100242658	3300005457	Bacteria	1446
30	Ga0070662_100250081	3300005457	Bacteria	1425
31	Ga0070697_100319461	3300005536	Bacteria	1337
32	Ga0068853_100049124	3300005539	Bacteria	3624
33	Ga0068853_100558995	3300005539	Bacteria	1084
34	Ga0070686_100000181	3300005544	Bacteria	44461
35	Ga0070686_100166271	3300005544	Bacteria	1556
36	Ga0068855_100071123	3300005563	Bacteria	4046
37	Ga0068855_100984436	3300005563	Bacteria	887
38	Ga0068857_100296693	3300005577	Bacteria	1489
39	Ga0068854_100038281	3300005578	Bacteria	3372
40	Ga0068854_100270772	3300005578	Bacteria	1363
41	Ga0068856_100642905	3300005614	Bacteria	1081
42	Ga0068864_100001179	3300005618	Bacteria	21773
43	Ga0068851_10043386	3300005834	Bacteria	2267
44	Ga0068863_100041119	3300005841	Bacteria	4394
45	Ga0068860_100002491	3300005843	Bacteria	19318
46	Ga0081455_10005754	3300005937	Bacteria	13514
47	Ga0081455_10023030	3300005937	Bacteria	5806
48	Ga0081540_1000696	3300005983	Bacteria	31330
49	Ga0081540_1002504	3300005983	Bacteria	14939
50	Ga0081540_1002715	3300005983	Bacteria	14396
51	Ga0081540_1022165	3300005983	Bacteria	3754
52	Ga0081540_1046880	3300005983	Bacteria	2178
53	Ga0070717_10172259	3300006028	Bacteria	1883
54	Ga0075365_10089884	3300006038	Bacteria	2091
55	Ga0075368_10006565	3300006042	Bacteria	4071
56	Ga0075364_10038775	3300006051	Bacteria	3087
57	Ga0070712_100834728	3300006175	Bacteria	792
58	Ga0075362_10030775	3300006177	Bacteria	2318
59	Ga0075367_10049473	3300006178	Bacteria	2478
60	Ga0075367_10085121	3300006178	Bacteria	1918
61	Ga0075367_10240517	3300006178	Bacteria	1134
62	Ga0075369_10214467	3300006186	Bacteria	890
63	Ga0075428_100013659	3300006844	Bacteria	9041
64	Ga0075430_100022864	3300006846	Bacteria	5316
65	Ga0075431_100095472	3300006847	Bacteria	3069
66	Ga0105240_10813477	3300009093	Bacteria	1011
67	Ga0111539_10780437	3300009094	Bacteria	1112
68	Ga0105247_10040606	3300009101	Bacteria	2844
69	Ga0114129_10507925	3300009147	Bacteria	1573
70	Ga0114129_10619901	3300009147	Bacteria	1399
71	Ga0105243_10389165	3300009148	Bacteria	1292
72	Ga0105241_10544036	3300009174	Bacteria	1042
73	Ga0105241_10902847	3300009174	Bacteria	820
74	Ga0105242_10368785	3300009176	Bacteria	1331
75	Ga0105237_10092228	3300009545	Bacteria	3019
76	Ga0105237_10934423	3300009545	Bacteria	874
77	Ga0105238_11051905	3300009551	Bacteria	836
78	Ga0105249_10000491	3300009553	Bacteria	36562
79	Ga0105249_10162260	3300009553	Bacteria	2161
80	Ga0105239_10568983	3300010375	Bacteria	1291
81	Ga0105246_10477025	3300011119	Bacteria	1054
82	Ga0157347_1000100	3300012502	Bacteria	4074
83	Ga0157373_10569187	3300013100	Bacteria	823
84	Ga0157371_10184831	3300013102	Bacteria	1491
85	Ga0157370_10004072	3300013104	Bacteria	16944
86	Ga0157370_10250821	3300013104	Bacteria	1637
87	Ga0157369_10115444	3300013105	Bacteria	2851
88	Ga0157369_10331881	3300013105	Bacteria	1580
89	Ga0157369_10390817	3300013105	Bacteria	1443
90	Ga0157369_10426087	3300013105	Bacteria	1375
91	Ga0157374_10118313	3300013296	Bacteria	2555
92	Ga0157378_10250229	3300013297	Bacteria	1696
93	Ga0157378_11296867	3300013297	Bacteria	769
94	Ga0163162_10066160	3300013306	Bacteria	3663
95	Ga0163162_10082085	3300013306	Bacteria	3295
96	Ga0157372_10258112	3300013307	Bacteria	2024
97	Ga0157372_10672647	3300013307	Bacteria	1205
98	Ga0157375_10212640	3300013308	Bacteria	2091
99	Ga0163163_10273180	3300014325	Bacteria	1741
100	Ga0163163_10334289	3300014325	Bacteria	1570
101	Ga0157380_10078430	3300014326	Bacteria	2694
102	Ga0182008_10005077	3300014497	Bacteria	7560
103	Ga0157377_10013172	3300014745	Bacteria	4180
104	Ga0157379_10008943	3300014968	Bacteria	8729
105	Ga0157379_10055003	3300014968	Bacteria	3556
106	Ga0157376_10098356	3300014969	Bacteria	2551
107	Ga0163161_10001202	3300017792	Bacteria	19511
108	Ga0213876_10005315	3300021384	Bacteria	7087
109	Ga0213876_10164617	3300021384	Bacteria	1180
110	Ga0213875_10000746	3300021388	Bacteria	24600
111	Ga0209435_100022	3300025206	Bacteria	207766
112	Ga0207425_1013051	3300025245	Bacteria	1929
113	Ga0209646_1000078	3300025246	Bacteria	207766
114	Ga0209026_1000065	3300025250	Bacteria	207766
115	Ga0209677_100235	3300025253	Bacteria	38918
116	Ga0209148_1005482	3300025254	Bacteria	2903
117	Ga0209759_1000055	3300025256	Bacteria	207766
118	Ga0209129_1005789	3300025258	Bacteria	4228
119	Ga0209233_1010528	3300025261	Bacteria	2766
120	Ga0209233_1029581	3300025261	Bacteria	1300
121	Ga0209455_1019411	3300025272	Bacteria	1374
122	Ga0209673_1094329	3300025273	Bacteria	656
123	Ga0209025_1035813	3300025294	Bacteria	2234
124	Ga0209564_1018860	3300025295	Bacteria	2605
125	Ga0209758_1000677	3300025297	Bacteria	50824
126	Ga0209758_1012862	3300025297	Bacteria	4635
127	Ga0209758_1020866	3300025297	Bacteria	3078
128	Ga0207426_1000465	3300025302	Bacteria	62583
129	Ga0207697_10225125	3300025315	Bacteria	828
130	Ga0207680_10000041	3300025903	Bacteria	69609
131	Ga0207647_10001460	3300025904	Bacteria	18169
132	Ga0207705_10163707	3300025909	Bacteria	1672
133	Ga0207654_10072793	3300025911	Bacteria	2047
134	Ga0207695_10281816	3300025913	Bacteria	1556
135	Ga0207695_10590070	3300025913	Bacteria	992
136	Ga0207671_10185701	3300025914	Bacteria	1620
137	Ga0207693_10720845	3300025915	Bacteria	772
138	Ga0207663_10693844	3300025916	Bacteria	806
139	Ga0207657_10410583	3300025919	Bacteria	1065
140	Ga0207657_10671637	3300025919	Bacteria	806
141	Ga0207649_10036684	3300025920	Bacteria	2955
142	Ga0207694_10126871	3300025924	Bacteria	2042
143	Ga0207664_10456125	3300025929	Bacteria	1141
144	Ga0207644_10000091	3300025931	Bacteria	65055
145	Ga0207644_10005752	3300025931	Bacteria	8066
146	Ga0207644_10179911	3300025931	Bacteria	1656
147	Ga0207706_10009033	3300025933	Bacteria	9172
148	Ga0207665_10077243	3300025939	Bacteria	2285
149	Ga0207667_10067217	3300025949	Bacteria	3734
150	Ga0207712_10000158	3300025961	Bacteria	69863
151	Ga0207668_10904565	3300025972	Bacteria	785
152	Ga0207640_10024203	3300025981	Bacteria	3661
153	Ga0207640_10370489	3300025981	Bacteria	1157
154	Ga0207658_10001022	3300025986	Bacteria	22750
155	Ga0207639_10010000	3300026041	Bacteria	6557
156	Ga0207639_10218763	3300026041	Bacteria	1644
157	Ga0207702_10475891	3300026078	Bacteria	1215
158	Ga0207641_10003461	3300026088	Bacteria	13981
159	Ga0207641_10061173	3300026088	Bacteria	3211
160	Ga0207676_10000275	3300026095	Bacteria	44782
161	Ga0207676_10366152	3300026095	Bacteria	1337
162	Ga0207674_10078471	3300026116	Bacteria	3307
163	Ga0207698_10115721	3300026142	Bacteria	2258
164	Ga0209371_1002778	3300027312	Bacteria	9364
165	Ga0268264_10000350	3300028381	Bacteria	69863
166	Ga0265326_10048348	3300028558	Bacteria	1206
167	Ga0265323_10001030	3300028653	Bacteria	14493
168	Ga0265336_10000400	3300028666	Bacteria	27273
169	Ga0307515_10015791	3300028794	Bacteria	13888
170	Ga0307515_10256193	3300028794	Bacteria	1494
171	Ga0265338_10000086	3300028800	Bacteria	175026
172	Ga0265338_10023661	3300028800	Bacteria	6303
173	Ga0265338_10149408	3300028800	Bacteria	1817
174	Ga0265324_10007350	3300029957	Bacteria	4474
175	Ga0268256_1002606	3300030500	Bacteria	8997
176	Ga0265332_10146258	3300031238	Bacteria	989
177	Ga0265331_10087547	3300031250	Bacteria	1442
178	Ga0265327_10002374	3300031251	Bacteria	20045
179	Ga0265316_10767328	3300031344	Bacteria	677
180	Ga0307408_100083383	3300031548	Bacteria	2395
181	Ga0307408_100487217	3300031548	Bacteria	1077
182	Ga0265314_10008398	3300031711	Bacteria	8852
183	Ga0265314_10147620	3300031711	Bacteria	1446
184	Ga0265314_10179892	3300031711	Bacteria	1268
185	Ga0265342_10046655	3300031712	Bacteria	2603
186	Ga0307405_10594152	3300031731	Bacteria	902
187	Ga0307407_10628533	3300031903	Bacteria	802
188	Ga0307412_10005746	3300031911	Bacteria	6974
189	Ga0307412_10322903	3300031911	Bacteria	1229
190	Ga0316213_1002759	3300033546	Bacteria	1173
191	Ga0373934_0048768	3300035086	Bacteria	1677
192	Ga0373927_0013174	3300035695	Bacteria	5500
193	Ga0373933_0142597	3300035724	Bacteria	1513
194	Ga0373933_0476446	3300035724	Bacteria	817
195	Ga0373947_0050599	3300035725	Bacteria	2498
196	Ga0373925_0124374	3300037068	Bacteria	2005
197	Ga0395899_0269286	3300037312	Bacteria	1162
198	Ga0395900_0010914	3300037418	Bacteria	9289
199	Ga0395900_0133542	3300037418	Bacteria	2543
200	Ga0395905_0024427	3300037471	Bacteria	5704
201	Ga0395905_0086978	3300037471	Bacteria	2930
202	Ga0395905_0090356	3300037471	Bacteria	2871
203	Ga0436364_1517900	3300037853	Bacteria	925
204	Ga0395901_0021900	3300038443	Bacteria	6551
205	Ga0395901_0134527	3300038443	Bacteria	2598
206	Ga0395901_0384566	3300038443	Bacteria	1444
207	Ga0436365_0156697	3300039437	Bacteria	4513
208	Ga0436365_0847903	3300039437	Bacteria	26153
209	Ga0436365_0998128	3300039437	Bacteria	1867
210	Ga0436365_1011890	3300039437	Bacteria	7432
211	Ga0436361_0077742	3300039447	Bacteria	1056
212	Ga0436361_0339641	3300039447	Bacteria	7680
213	Ga0436361_0346057	3300039447	Bacteria	1550
214	Ga0436361_1210139	3300039447	Bacteria	887
215	Ga0451787_795675	3300041441	Bacteria	1189
216	Ga0451807_1614537	3300041486	Bacteria	848
217	Ga0451843_0666075	3300041509	Bacteria	710
218	Ga0439435_0040132	3300042436	Bacteria	1306
219	Ga0466972_0166955	3300044658	Bacteria	1033
220	Ga0466963_0008188	3300044694	Bacteria	6265
221	Ga0466963_0030197	3300044694	Bacteria	3495
222	Ga0466968_0022640	3300044735	Bacteria	2555
223	Ga0466968_0077532	3300044735	Bacteria	1456
224	Ga0466970_0004466	3300044765	Bacteria	6894
225	Ga0466957_0039313	3300044842	Bacteria	2854
226	Ga0466957_0118452	3300044842	Bacteria	1686
227	Ga0466957_0385058	3300044842	Bacteria	957
228	Ga0466958_0101727	3300045836	Bacteria	1787
229	Ga0466967_0002820	3300045976	Bacteria	11023
230	Ga0466967_0067432	3300045976	Bacteria	3192
231	Ga0495603_0076845	3300046455	Bacteria	1959
232	Ga0495629_0504065	3300046459	Bacteria	816
233	Ga0495638_0196580	3300046460	Bacteria	1141
234	Ga0495582_0280682	3300046473	Bacteria	956
235	Ga0495639_0131306	3300046475	Bacteria	1199
236	Ga0495639_0152359	3300046475	Bacteria	1116
237	Ga0495662_0283336	3300046476	Bacteria	816
238	Ga0495652_0817945	3300046529	Bacteria	619
239	Ga0495640_0017473	3300046533	Eukaryota	5347
240	Ga0495656_0320743	3300046615	Bacteria	798
241	Ga0495668_0577077	3300046616	Bacteria	621
242	Ga0495625_0198619	3300046660	Bacteria	1325
243	Ga0495625_0481375	3300046660	Bacteria	762
244	Ga0495599_0175869	3300046678	Bacteria	1320
245	Ga0495613_0014383	3300046689	Eukaryota	5873
246	Ga0495589_0111991	3300046794	Bacteria	1317
247	Ga0495604_0222890	3300047317	Bacteria	1297
248	Ga0495604_0444648	3300047317	Eukaryota	848
249	Ga0495674_0183463	3300047319	Bacteria	1742
250	Ga0495676_0172702	3300047321	Bacteria	1520
251	Ga0495680_0277744	3300047322	Unclassified	1181
252	Ga0495675_0250135	3300047444	Bacteria	1065
253	Ga0495684_0300364	3300047471	Bacteria	1153
254	Ga0495593_0462924	3300047673	Bacteria	635
255	Ga0496101_0371332	3300048904	Bacteria	1125
256	Ga0496101_0700595	3300048904	Bacteria	799
257	Ga0496102_0093860	3300048905	Bacteria	2780
258	Ga0496102_1137032	3300048905	Bacteria	700
259	Ga0496103_0000395	3300048906	Bacteria	38785
260	Ga0496103_0081911	3300048906	Bacteria	2030
261	Ga0496104_0000457	3300048907	Bacteria	35201
262	Ga0496104_0006343	3300048907	Bacteria	10402
263	Ga0496104_0038845	3300048907	Bacteria	4455
264	Ga0496105_0000327	3300048908	Bacteria	31177
265	Ga0496105_0055156	3300048908	Bacteria	3281
266	Ga0496106_0070150	3300048909	Bacteria	2676
267	Ga0496106_0074102	3300048909	Bacteria	2605
268	Ga0496106_0637365	3300048909	Bacteria	852
269	Ga0496108_0030183	3300048911	Bacteria	4493
270	Ga0496108_0041167	3300048911	Bacteria	3855
271	Ga0496108_0085577	3300048911	Bacteria	2676
272	Ga0496109_0180861	3300048912	Bacteria	1980
273	Ga0496109_0187648	3300048912	Bacteria	1942
274	Ga0496109_0198656	3300048912	Bacteria	1885
275	Ga0496110_0071215	3300048913	Bacteria	3082
276	Ga0496110_0205593	3300048913	Bacteria	1789
277	Ga0496111_0096838	3300048914	Bacteria	2166
278	Ga0496111_0134108	3300048914	Bacteria	1833
279	Ga0496111_0281611	3300048914	Bacteria	1233
280	Ga0496111_0339351	3300048914	Bacteria	1112
281	Ga0496112_0039593	3300048915	Bacteria	4607
282	Ga0496112_0247325	3300048915	Bacteria	1735
283	Ga0496113_0036327	3300048916	Bacteria	3609
284	Ga0496113_0085057	3300048916	Bacteria	2429
285	Ga0496113_0142496	3300048916	Bacteria	1886
286	Ga0496113_0398689	3300048916	Bacteria	1105
287	Ga0496114_0070535	3300048917	Bacteria	2935
288	Ga0496115_0299624	3300048918	Bacteria	1317
289	Ga0496116_0000486	3300048919	Bacteria	54596
290	Ga0496117_0000824	3300048920	Bacteria	48048
291	Ga0496117_0037901	3300048920	Bacteria	3584
292	Ga0496117_0060594	3300048920	Bacteria	2607
293	Ga0496117_0225324	3300048920	Bacteria	1040
294	Ga0496118_0000133	3300048921	Bacteria	131319
295	Ga0496118_0054753	3300048921	Bacteria	3018
296	Ga0496119_0022909	3300048922	Bacteria	4450
297	Ga0496121_0001109	3300048924	Bacteria	47457
298	Ga0496121_0024555	3300048924	Bacteria	5759
299	Ga0496122_0001328	3300048925	Bacteria	40504
300	Ga0496122_0022224	3300048925	Bacteria	5646
301	Ga0496123_0005663	3300048926	Bacteria	12474
302	Ga0496123_0051370	3300048926	Bacteria	2746
303	Ga0496124_0000903	3300048927	Bacteria	48007
304	Ga0496124_0083907	3300048927	Bacteria	2613
305	Ga0496125_0047260	3300048928	Bacteria	3601
306	Ga0496125_0055634	3300048928	Bacteria	3221
307	Ga0496126_0072884	3300048929	Bacteria	3054
308	Ga0496126_0186655	3300048929	Bacteria	1758
309	Ga0501034_0432318	3300049571	Bacteria	1236
310	Ga0501037_0061136	3300049573	Bacteria	2747
311	Ga0501038_0363575	3300049574	Bacteria	1125
312	Ga0501039_0641879	3300049575	Bacteria	831
313	Ga0501041_0435298	3300049577	Bacteria	832
314	Ga0501042_0567355	3300049578	Bacteria	825
315	Ga0501046_0003677	3300049580	Bacteria	14051
316	Ga0501047_1013051	3300049581	Bacteria	644
317	Ga0501067_0533285	3300049583	Bacteria	657
318	Ga0501072_0590758	3300049588	Bacteria	876
319	Ga0501079_0718020	3300049741	Bacteria	787
320	Ga0501044_0855044	3300049823	Bacteria	786
321	Ga0501045_1084393	3300049824	Bacteria	586
322	nmdc:mga03n38_419516_c1	3300050490	Bacteria	740
323	nmdc:mga00v17_170588_c1	3300050491	Bacteria	1403
324	nmdc:mga00v17_183033_c1	3300050491	Bacteria	1352
325	nmdc:mga0yw44_655528_c1	3300050492	Bacteria	713
326	nmdc:mga04h51_8629_c1	3300050495	Bacteria	2731
327	nmdc:mga05p37_319907_c1	3300050507	Bacteria	1837
328	nmdc:mga09592_1040939_c1	3300050508	Bacteria	683
329	nmdc:mga0qj67_171085_c1	3300050509	Bacteria	1764
330	nmdc:mga06r32_270409_c1	3300050510	Bacteria	1687
331	nmdc:mga06r32_668942_c1	3300050510	Bacteria	1005
332	nmdc:mga08y16_454635_c1	3300050511	Bacteria	1306
333	nmdc:mga08x19_912371_c1	3300050514	Bacteria	624
334	nmdc:mga0a205_617505_c1	3300050515	Bacteria	937
335	nmdc:mga0sz30_28056_c1	3300050516	Bacteria	1903
336	nmdc:mga0sz30_39138_c1	3300050516	Bacteria	1989
337	Ga0495601_0524477	3300053077	Bacteria	763
338	Ga0495619_0130661	3300053085	Bacteria	1726
339	Ga0500578_0027441	3300053086	Bacteria	3656
340	Ga0500578_0348626	3300053086	Bacteria	866
341	Ga0500647_0153729	3300053091	Bacteria	1072
342	Ga0500554_001195	3300053102	Bacteria	5035
343	Ga0500572_000416	3300053111	Bacteria	14982
344	Ga0500603_051098	3300053150	Bacteria	1131
345	Ga0500616_0024398	3300053153	Bacteria	3360
346	Ga0500619_000193	3300053154	Bacteria	14285
347	Ga0500645_004209	3300053730	Bacteria	5595

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005338	Ga0068868_100411872	Ga0068868_1004118723	180
2	3300005435	Ga0070714_100608473	Ga0070714_1006084732	180
3	3300005544	Ga0070686_100166271	Ga0070686_1001662711	180
4	3300009094	Ga0111539_10780437	Ga0111539_107804372	180
5	3300009101	Ga0105247_10040606	Ga0105247_100406062	180
6	3300009147	Ga0114129_10619901	Ga0114129_106199011	180
7	3300009148	Ga0105243_10389165	Ga0105243_103891653	180
8	3300009174	Ga0105241_10902847	Ga0105241_109028471	180
9	3300009176	Ga0105242_10368785	Ga0105242_103687852	180
10	3300009545	Ga0105237_10092228	Ga0105237_100922283	180
11	3300009553	Ga0105249_10162260	Ga0105249_101622603	180
12	3300010375	Ga0105239_10568983	Ga0105239_105689831	180
13	3300011119	Ga0105246_10477025	Ga0105246_104770252	180
14	3300013100	Ga0157373_10569187	Ga0157373_105691871	180
15	3300013102	Ga0157371_10184831	Ga0157371_101848313	180
16	3300013105	Ga0157369_10115444	Ga0157369_101154443	180
17	3300013296	Ga0157374_10118313	Ga0157374_101183132	180
18	3300013297	Ga0157378_10250229	Ga0157378_102502293	180
19	3300013306	Ga0163162_10066160	Ga0163162_100661603	180
20	3300013307	Ga0157372_10258112	Ga0157372_102581122	180
21	3300013308	Ga0157375_10212640	Ga0157375_102126402	180
22	3300014325	Ga0163163_10273180	Ga0163163_102731803	180
23	3300014326	Ga0157380_10078430	Ga0157380_100784304	180
24	3300014745	Ga0157377_10013172	Ga0157377_100131725	180
25	3300014968	Ga0157379_10055003	Ga0157379_100550035	180
26	3300014969	Ga0157376_10098356	Ga0157376_100983564	180
27	3300035695	Ga0373927_0013174	Ga0373927_0013174_4112_4654	180
28	3300035724	Ga0373933_0142597	Ga0373933_0142597_699_1241	180
29	3300035725	Ga0373947_0050599	Ga0373947_0050599_222_764	180
30	3300037068	Ga0373925_0124374	Ga0373925_0124374_1351_1893	180
31	3300039447	Ga0436361_0346057	Ga0436361_0346057_541_1083	180
32	3300041441	Ga0451787_795675	Ga0451787_795675_23_565	180
33	3300041509	Ga0451843_0666075	Ga0451843_0666075_133_675	180
34	3300046455	Ga0495603_0076845	Ga0495603_0076845_129_671	180
35	3300046473	Ga0495582_0280682	Ga0495582_0280682_161_703	180
36	3300046529	Ga0495652_0817945	Ga0495652_0817945_10_552	180
37	3300046616	Ga0495668_0577077	Ga0495668_0577077_14_556	180
38	3300046660	Ga0495625_0198619	Ga0495625_0198619_64_606	180
39	3300047319	Ga0495674_0183463	Ga0495674_0183463_1190_1732	180
40	3300047321	Ga0495676_0172702	Ga0495676_0172702_210_752	180
41	3300047471	Ga0495684_0300364	Ga0495684_0300364_162_704	180
42	3300047673	Ga0495593_0462924	Ga0495593_0462924_43_585	180
43	3300048904	Ga0496101_0371332	Ga0496101_0371332_503_1045	180
44	3300048904	Ga0496101_0700595	Ga0496101_0700595_75_617	180
45	3300048905	Ga0496102_0093860	Ga0496102_0093860_1192_1734	180
46	3300048905	Ga0496102_1137032	Ga0496102_1137032_72_614	180
47	3300048906	Ga0496103_0081911	Ga0496103_0081911_1100_1642	180
48	3300048907	Ga0496104_0006343	Ga0496104_0006343_7299_7841	180
49	3300048907	Ga0496104_0038845	Ga0496104_0038845_874_1416	180
50	3300048908	Ga0496105_0055156	Ga0496105_0055156_314_856	180
51	3300048909	Ga0496106_0070150	Ga0496106_0070150_636_1178	180
52	3300048909	Ga0496106_0074102	Ga0496106_0074102_1679_2221	180
53	3300048911	Ga0496108_0030183	Ga0496108_0030183_3399_3941	180
54	3300048911	Ga0496108_0041167	Ga0496108_0041167_2548_3090	180
55	3300048912	Ga0496109_0180861	Ga0496109_0180861_654_1196	180
56	3300048912	Ga0496109_0187648	Ga0496109_0187648_63_605	180
57	3300048913	Ga0496110_0071215	Ga0496110_0071215_2034_2576	180
58	3300048913	Ga0496110_0205593	Ga0496110_0205593_158_700	180
59	3300048914	Ga0496111_0134108	Ga0496111_0134108_505_1047	180
60	3300048914	Ga0496111_0281611	Ga0496111_0281611_385_927	180
61	3300048916	Ga0496113_0036327	Ga0496113_0036327_3004_3546	180
62	3300048916	Ga0496113_0142496	Ga0496113_0142496_759_1301	180
63	3300048916	Ga0496113_0398689	Ga0496113_0398689_220_810	180
64	3300048917	Ga0496114_0070535	Ga0496114_0070535_424_966	180
65	3300048918	Ga0496115_0299624	Ga0496115_0299624_82_624	180
66	3300048929	Ga0496126_0186655	Ga0496126_0186655_755_1345	180
67	3300049578	Ga0501042_0567355	Ga0501042_0567355_249_791	180
68	3300049588	Ga0501072_0590758	Ga0501072_0590758_315_857	180
69	3300049741	Ga0501079_0718020	Ga0501079_0718020_23_565	180
70	3300049824	Ga0501045_1084393	Ga0501045_1084393_31_573	180
71	3300050492	nmdc:mga0yw44_655528_c1	nmdc:mga0yw44_655528_c1_26_568	180
72	3300050507	nmdc:mga05p37_319907_c1	nmdc:mga05p37_319907_c1_151_693	180
73	3300050508	nmdc:mga09592_1040939_c1	nmdc:mga09592_1040939_c1_33_575	180
74	3300050510	nmdc:mga06r32_270409_c1	nmdc:mga06r32_270409_c1_770_1312	180
75	3300050511	nmdc:mga08y16_454635_c1	nmdc:mga08y16_454635_c1_263_805	180
76	3300050514	nmdc:mga08x19_912371_c1	nmdc:mga08x19_912371_c1_44_586	180
77	3300050515	nmdc:mga0a205_617505_c1	nmdc:mga0a205_617505_c1_221_763	180
78	3300053102	Ga0500554_001195	Ga0500554_001195_4473_5018	180
79	3300031711	Ga0265314_10008398	Ga0265314_100083984	181
80	3300041486	Ga0451807_1614537	Ga0451807_1614537_128_745	181
81	3300046794	Ga0495589_0111991	Ga0495589_0111991_602_1192	181
82	3300053153	Ga0500616_0024398	Ga0500616_0024398_827_1417	185
83	3300053154	Ga0500619_000193	Ga0500619_000193_4637_5227	187
84	iso_pu_bacteria	2513237102	2513705678	189
85	3300005563	Ga0068855_100984436	Ga0068855_1009844362	190
86	3300013104	Ga0157370_10004072	Ga0157370_1000407217	190
87	3300014497	Ga0182008_10005077	Ga0182008_100050778	190
88	3300046615	Ga0495656_0320743	Ga0495656_0320743_60_650	190
89	iso_pu_bacteria	2582581315	2585323977	192
90	iso_pu_bacteria	2599185354	2600202622	192
91	iso_pu_bacteria	2615840698	2616556537	192
92	iso_pu_bacteria	2667528174	2671115792	192
93	iso_pu_bacteria	2667528175	2671120368	192
94	iso_pu_bacteria	2751185897	2753764417	192
95	iso_pu_bacteria	2775507266	2778176531	192
96	iso_pu_bacteria	2818991448	2819610352	192
97	iso_pu_bacteria	2830075706	2830077601	192
98	iso_pu_bacteria	2848297114	2848299828	192
99	iso_pu_bacteria	2874620515	2874621078	192
100	iso_pu_bacteria	2882806704	2882806890	192
101	iso_pu_bacteria	2885374607	2885380570	192
102	iso_pu_bacteria	2885429604	2885431789	192
103	iso_pu_bacteria	2903748898	2903749305	192
104	iso_pu_bacteria	2904666416	2904673300	192
105	iso_pu_bacteria	2904690495	2904695829	192
106	iso_pu_bacteria	2906610324	2906618638	192
107	iso_pu_bacteria	2908739725	2908742684	192
108	iso_pu_bacteria	2908756301	2908761130	192
109	iso_pu_bacteria	2922386360	2922390964	192
110	iso_pu_bacteria	2928027323	2928028122	192
111	iso_pu_bacteria	2935630451	2935631653	192
112	iso_pu_bacteria	2941507105	2941511447	192
113	iso_pu_bacteria	2941515067	2941519148	192
114	iso_pu_bacteria	2941523033	2941526272	192
115	iso_pu_bacteria	2984555340	2984558451	192
116	iso_pu_bacteria	2984564862	2984567142	192
117	iso_pu_bacteria	2993356040	2993358233	192
118	iso_pu_bacteria	3005416602	3005420290	192
119	iso_pu_bacteria	3005474847	3005480222	192
120	iso_pu_bacteria	8005314921	8005317241	192
121	iso_pu_bacteria	8005484373	8005486697	192
122	iso_pu_bacteria	8005645114	8005646163	192
123	iso_pu_bacteria	8005682033	8005686293	192
124	iso_pu_bacteria	8006964411	8006965181	192
125	iso_pu_bacteria	8019555841	8019556735	192
126	iso_pu_bacteria	8054563764	8054566158	192
127	iso_pu_bacteria	8056673599	8056673874	192
128	3300038443	Ga0395901_0021900	Ga0395901_0021900_859_1443	194
129	3300038443	Ga0395901_0384566	Ga0395901_0384566_312_896	194
130	3300031238	Ga0265332_10146258	Ga0265332_101462582	195
131	3300031548	Ga0307408_100083383	Ga0307408_1000833833	195
132	3300046460	Ga0495638_0196580	Ga0495638_0196580_78_665	195
133	3300053091	Ga0500647_0153729	Ga0500647_0153729_475_1062	195
134	3300001904	JGI24736J21556_1008100	JGI24736J21556_10081002	196
135	3300001979	JGI24740J21852_10019393	JGI24740J21852_100193931	196
136	3300001979	JGI24740J21852_10026889	JGI24740J21852_100268891	196
137	3300002067	JGI24735J21928_10037746	JGI24735J21928_100377462	196
138	3300002070	JGI24750J21931_1000216	JGI24750J21931_100021612	196
139	3300002704	JGI25155J39150_1000011	JGI25155J39150_1000011198	196
140	3300002705	JGI25156J39149_1000030	JGI25156J39149_1000030112	196
141	3300002738	JGI25154J39366_1000289	JGI25154J39366_100028920	196
142	3300002741	JGI25157J39369_1000010	JGI25157J39369_100001014	196
143	3300003215	JGI25153J46596_10009181	JGI25153J46596_100091812	196
144	3300003316	rootH1_10051085	rootH1_100510856	196
145	3300003322	rootL2_10075208	rootL2_100752087	196
146	3300003323	rootH1_10126725	rootH1_101267252	196
147	3300003354	JGI25160J50197_1000438	JGI25160J50197_100043819	196
148	3300003578	Ga0006562J51391_1138168	Ga0006562J51391_11381682	196
149	3300003762	Ga0055542_1027555	Ga0055542_10275551	196
150	3300005330	Ga0070690_100000552	Ga0070690_1000005522	196
151	3300005335	Ga0070666_10000834	Ga0070666_100008342	196
152	3300005344	Ga0070661_100057150	Ga0070661_1000571504	196
153	3300005347	Ga0070668_100513968	Ga0070668_1005139682	196
154	3300005355	Ga0070671_100019201	Ga0070671_1000192019	196
155	3300005355	Ga0070671_100213061	Ga0070671_1002130612	196
156	3300005366	Ga0070659_100215650	Ga0070659_1002156503	196
157	3300005367	Ga0070667_100061433	Ga0070667_1000614332	196
158	3300005367	Ga0070667_100389993	Ga0070667_1003899931	196
159	3300005435	Ga0070714_100368527	Ga0070714_1003685272	196
160	3300005457	Ga0070662_100242658	Ga0070662_1002426582	196
161	3300005457	Ga0070662_100250081	Ga0070662_1002500811	196
162	3300005536	Ga0070697_100319461	Ga0070697_1003194612	196
163	3300005539	Ga0068853_100049124	Ga0068853_1000491243	196
164	3300005539	Ga0068853_100558995	Ga0068853_1005589951	196
165	3300005544	Ga0070686_100000181	Ga0070686_1000001813	196
166	3300005563	Ga0068855_100071123	Ga0068855_1000711232	196
167	3300005577	Ga0068857_100296693	Ga0068857_1002966932	196
168	3300005578	Ga0068854_100038281	Ga0068854_1000382812	196
169	3300005578	Ga0068854_100270772	Ga0068854_1002707722	196
170	3300005614	Ga0068856_100642905	Ga0068856_1006429051	196
171	3300005618	Ga0068864_100001179	Ga0068864_10000117929	196
172	3300005834	Ga0068851_10043386	Ga0068851_100433863	196
173	3300005841	Ga0068863_100041119	Ga0068863_1000411192	196
174	3300005843	Ga0068860_100002491	Ga0068860_1000024913	196
175	3300005937	Ga0081455_10005754	Ga0081455_1000575415	196
176	3300005937	Ga0081455_10023030	Ga0081455_100230306	196
177	3300005983	Ga0081540_1000696	Ga0081540_100069650	196
178	3300005983	Ga0081540_1002504	Ga0081540_100250411	196
179	3300005983	Ga0081540_1002715	Ga0081540_100271513	196
180	3300005983	Ga0081540_1022165	Ga0081540_10221654	196
181	3300005983	Ga0081540_1046880	Ga0081540_10468802	196
182	3300006028	Ga0070717_10172259	Ga0070717_101722592	196
183	3300006038	Ga0075365_10089884	Ga0075365_100898841	196
184	3300006042	Ga0075368_10006565	Ga0075368_100065652	196
185	3300006051	Ga0075364_10038775	Ga0075364_100387752	196
186	3300006175	Ga0070712_100834728	Ga0070712_1008347281	196
187	3300006177	Ga0075362_10030775	Ga0075362_100307754	196
188	3300006178	Ga0075367_10049473	Ga0075367_100494732	196
189	3300006178	Ga0075367_10085121	Ga0075367_100851212	196
190	3300006178	Ga0075367_10240517	Ga0075367_102405173	196
191	3300006186	Ga0075369_10214467	Ga0075369_102144671	196
192	3300006844	Ga0075428_100013659	Ga0075428_1000136593	196
193	3300006846	Ga0075430_100022864	Ga0075430_1000228642	196
194	3300006847	Ga0075431_100095472	Ga0075431_1000954722	196
195	3300009093	Ga0105240_10813477	Ga0105240_108134771	196
196	3300009147	Ga0114129_10507925	Ga0114129_105079252	196
197	3300009174	Ga0105241_10544036	Ga0105241_105440361	196
198	3300009545	Ga0105237_10934423	Ga0105237_109344231	196
199	3300009551	Ga0105238_11051905	Ga0105238_110519051	196
200	3300009553	Ga0105249_10000491	Ga0105249_1000049123	196
201	3300012502	Ga0157347_1000100	Ga0157347_10001003	196
202	3300013104	Ga0157370_10250821	Ga0157370_102508213	196
203	3300013105	Ga0157369_10331881	Ga0157369_103318813	196
204	3300013105	Ga0157369_10390817	Ga0157369_103908171	196
205	3300013105	Ga0157369_10426087	Ga0157369_104260873	196
206	3300013297	Ga0157378_11296867	Ga0157378_112968671	196
207	3300013306	Ga0163162_10082085	Ga0163162_100820855	196
208	3300013307	Ga0157372_10672647	Ga0157372_106726471	196
209	3300014325	Ga0163163_10334289	Ga0163163_103342892	196
210	3300014968	Ga0157379_10008943	Ga0157379_100089433	196
211	3300017792	Ga0163161_10001202	Ga0163161_100012023	196
212	3300021384	Ga0213876_10005315	Ga0213876_100053158	196
213	3300021384	Ga0213876_10164617	Ga0213876_101646171	196
214	3300021388	Ga0213875_10000746	Ga0213875_100007462	196
215	3300025206	Ga0209435_100022	Ga0209435_10002212	196
216	3300025245	Ga0207425_1013051	Ga0207425_10130512	196
217	3300025246	Ga0209646_1000078	Ga0209646_100007812	196
218	3300025250	Ga0209026_1000065	Ga0209026_100006512	196
219	3300025253	Ga0209677_100235	Ga0209677_10023519	196
220	3300025254	Ga0209148_1005482	Ga0209148_10054822	196
221	3300025256	Ga0209759_1000055	Ga0209759_100005512	196
222	3300025258	Ga0209129_1005789	Ga0209129_10057894	196
223	3300025261	Ga0209233_1010528	Ga0209233_10105283	196
224	3300025261	Ga0209233_1029581	Ga0209233_10295811	196
225	3300025272	Ga0209455_1019411	Ga0209455_10194111	196
226	3300025273	Ga0209673_1094329	Ga0209673_10943291	196
227	3300025294	Ga0209025_1035813	Ga0209025_10358132	196
228	3300025295	Ga0209564_1018860	Ga0209564_10188602	196
229	3300025297	Ga0209758_1000677	Ga0209758_10006779	196
230	3300025297	Ga0209758_1012862	Ga0209758_10128624	196
231	3300025297	Ga0209758_1020866	Ga0209758_10208663	196
232	3300025302	Ga0207426_1000465	Ga0207426_100046510	196
233	3300025315	Ga0207697_10225125	Ga0207697_102251251	196
234	3300025903	Ga0207680_10000041	Ga0207680_1000004121	196
235	3300025904	Ga0207647_10001460	Ga0207647_100014603	196
236	3300025909	Ga0207705_10163707	Ga0207705_101637072	196
237	3300025911	Ga0207654_10072793	Ga0207654_100727931	196
238	3300025913	Ga0207695_10281816	Ga0207695_102818161	196
239	3300025913	Ga0207695_10590070	Ga0207695_105900702	196
240	3300025914	Ga0207671_10185701	Ga0207671_101857013	196
241	3300025915	Ga0207693_10720845	Ga0207693_107208451	196
242	3300025916	Ga0207663_10693844	Ga0207663_106938441	196
243	3300025919	Ga0207657_10410583	Ga0207657_104105832	196
244	3300025919	Ga0207657_10671637	Ga0207657_106716371	196
245	3300025920	Ga0207649_10036684	Ga0207649_100366845	196
246	3300025924	Ga0207694_10126871	Ga0207694_101268713	196
247	3300025929	Ga0207664_10456125	Ga0207664_104561252	196
248	3300025931	Ga0207644_10000091	Ga0207644_1000009147	196
249	3300025931	Ga0207644_10005752	Ga0207644_100057527	196
250	3300025931	Ga0207644_10179911	Ga0207644_101799112	196
251	3300025933	Ga0207706_10009033	Ga0207706_1000903311	196
252	3300025939	Ga0207665_10077243	Ga0207665_100772434	196
253	3300025949	Ga0207667_10067217	Ga0207667_100672175	196
254	3300025961	Ga0207712_10000158	Ga0207712_1000015847	196
255	3300025972	Ga0207668_10904565	Ga0207668_109045651	196
256	3300025981	Ga0207640_10024203	Ga0207640_100242035	196
257	3300025981	Ga0207640_10370489	Ga0207640_103704891	196
258	3300025986	Ga0207658_10001022	Ga0207658_100010225	196
259	3300026041	Ga0207639_10010000	Ga0207639_100100004	196
260	3300026041	Ga0207639_10218763	Ga0207639_102187633	196
261	3300026078	Ga0207702_10475891	Ga0207702_104758911	196
262	3300026088	Ga0207641_10003461	Ga0207641_100034613	196
263	3300026088	Ga0207641_10061173	Ga0207641_100611734	196
264	3300026095	Ga0207676_10000275	Ga0207676_1000027527	196
265	3300026095	Ga0207676_10366152	Ga0207676_103661522	196
266	3300026116	Ga0207674_10078471	Ga0207674_100784713	196
267	3300026142	Ga0207698_10115721	Ga0207698_101157211	196
268	3300027312	Ga0209371_1002778	Ga0209371_10027784	196
269	3300028381	Ga0268264_10000350	Ga0268264_1000035047	196
270	3300028558	Ga0265326_10048348	Ga0265326_100483482	196
271	3300028653	Ga0265323_10001030	Ga0265323_1000103014	196
272	3300028666	Ga0265336_10000400	Ga0265336_1000040014	196
273	3300028794	Ga0307515_10015791	Ga0307515_1001579114	196
274	3300028794	Ga0307515_10256193	Ga0307515_102561932	196
275	3300028800	Ga0265338_10000086	Ga0265338_1000008669	196
276	3300028800	Ga0265338_10023661	Ga0265338_100236614	196
277	3300028800	Ga0265338_10149408	Ga0265338_101494082	196
278	3300029957	Ga0265324_10007350	Ga0265324_100073502	196
279	3300030500	Ga0268256_1002606	Ga0268256_10026067	196
280	3300031250	Ga0265331_10087547	Ga0265331_100875472	196
281	3300031251	Ga0265327_10002374	Ga0265327_1000237413	196
282	3300031344	Ga0265316_10767328	Ga0265316_107673281	196
283	3300031548	Ga0307408_100487217	Ga0307408_1004872172	196
284	3300031711	Ga0265314_10147620	Ga0265314_101476201	196
285	3300031711	Ga0265314_10179892	Ga0265314_101798922	196
286	3300031712	Ga0265342_10046655	Ga0265342_100466553	196
287	3300031731	Ga0307405_10594152	Ga0307405_105941521	196
288	3300031903	Ga0307407_10628533	Ga0307407_106285331	196
289	3300031911	Ga0307412_10005746	Ga0307412_100057465	196
290	3300031911	Ga0307412_10322903	Ga0307412_103229032	196
291	3300033546	Ga0316213_1002759	Ga0316213_10027591	196
292	3300035086	Ga0373934_0048768	Ga0373934_0048768_782_1372	196
293	3300035724	Ga0373933_0476446	Ga0373933_0476446_136_726	196
294	3300037312	Ga0395899_0269286	Ga0395899_0269286_186_776	196
295	3300037418	Ga0395900_0010914	Ga0395900_0010914_2891_3481	196
296	3300037418	Ga0395900_0133542	Ga0395900_0133542_114_704	196
297	3300037471	Ga0395905_0024427	Ga0395905_0024427_144_734	196
298	3300037471	Ga0395905_0086978	Ga0395905_0086978_1486_2076	196
299	3300037471	Ga0395905_0090356	Ga0395905_0090356_672_1262	196
300	3300037853	Ga0436364_1517900	Ga0436364_1517900_138_728	196
301	3300038443	Ga0395901_0134527	Ga0395901_0134527_1736_2326	196
302	3300039437	Ga0436365_0156697	Ga0436365_0156697_3315_3905	196
303	3300039437	Ga0436365_0847903	Ga0436365_0847903_15498_16088	196
304	3300039437	Ga0436365_0998128	Ga0436365_0998128_984_1574	196
305	3300039437	Ga0436365_1011890	Ga0436365_1011890_3006_3596	196
306	3300039447	Ga0436361_0077742	Ga0436361_0077742_338_928	196
307	3300039447	Ga0436361_0339641	Ga0436361_0339641_284_874	196
308	3300039447	Ga0436361_1210139	Ga0436361_1210139_96_686	196
309	3300042436	Ga0439435_0040132	Ga0439435_0040132_354_944	196
310	3300044658	Ga0466972_0166955	Ga0466972_0166955_393_983	196
311	3300044694	Ga0466963_0008188	Ga0466963_0008188_4460_5050	196
312	3300044694	Ga0466963_0030197	Ga0466963_0030197_615_1205	196
313	3300044735	Ga0466968_0022640	Ga0466968_0022640_1443_2033	196
314	3300044735	Ga0466968_0077532	Ga0466968_0077532_78_668	196
315	3300044765	Ga0466970_0004466	Ga0466970_0004466_1208_1798	196
316	3300044842	Ga0466957_0039313	Ga0466957_0039313_1465_2055	196
317	3300044842	Ga0466957_0118452	Ga0466957_0118452_927_1517	196
318	3300044842	Ga0466957_0385058	Ga0466957_0385058_170_760	196
319	3300045836	Ga0466958_0101727	Ga0466958_0101727_1139_1729	196
320	3300045976	Ga0466967_0002820	Ga0466967_0002820_3290_3880	196
321	3300045976	Ga0466967_0067432	Ga0466967_0067432_1940_2530	196
322	3300046459	Ga0495629_0504065	Ga0495629_0504065_154_747	196
323	3300046475	Ga0495639_0131306	Ga0495639_0131306_155_745	196
324	3300046475	Ga0495639_0152359	Ga0495639_0152359_466_1059	196
325	3300046476	Ga0495662_0283336	Ga0495662_0283336_46_639	196
326	3300046533	Ga0495640_0017473	Ga0495640_0017473_1565_2167	196
327	3300046660	Ga0495625_0481375	Ga0495625_0481375_31_621	196
328	3300046678	Ga0495599_0175869	Ga0495599_0175869_345_935	196
329	3300046689	Ga0495613_0014383	Ga0495613_0014383_4118_4720	196
330	3300047317	Ga0495604_0222890	Ga0495604_0222890_413_1003	196
331	3300047317	Ga0495604_0444648	Ga0495604_0444648_21_620	196
332	3300047322	Ga0495680_0277744	Ga0495680_0277744_60_662	196
333	3300047444	Ga0495675_0250135	Ga0495675_0250135_37_627	196
334	3300048906	Ga0496103_0000395	Ga0496103_0000395_20642_21232	196
335	3300048907	Ga0496104_0000457	Ga0496104_0000457_28642_29232	196
336	3300048908	Ga0496105_0000327	Ga0496105_0000327_28282_28872	196
337	3300048909	Ga0496106_0637365	Ga0496106_0637365_199_795	196
338	3300048911	Ga0496108_0085577	Ga0496108_0085577_1615_2220	196
339	3300048912	Ga0496109_0198656	Ga0496109_0198656_893_1498	196
340	3300048914	Ga0496111_0096838	Ga0496111_0096838_1486_2091	196
341	3300048914	Ga0496111_0339351	Ga0496111_0339351_480_1070	196
342	3300048915	Ga0496112_0039593	Ga0496112_0039593_3303_3908	196
343	3300048915	Ga0496112_0247325	Ga0496112_0247325_594_1184	196
344	3300048916	Ga0496113_0085057	Ga0496113_0085057_1282_1887	196
345	3300048919	Ga0496116_0000486	Ga0496116_0000486_33467_34057	196
346	3300048920	Ga0496117_0000824	Ga0496117_0000824_17547_18137	196
347	3300048920	Ga0496117_0037901	Ga0496117_0037901_815_1405	196
348	3300048920	Ga0496117_0060594	Ga0496117_0060594_187_777	196
349	3300048920	Ga0496117_0225324	Ga0496117_0225324_229_819	196
350	3300048921	Ga0496118_0000133	Ga0496118_0000133_17554_18144	196
351	3300048921	Ga0496118_0054753	Ga0496118_0054753_1930_2520	196
352	3300048922	Ga0496119_0022909	Ga0496119_0022909_701_1291	196
353	3300048924	Ga0496121_0001109	Ga0496121_0001109_13442_14032	196
354	3300048924	Ga0496121_0024555	Ga0496121_0024555_3643_4233	196
355	3300048925	Ga0496122_0001328	Ga0496122_0001328_4347_4937	196
356	3300048925	Ga0496122_0022224	Ga0496122_0022224_1691_2281	196
357	3300048926	Ga0496123_0005663	Ga0496123_0005663_7255_7845	196
358	3300048926	Ga0496123_0051370	Ga0496123_0051370_1045_1635	196
359	3300048927	Ga0496124_0000903	Ga0496124_0000903_29864_30454	196
360	3300048927	Ga0496124_0083907	Ga0496124_0083907_31_621	196
361	3300048928	Ga0496125_0047260	Ga0496125_0047260_1710_2300	196
362	3300048928	Ga0496125_0055634	Ga0496125_0055634_158_748	196
363	3300048929	Ga0496126_0072884	Ga0496126_0072884_668_1258	196
364	3300049571	Ga0501034_0432318	Ga0501034_0432318_493_1083	196
365	3300049573	Ga0501037_0061136	Ga0501037_0061136_1512_2102	196
366	3300049574	Ga0501038_0363575	Ga0501038_0363575_388_978	196
367	3300049575	Ga0501039_0641879	Ga0501039_0641879_56_646	196
368	3300049577	Ga0501041_0435298	Ga0501041_0435298_68_658	196
369	3300049580	Ga0501046_0003677	Ga0501046_0003677_1289_1879	196
370	3300049581	Ga0501047_1013051	Ga0501047_1013051_27_617	196
371	3300049583	Ga0501067_0533285	Ga0501067_0533285_14_604	196
372	3300049823	Ga0501044_0855044	Ga0501044_0855044_162_752	196
373	3300050490	nmdc:mga03n38_419516_c1	nmdc:mga03n38_419516_c1_62_652	196
374	3300050491	nmdc:mga00v17_170588_c1	nmdc:mga00v17_170588_c1_755_1345	196
375	3300050491	nmdc:mga00v17_183033_c1	nmdc:mga00v17_183033_c1_312_902	196
376	3300050495	nmdc:mga04h51_8629_c1	nmdc:mga04h51_8629_c1_1719_2336	196
377	3300050509	nmdc:mga0qj67_171085_c1	nmdc:mga0qj67_171085_c1_159_749	196
378	3300050510	nmdc:mga06r32_668942_c1	nmdc:mga06r32_668942_c1_146_736	196
379	3300050516	nmdc:mga0sz30_28056_c1	nmdc:mga0sz30_28056_c1_461_1051	196
380	3300050516	nmdc:mga0sz30_39138_c1	nmdc:mga0sz30_39138_c1_355_945	196
381	3300053077	Ga0495601_0524477	Ga0495601_0524477_128_718	196
382	3300053085	Ga0495619_0130661	Ga0495619_0130661_731_1321	196
383	3300053086	Ga0500578_0027441	Ga0500578_0027441_691_1281	196
384	3300053086	Ga0500578_0348626	Ga0500578_0348626_64_666	196
385	3300053111	Ga0500572_000416	Ga0500572_000416_5717_6307	196
386	3300053150	Ga0500603_051098	Ga0500603_051098_15_605	196
387	3300053730	Ga0500645_004209	Ga0500645_004209_100_690	196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

31

177

0.94 PF02525

Flavodoxin_2

Flavodoxin-like fold

30

186

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3gfr-assembly2.cif.gz_B	structure of yhda, d137l variant	0.8655	6	183
2gsw-assembly2.cif.gz_D	crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135	0.8649	6	184
3gfs-assembly1.cif.gz_A	structure of yhda, k109d/d137k variant	0.864	6	183
7bx9-assembly1.cif.gz_A	purification, characterization and x-ray structure of yhda-type azoreductase from bacillus velezensis	0.8605	5	181
3gfr-assembly2.cif.gz_B	structure of yhda, d137l variant	0.8512	6	183

ID	Description	Score	Start	End	Superfamily
af_Q9USJ6_13_177_3.40.50.360	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain	0.8609	5	147	3.40.50.360
2gswD00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain	0.8557	7	184	3.40.50.360
2gswD00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain	0.8416	7	184	3.40.50.360
af_Q54QT4_9_187_3.40.50.360	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain	0.8307	5	145	3.40.50.360
3u7rB00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain	0.788	2	185	3.40.50.360

ID	Description	Score	Start	End	GO Terms
AF-A0A520GVJ0-F1-model_v4	NADPH-dependent oxidoreductase	0.9751	1	99	GO:0005829 GO:0010181 GO:0016491
AF-B0UI47-F1-model_v4	deleted	0.9744	1	196
AF-B0UI47-F1-model_v4	deleted	0.9695	1	196
AF-A0A4Q5TC04-F1-model_v4	NADPH-dependent oxidoreductase	0.9678	25	196	GO:0005829 GO:0010181 GO:0016491
AF-J2WMA2-F1-model_v4	Putative flavoprotein	0.9672	1	158	GO:0005829 GO:0010181 GO:0016491

Feature Viewer

pLDDT	pTM	Quality
87.71	0.89	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F430755

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03358

FMN_red

NADPH-dependent FMN reductase

31

177

0.94

PF02525

Flavodoxin_2

Flavodoxin-like fold

30

186

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map