F430716

General Info

Members Datasets Scaffolds Average Seq Length
387 258 342 335

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10090573|Ga0065704_100905732
Length 369
Sequence MEFPILLIVIIALALIFDYINGFHDAANSIATIVSTKVLTPFQAVLWAAFWNFAAFFIAAYVVGEFKIGNTIAKTVDENFITLEVIFAGLIAAIAWNLLTWWFGIPSSSSHTLIGGFIGAALMHALISDYHLIAITHPEYSFFDKVYKAFVQLFSQNVVKYKVVIPIFLFXXXAPLIGVNICKRANPHKAERVFKKLQLVSSALFSLGHGTNDAQKVMGIIGAAMIYFHVNMMKDPLYLNIPEADRFNFFAEHYLWVPVVSFLAIALGTMSGGWKIIKTMGTRITKVTPLEGVAAETAGAITLFITEQLRIPVSTTHTVTGSIIGVGLTKRVSAVRWGVTVSLLWAWILTIPISAIVAGFTYLLVALIF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
4 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
5 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
6 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
7 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
8 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
9 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
10 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
11 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
12 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
13 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
14 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
15 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
16 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
17 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
18 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
19 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
20 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
21 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
22 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
23 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
24 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
25 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
26 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
27 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
28 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
29 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
30 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
31 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
32 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
33 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
34 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
35 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
36 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
37 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
38 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
39 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
40 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
41 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
42 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
43 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
44 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
45 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
46 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
47 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
48 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
49 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
50 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
141 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
144 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
253 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
254 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
257 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.37
Metatranscriptomes 0
Isolates 11.63

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 2.33
Nodule 0.26
Rhizoplane 2.58
Rhizosphere 86.3
Stem 0
Stem Tuber 0
Unclassified 8.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_971772 2162886007 Bacteria 2633
2 JGI24741J21665_1001136 3300001915 Bacteria 7883
3 rootL2_10256953 3300003322 Bacteria 4639
4 Ga0055534_1008916 3300003784 Bacteria 2226
5 Ga0065714_10064864 3300005288 Bacteria 16704
6 Ga0065704_10076605 3300005289 Bacteria 5058
7 Ga0065704_10090573 3300005289 Bacteria 2777
8 Ga0070683_100003563 3300005329 Bacteria 12675
9 Ga0070683_100317230 3300005329 Bacteria 1483
10 Ga0070680_100056308 3300005336 Bacteria 3214
11 Ga0070682_100000487 3300005337 Bacteria 24879
12 Ga0070660_100057193 3300005339 Bacteria 3020
13 Ga0070714_100233608 3300005435 Bacteria 1695
14 Ga0070710_10045337 3300005437 Bacteria 2444
15 Ga0070711_100045567 3300005439 Unclassified 2984
16 Ga0070711_100098377 3300005439 Bacteria 2124
17 Ga0070705_100038189 3300005440 Bacteria 2715
18 Ga0070705_100221154 3300005440 Bacteria 1311
19 Ga0070694_100009978 3300005444 Bacteria 5838
20 Ga0070708_100061929 3300005445 Bacteria 3344
21 Ga0070708_100218608 3300005445 Unclassified 1786
22 Ga0070708_100447943 3300005445 Bacteria 1218
23 Ga0070681_10152299 3300005458 Bacteria 2239
24 Ga0070706_100030022 3300005467 Bacteria 5006
25 Ga0070706_100051692 3300005467 Bacteria 3793
26 Ga0070707_100011247 3300005468 Bacteria 8342
27 Ga0070707_100015685 3300005468 Bacteria 7114
28 Ga0070707_100025987 3300005468 Archaea 5557
29 Ga0070707_100026356 3300005468 Bacteria 5519
30 Ga0070707_100097155 3300005468 Bacteria 2853
31 Ga0070707_100492040 3300005468 Bacteria 1188
32 Ga0070699_100022265 3300005518 Bacteria 5461
33 Ga0070699_100048169 3300005518 Unclassified 3688
34 Ga0070679_100005597 3300005530 Bacteria 11641
35 Ga0070679_100041035 3300005530 Bacteria 4606
36 Ga0070697_100022978 3300005536 Bacteria 4959
37 Ga0070697_100026637 3300005536 Bacteria 4622
38 Ga0070697_100030839 3300005536 Bacteria 4308
39 Ga0070697_100078822 3300005536 Bacteria 2711
40 Ga0070697_100174866 3300005536 Bacteria 1818
41 Ga0068853_100146550 3300005539 Unclassified 2122
42 Ga0070695_100155807 3300005545 Bacteria 1598
43 Ga0070696_100018806 3300005546 Bacteria 4676
44 Ga0070693_100012544 3300005547 Bacteria 4290
45 Ga0070665_100000666 3300005548 Bacteria 46257
46 Ga0070665_100034462 3300005548 Bacteria 5091
47 Ga0070704_100002079 3300005549 Bacteria 11127
48 Ga0068863_100004715 3300005841 Bacteria 13439
49 Ga0068858_100046232 3300005842 Bacteria 4036
50 Ga0070717_10168653 3300006028 Bacteria 1903
51 Ga0070715_10155099 3300006163 Bacteria 1126
52 Ga0070716_100169758 3300006173 Bacteria 1422
53 Ga0070712_100011165 3300006175 Bacteria 5685
54 Ga0075369_10041701 3300006186 Bacteria 1966
55 Ga0097621_100013872 3300006237 Bacteria 6016
56 Ga0068871_100020134 3300006358 Bacteria 5106
57 Ga0068871_100071473 3300006358 Bacteria 2854
58 Ga0075430_100039753 3300006846 Bacteria 3981
59 Ga0075431_100061700 3300006847 Bacteria 3868
60 Ga0075433_10126573 3300006852 Bacteria 2269
61 Ga0075434_100018138 3300006871 Bacteria 6793
62 Ga0075434_100058937 3300006871 Bacteria 3817
63 Ga0075434_100073041 3300006871 Bacteria 3422
64 Ga0075436_100003755 3300006914 Bacteria 10408
65 Ga0075436_100011708 3300006914 Bacteria 6022
66 Ga0075435_100090198 3300007076 Bacteria 2528
67 Ga0099794_10006983 3300007265 Bacteria 4606
68 Ga0099794_10007212 3300007265 Bacteria 4550
69 Ga0099794_10015466 3300007265 Bacteria 3369
70 Ga0099795_10014966 3300007788 Bacteria 2418
71 Ga0099795_10026733 3300007788 Bacteria 1947
72 Ga0105244_10000043 3300009036 Bacteria 150556
73 Ga0105240_10056351 3300009093 Bacteria 4919
74 Ga0105240_10088482 3300009093 Bacteria 3789
75 Ga0111539_10007976 3300009094 Bacteria 13505
76 Ga0111539_10108789 3300009094 Bacteria 3253
77 Ga0105245_10059215 3300009098 Bacteria 3448
78 Ga0114129_10359943 3300009147 Bacteria 1925
79 Ga0105243_10001102 3300009148 Bacteria 24539
80 Ga0105248_10066461 3300009177 Bacteria 4049
81 Ga0105237_10220250 3300009545 Bacteria 1898
82 Ga0105238_10127771 3300009551 Bacteria 2520
83 Ga0099796_10023342 3300010159 Bacteria 1930
84 Ga0105239_10049968 3300010375 Unclassified 4586
85 Ga0105239_10168622 3300010375 Bacteria 2448
86 Ga0157373_10000163 3300013100 Bacteria 54136
87 Ga0157371_10000012 3300013102 Bacteria 355318
88 Ga0157370_10004679 3300013104 Bacteria 15609
89 Ga0157370_10243856 3300013104 Bacteria 1662
90 Ga0157369_10002177 3300013105 Bacteria 23589
91 Ga0157369_10064398 3300013105 Bacteria 3948
92 Ga0157378_10000053 3300013297 Bacteria 99982
93 Ga0157378_10001919 3300013297 Bacteria 18662
94 Ga0157372_10017553 3300013307 Bacteria 7678
95 Ga0157375_10000690 3300013308 Bacteria 29835
96 Ga0157375_10056178 3300013308 Bacteria 3885
97 Ga0157375_10554376 3300013308 Bacteria 1311
98 Ga0182008_10000033 3300014497 Bacteria 153579
99 Ga0157379_10044037 3300014968 Bacteria 3985
100 Ga0157379_10073699 3300014968 Bacteria 3056
101 Ga0157379_10131225 3300014968 Bacteria 2255
102 Ga0157376_10000029 3300014969 Bacteria 201828
103 Ga0182006_1000016 3300015261 Bacteria 303558
104 Ga0163161_10002751 3300017792 Bacteria 12501
105 Ga0163161_10157227 3300017792 Bacteria 1731
106 Ga0213876_10007228 3300021384 Bacteria 6054
107 Ga0209675_1000095 3300025291 Bacteria 135911
108 Ga0207655_1000237 3300025728 Bacteria 91108
109 Ga0207653_10001632 3300025885 Bacteria 7218
110 Ga0207692_10018820 3300025898 Bacteria 3108
111 Ga0207684_10011777 3300025910 Bacteria 7630
112 Ga0207695_10020919 3300025913 Bacteria 7477
113 Ga0207693_10044302 3300025915 Bacteria 3498
114 Ga0207693_10050879 3300025915 Bacteria 3252
115 Ga0207693_10052284 3300025915 Bacteria 3204
116 Ga0207663_10023898 3300025916 Bacteria 3515
117 Ga0207660_10059210 3300025917 Bacteria 2749
118 Ga0207657_10099603 3300025919 Bacteria 2414
119 Ga0207652_10013350 3300025921 Bacteria 6652
120 Ga0207652_10029177 3300025921 Bacteria 4610
121 Ga0207646_10000927 3300025922 Bacteria 37748
122 Ga0207646_10006432 3300025922 Bacteria 12129
123 Ga0207646_10026419 3300025922 Archaea 5297
124 Ga0207646_10041211 3300025922 Bacteria 4152
125 Ga0207646_10255818 3300025922 Unclassified 1583
126 Ga0207694_10120808 3300025924 Bacteria 2092
127 Ga0207687_10036684 3300025927 Bacteria 3339
128 Ga0207664_10120908 3300025929 Bacteria 2191
129 Ga0207709_10000774 3300025935 Bacteria 25155
130 Ga0207665_10027229 3300025939 Bacteria 3777
131 Ga0207665_10068381 3300025939 Unclassified 2420
132 Ga0207665_10350077 3300025939 Bacteria 1115
133 Ga0207711_10036145 3300025941 Bacteria 4190
134 Ga0207661_10062981 3300025944 Bacteria 3002
135 Ga0207703_10030592 3300026035 Bacteria 4256
136 Ga0207641_10002226 3300026088 Bacteria 18176
137 Ga0209588_1000164 3300027671 Unclassified 18506
138 Ga0209588_1002133 3300027671 Bacteria 5336
139 Ga0209588_1002305 3300027671 Bacteria 5166
140 Ga0209588_1004200 3300027671 Bacteria 4047
141 Ga0209588_1020474 3300027671 Archaea 2072
142 Ga0207428_10039925 3300027907 Bacteria 3809
143 Ga0268266_10000249 3300028379 Bacteria 91239
144 Ga0268264_10003766 3300028381 Bacteria 13011
145 Ga0265337_1000439 3300028556 Bacteria 22057
146 Ga0265326_10001230 3300028558 Bacteria 9142
147 Ga0265326_10001763 3300028558 Bacteria 7489
148 Ga0265319_1000100 3300028563 Bacteria 66728
149 Ga0265319_1000169 3300028563 Bacteria 49406
150 Ga0265322_10000248 3300028654 Bacteria 23437
151 Ga0265336_10000115 3300028666 Bacteria 59960
152 Ga0265338_10000261 3300028800 Bacteria 96027
153 Ga0265338_10001654 3300028800 Bacteria 35526
154 Ga0265338_10003467 3300028800 Bacteria 22201
155 Ga0265338_10007677 3300028800 Bacteria 13294
156 Ga0265324_10000265 3300029957 Bacteria 38646
157 Ga0265324_10006706 3300029957 Bacteria 4758
158 Ga0265330_10001075 3300031235 Bacteria 16493
159 Ga0265330_10001279 3300031235 Bacteria 14727
160 Ga0265332_10000059 3300031238 Bacteria 99723
161 Ga0265332_10000382 3300031238 Bacteria 32426
162 Ga0265332_10032184 3300031238 Bacteria 2286
163 Ga0265320_10001579 3300031240 Bacteria 16365
164 Ga0265320_10002614 3300031240 Bacteria 12499
165 Ga0265329_10000073 3300031242 Bacteria 44995
166 Ga0265340_10001663 3300031247 Bacteria 12783
167 Ga0265340_10004735 3300031247 Bacteria 7564
168 Ga0265339_10000297 3300031249 Bacteria 40447
169 Ga0265339_10057724 3300031249 Bacteria 2098
170 Ga0265331_10000569 3300031250 Bacteria 33094
171 Ga0265331_10002323 3300031250 Bacteria 12964
172 Ga0265316_10000066 3300031344 Bacteria 110650
173 Ga0265316_10000247 3300031344 Bacteria 62442
174 Ga0265316_10016603 3300031344 Bacteria 6382
175 Ga0265316_10024644 3300031344 Bacteria 5034
176 Ga0265316_10148392 3300031344 Bacteria 1758
177 Ga0265316_10305832 3300031344 Bacteria 1157
178 Ga0307408_100020622 3300031548 Bacteria 4451
179 Ga0265313_10000580 3300031595 Bacteria 38083
180 Ga0265314_10000285 3300031711 Bacteria 73539
181 Ga0265314_10000485 3300031711 Bacteria 51849
182 Ga0265314_10224216 3300031711 Bacteria 1095
183 Ga0265342_10000992 3300031712 Bacteria 27981
184 Ga0316576_10000883 3300031727 Bacteria 15232
185 Ga0316576_10111037 3300031727 Bacteria 2055
186 Ga0307405_10006562 3300031731 Bacteria 5733
187 Ga0307413_10128072 3300031824 Bacteria 1732
188 Ga0307410_10006330 3300031852 Bacteria 6380
189 Ga0307410_10027767 3300031852 Bacteria 3580
190 Ga0307407_10000960 3300031903 Bacteria 9819
191 Ga0307407_10116252 3300031903 Bacteria 1688
192 Ga0307412_10000079 3300031911 Bacteria 94863
193 Ga0307412_10003135 3300031911 Bacteria 9186
194 Ga0307412_10015390 3300031911 Bacteria 4535
195 Ga0307409_100008915 3300031995 Bacteria 6128
196 Ga0307416_100000051 3300032002 Bacteria 115585
197 Ga0307416_100007749 3300032002 Bacteria 6864
198 Ga0307414_10000010 3300032004 Bacteria 357863
199 Ga0307414_10003497 3300032004 Bacteria 8395
200 Ga0307414_10100284 3300032004 Bacteria 2177
201 Ga0307411_10194515 3300032005 Bacteria 1552
202 Ga0307415_100003892 3300032126 Bacteria 7669
203 Ga0307415_100390115 3300032126 Bacteria 1185
204 Ga0373953_0038249 3300035117 Bacteria 1897
205 Ga0373955_0005887 3300035172 Bacteria 5543
206 Ga0373931_0181803 3300035691 Bacteria 1246
207 Ga0373933_0028239 3300035724 Bacteria 3235
208 Ga0373933_0102840 3300035724 Bacteria 1774
209 Ga0373937_0000942 3300036401 Bacteria 24733
210 Ga0373937_0025473 3300036401 Bacteria 5340
211 Ga0373937_0076423 3300036401 Bacteria 3093
212 Ga0373937_0124933 3300036401 Bacteria 2400
213 Ga0373925_0005079 3300037068 Bacteria 9848
214 Ga0373925_0162271 3300037068 Bacteria 1761
215 Ga0436365_0435927 3300039437 Bacteria 5922
216 Ga0439465_0000613 3300041413 Bacteria 10831
217 Ga0439445_0000003 3300042004 Bacteria 29611
218 Ga0439446_0005855 3300042156 Bacteria 3178
219 Ga0439434_0035758 3300042435 Bacteria 1518
220 Ga0451577_0000202 3300042876 Bacteria 124050
221 Ga0451577_0000207 3300042876 Bacteria 123185
222 Ga0451577_0065788 3300042876 Bacteria 3233
223 Ga0451577_0255726 3300042876 Bacteria 1586
224 Ga0453684_0000004 3300044712 Bacteria 1469893
225 Ga0453684_0000791 3300044712 Bacteria 108441
226 Ga0451576_0006332 3300045051 Bacteria 14545
227 Ga0451576_0007818 3300045051 Bacteria 12670
228 Ga0451576_0438126 3300045051 Bacteria 1371
229 Ga0495627_000025 3300046453 Bacteria 248825
230 Ga0495627_001886 3300046453 Bacteria 11038
231 Ga0495627_003047 3300046453 Bacteria 7652
232 Ga0495638_0051297 3300046460 Bacteria 2573
233 Ga0495641_0112946 3300046461 Bacteria 1212
234 Ga0495651_0029685 3300046462 Bacteria 4264
235 Ga0495651_0160947 3300046462 Bacteria 1608
236 Ga0495580_0001761 3300046472 Bacteria 19013
237 Ga0495580_0158757 3300046472 Bacteria 1565
238 Ga0495580_0317865 3300046472 Bacteria 1058
239 Ga0495582_0008252 3300046473 Bacteria 5747
240 Ga0495582_0025280 3300046473 Bacteria 3253
241 Ga0495582_0092703 3300046473 Bacteria 1685
242 Ga0495639_0002770 3300046475 Bacteria 7620
243 Ga0495639_0004758 3300046475 Bacteria 5839
244 Ga0495664_0011956 3300046477 Bacteria 4904
245 Ga0495664_0018090 3300046477 Bacteria 4032
246 Ga0495664_0037738 3300046477 Bacteria 2852
247 Ga0495594_0027802 3300046499 Bacteria 3049
248 Ga0495596_0000747 3300046500 Bacteria 19939
249 Ga0495606_0028401 3300046507 Bacteria 3947
250 Ga0495608_0085300 3300046511 Bacteria 2047
251 Ga0495610_0000009 3300046512 Bacteria 554843
252 Ga0495630_0105812 3300046517 Bacteria 2130
253 Ga0495643_0000392 3300046522 Bacteria 57744
254 Ga0495643_0001365 3300046522 Bacteria 22850
255 Ga0495643_0098920 3300046522 Bacteria 1497
256 Ga0495663_0000655 3300046525 Bacteria 11993
257 Ga0495663_0005302 3300046525 Bacteria 3583
258 Ga0495666_0012101 3300046526 Bacteria 4306
259 Ga0495666_0105321 3300046526 Bacteria 1327
260 Ga0495654_0000242 3300046530 Bacteria 50953
261 Ga0495640_0001536 3300046533 Bacteria 18175
262 Ga0495586_0024746 3300046535 Bacteria 3211
263 Ga0495609_0000047 3300046538 Bacteria 156247
264 Ga0495633_0000341 3300046558 Bacteria 52317
265 Ga0495633_0001668 3300046558 Bacteria 16757
266 Ga0495667_0020188 3300046559 Bacteria 4495
267 Ga0495634_0018481 3300046642 Bacteria 4963
268 Ga0495634_0030837 3300046642 Bacteria 3698
269 Ga0495623_0012602 3300046679 Bacteria 5473
270 Ga0495658_0004984 3300046683 Bacteria 6518
271 Ga0495658_0030122 3300046683 Bacteria 2944
272 Ga0495613_0118005 3300046689 Bacteria 1907
273 Ga0495613_0167370 3300046689 Bacteria 1561
274 Ga0495624_0083316 3300046690 Bacteria 1978
275 Ga0495581_0011949 3300047315 Bacteria 5023
276 Ga0495604_0001058 3300047317 Bacteria 22815
277 Ga0495674_0012116 3300047319 Bacteria 8127
278 Ga0495674_0023123 3300047319 Bacteria 5729
279 Ga0495676_0011010 3300047321 Bacteria 8181
280 Ga0495676_0145016 3300047321 Bacteria 1697
281 Ga0495680_0014275 3300047322 Bacteria 6886
282 Ga0495680_0037013 3300047322 Bacteria 3911
283 Ga0495684_0049374 3300047471 Bacteria 3215
284 Ga0495684_0069219 3300047471 Bacteria 2684
285 Ga0495686_0000485 3300047472 Bacteria 58800
286 Ga0495686_0012111 3300047472 Bacteria 6054
287 Ga0495593_0127502 3300047673 Bacteria 1293
288 Ga0495602_0077324 3300048088 Bacteria 2816
289 Ga0495602_0310423 3300048088 Bacteria 1151
290 Ga0496100_0291194 3300048903 Bacteria 1220
291 Ga0496102_0012248 3300048905 Bacteria 7415
292 Ga0496102_0024248 3300048905 Bacteria 5393
293 Ga0496104_0056844 3300048907 Bacteria 3702
294 Ga0496105_0111147 3300048908 Bacteria 2262
295 Ga0496105_0114484 3300048908 Bacteria 2225
296 Ga0496114_0016338 3300048917 Bacteria 5978
297 Ga0496114_0087539 3300048917 Bacteria 2641
298 Ga0496115_0017193 3300048918 Bacteria 5521
299 Ga0496115_0071591 3300048918 Bacteria 2812
300 Ga0496116_0000919 3300048919 Bacteria 36391
301 Ga0496117_0000285 3300048920 Bacteria 92381
302 Ga0496118_0001982 3300048921 Bacteria 29084
303 Ga0496119_0000004 3300048922 Bacteria 536344
304 Ga0496121_0066933 3300048924 Bacteria 2914
305 Ga0496122_0000856 3300048925 Bacteria 57260
306 Ga0496122_0001202 3300048925 Bacteria 44119
307 Ga0496122_0003831 3300048925 Bacteria 19332
308 Ga0496122_0003925 3300048925 Bacteria 19018
309 Ga0496123_0006239 3300048926 Bacteria 11622
310 Ga0496123_0027340 3300048926 Bacteria 4251
311 Ga0496123_0050555 3300048926 Bacteria 2776
312 Ga0496124_0006237 3300048927 Bacteria 13064
313 Ga0496125_0000177 3300048928 Bacteria 140730
314 Ga0496125_0000552 3300048928 Bacteria 64522
315 Ga0496125_0037970 3300048928 Bacteria 4179
316 Ga0496126_0005397 3300048929 Bacteria 14596
317 Ga0501036_0124423 3300049572 Bacteria 2177
318 Ga0501068_0017706 3300049584 Bacteria 4122
319 Ga0501070_0001394 3300049586 Bacteria 21627
320 Ga0501081_0080138 3300049743 Bacteria 2285
321 Ga0501083_0000899 3300049744 Bacteria 19690
322 Ga0501241_000014 3300049758 Bacteria 100728
323 nmdc:mga0qj67_87327_c1 3300050509 Bacteria 2503
324 nmdc:mga06r32_58415_c1 3300050510 Bacteria 3707
325 nmdc:mga08y16_10566_c1 3300050511 Bacteria 9690
326 nmdc:mga08y16_93507_c1 3300050511 Bacteria 3132
327 nmdc:mga0n895_107939_c1 3300050512 Bacteria 2798
328 nmdc:mga0n895_12318_c1 3300050512 Bacteria 7667
329 nmdc:mga0rr50_75992_c1 3300050513 Bacteria 2577
330 nmdc:mga08x19_11459_c1 3300050514 Bacteria 5336
331 nmdc:mga08x19_4823_c1 3300050514 Bacteria 7984
332 nmdc:mga0a205_109756_c1 3300050515 Bacteria 2657
333 Ga0495601_0285536 3300053077 Bacteria 1076
334 Ga0495619_0116212 3300053085 Bacteria 1831
335 Ga0500644_0004151 3300053088 Bacteria 3613
336 Ga0500646_0023230 3300053090 Bacteria 1662
337 Ga0500562_000027 3300053108 Bacteria 100118
338 Ga0500616_0023070 3300053153 Bacteria 3470
339 Ga0500622_0000931 3300053156 Bacteria 24896
340 Ga0500661_003356 3300055283 Bacteria 3011
341 Ga0501082_0015678 3300060353 Bacteria 6520
342 Ga0501082_0017934 3300060353 Bacteria 6097

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0007818 Ga0451576_0007818_7329_8351 234
2 3300049584 Ga0501068_0017706 Ga0501068_0017706_2511_3500 243
3 3300060353 Ga0501082_0017934 Ga0501082_0017934_977_1966 243
4 3300049586 Ga0501070_0001394 Ga0501070_0001394_6177_7166 245
5 3300049744 Ga0501083_0000899 Ga0501083_0000899_5016_6005 245
6 3300060353 Ga0501082_0015678 Ga0501082_0015678_1788_2777 245
7 3300031727 Ga0316576_10111037 Ga0316576_101110372 247
8 3300053077 Ga0495601_0285536 Ga0495601_0285536_164_1051 247
9 3300025921 Ga0207652_10013350 Ga0207652_100133505 252
10 3300053088 Ga0500644_0004151 Ga0500644_0004151_725_1738 252
11 3300053108 Ga0500562_000027 Ga0500562_000027_64981_65994 252
12 3300055283 Ga0500661_003356 Ga0500661_003356_550_1563 252
13 3300031727 Ga0316576_10000883 Ga0316576_100008838 253
14 3300053090 Ga0500646_0023230 Ga0500646_0023230_634_1629 255
15 3300005445 Ga0070708_100447943 Ga0070708_1004479431 259
16 3300007788 Ga0099795_10026733 Ga0099795_100267332 259
17 3300046522 Ga0495643_0000392 Ga0495643_0000392_12463_13527 259
18 3300005458 Ga0070681_10152299 Ga0070681_101522992 260
19 3300005467 Ga0070706_100030022 Ga0070706_1000300222 260
20 3300005468 Ga0070707_100011247 Ga0070707_1000112476 260
21 3300005536 Ga0070697_100022978 Ga0070697_1000229783 260
22 3300006871 Ga0075434_100058937 Ga0075434_1000589372 260
23 3300025922 Ga0207646_10000927 Ga0207646_1000092726 260
24 3300036401 Ga0373937_0025473 Ga0373937_0025473_2502_3497 260
25 3300032126 Ga0307415_100390115 Ga0307415_1003901151 263
26 3300009098 Ga0105245_10059215 Ga0105245_100592154 264
27 3300009177 Ga0105248_10066461 Ga0105248_100664614 264
28 3300010375 Ga0105239_10168622 Ga0105239_101686222 264
29 3300013297 Ga0157378_10000053 Ga0157378_1000005373 264
30 3300013308 Ga0157375_10056178 Ga0157375_100561782 264
31 3300014968 Ga0157379_10073699 Ga0157379_100736992 264
32 3300025927 Ga0207687_10036684 Ga0207687_100366844 264
33 3300025941 Ga0207711_10036145 Ga0207711_100361454 264
34 3300028381 Ga0268264_10003766 Ga0268264_100037664 264
35 3300048905 Ga0496102_0012248 Ga0496102_0012248_4182_5180 264
36 3300007265 Ga0099794_10015466 Ga0099794_100154664 265
37 3300027671 Ga0209588_1000164 Ga0209588_10001647 265
38 3300048903 Ga0496100_0291194 Ga0496100_0291194_153_1133 267
39 3300048918 Ga0496115_0017193 Ga0496115_0017193_630_1610 267
40 3300005468 Ga0070707_100025987 Ga0070707_1000259876 268
41 3300025922 Ga0207646_10026419 Ga0207646_100264195 268
42 3300048088 Ga0495602_0310423 Ga0495602_0310423_46_1023 268
43 iso_pu_bacteria 2929154850 2929158855 268
44 3300009094 Ga0111539_10007976 Ga0111539_1000797612 270
45 3300013308 Ga0157375_10554376 Ga0157375_105543762 270
46 3300027907 Ga0207428_10039925 Ga0207428_100399254 270
47 3300050511 nmdc:mga08y16_10566_c1 nmdc:mga08y16_10566_c1_4241_5218 270
48 3300042876 Ga0451577_0000202 Ga0451577_0000202_87431_88417 271
49 3300042876 Ga0451577_0000207 Ga0451577_0000207_98593_99579 271
50 3300044712 Ga0453684_0000004 Ga0453684_0000004_347184_348170 271
51 3300044712 Ga0453684_0000791 Ga0453684_0000791_65036_66022 271
52 3300005530 Ga0070679_100005597 Ga0070679_10000559711 272
53 3300009093 Ga0105240_10056351 Ga0105240_100563515 272
54 3300009551 Ga0105238_10127771 Ga0105238_101277712 272
55 3300014968 Ga0157379_10131225 Ga0157379_101312252 272
56 3300025924 Ga0207694_10120808 Ga0207694_101208082 272
57 3300028556 Ga0265337_1000439 Ga0265337_100043910 272
58 3300028558 Ga0265326_10001230 Ga0265326_100012304 272
59 3300028558 Ga0265326_10001763 Ga0265326_100017632 272
60 3300028563 Ga0265319_1000100 Ga0265319_100010060 272
61 3300028563 Ga0265319_1000169 Ga0265319_10001697 272
62 3300028654 Ga0265322_10000248 Ga0265322_1000024813 272
63 3300028666 Ga0265336_10000115 Ga0265336_100001157 272
64 3300028800 Ga0265338_10000261 Ga0265338_1000026188 272
65 3300028800 Ga0265338_10001654 Ga0265338_100016547 272
66 3300028800 Ga0265338_10003467 Ga0265338_1000346720 272
67 3300028800 Ga0265338_10007677 Ga0265338_100076777 272
68 3300029957 Ga0265324_10000265 Ga0265324_1000026513 272
69 3300029957 Ga0265324_10006706 Ga0265324_100067063 272
70 3300031235 Ga0265330_10001075 Ga0265330_100010756 272
71 3300031235 Ga0265330_10001279 Ga0265330_100012798 272
72 3300031238 Ga0265332_10000059 Ga0265332_1000005979 272
73 3300031238 Ga0265332_10000382 Ga0265332_1000038235 272
74 3300031238 Ga0265332_10032184 Ga0265332_100321843 272
75 3300031240 Ga0265320_10001579 Ga0265320_100015796 272
76 3300031240 Ga0265320_10002614 Ga0265320_100026145 272
77 3300031242 Ga0265329_10000073 Ga0265329_1000007332 272
78 3300031247 Ga0265340_10001663 Ga0265340_100016638 272
79 3300031247 Ga0265340_10004735 Ga0265340_100047352 272
80 3300031249 Ga0265339_10000297 Ga0265339_1000029731 272
81 3300031249 Ga0265339_10057724 Ga0265339_100577241 272
82 3300031250 Ga0265331_10000569 Ga0265331_1000056921 272
83 3300031250 Ga0265331_10002323 Ga0265331_1000232313 272
84 3300031344 Ga0265316_10000066 Ga0265316_1000006691 272
85 3300031344 Ga0265316_10000247 Ga0265316_1000024746 272
86 3300031344 Ga0265316_10024644 Ga0265316_100246442 272
87 3300031344 Ga0265316_10148392 Ga0265316_101483922 272
88 3300031344 Ga0265316_10305832 Ga0265316_103058321 272
89 3300031595 Ga0265313_10000580 Ga0265313_100005809 272
90 3300031711 Ga0265314_10000285 Ga0265314_1000028517 272
91 3300031711 Ga0265314_10000485 Ga0265314_1000048537 272
92 3300031711 Ga0265314_10224216 Ga0265314_102242161 272
93 3300031712 Ga0265342_10000992 Ga0265342_100009927 272
94 3300035724 Ga0373933_0102840 Ga0373933_0102840_641_1630 272
95 3300036401 Ga0373937_0076423 Ga0373937_0076423_543_1532 272
96 3300036401 Ga0373937_0124933 Ga0373937_0124933_848_1837 272
97 3300042435 Ga0439434_0035758 Ga0439434_0035758_29_1027 272
98 3300042876 Ga0451577_0065788 Ga0451577_0065788_1909_2898 272
99 3300045051 Ga0451576_0006332 Ga0451576_0006332_2311_3300 272
100 3300045051 Ga0451576_0438126 Ga0451576_0438126_163_1152 272
101 3300048907 Ga0496104_0056844 Ga0496104_0056844_165_1154 272
102 3300048908 Ga0496105_0111147 Ga0496105_0111147_520_1509 272
103 3300048908 Ga0496105_0114484 Ga0496105_0114484_772_1761 272
104 3300048917 Ga0496114_0016338 Ga0496114_0016338_3628_4617 272
105 3300049572 Ga0501036_0124423 Ga0501036_0124423_1036_2025 272
106 3300053156 Ga0500622_0000931 Ga0500622_0000931_14715_15728 272
107 3300005336 Ga0070680_100056308 Ga0070680_1000563081 273
108 3300005435 Ga0070714_100233608 Ga0070714_1002336081 273
109 3300005437 Ga0070710_10045337 Ga0070710_100453372 273
110 3300005439 Ga0070711_100045567 Ga0070711_1000455672 273
111 3300005439 Ga0070711_100098377 Ga0070711_1000983771 273
112 3300005440 Ga0070705_100038189 Ga0070705_1000381893 273
113 3300005440 Ga0070705_100221154 Ga0070705_1002211541 273
114 3300005444 Ga0070694_100009978 Ga0070694_1000099784 273
115 3300005445 Ga0070708_100218608 Ga0070708_1002186083 273
116 3300005467 Ga0070706_100051692 Ga0070706_1000516921 273
117 3300005468 Ga0070707_100097155 Ga0070707_1000971551 273
118 3300005518 Ga0070699_100022265 Ga0070699_1000222654 273
119 3300005518 Ga0070699_100048169 Ga0070699_1000481691 273
120 3300005530 Ga0070679_100041035 Ga0070679_1000410354 273
121 3300005536 Ga0070697_100078822 Ga0070697_1000788223 273
122 3300005536 Ga0070697_100174866 Ga0070697_1001748662 273
123 3300005539 Ga0068853_100146550 Ga0068853_1001465502 273
124 3300005545 Ga0070695_100155807 Ga0070695_1001558072 273
125 3300005546 Ga0070696_100018806 Ga0070696_1000188064 273
126 3300005547 Ga0070693_100012544 Ga0070693_1000125442 273
127 3300005548 Ga0070665_100000666 Ga0070665_10000066610 273
128 3300005549 Ga0070704_100002079 Ga0070704_10000207911 273
129 3300005841 Ga0068863_100004715 Ga0068863_1000047157 273
130 3300005842 Ga0068858_100046232 Ga0068858_1000462322 273
131 3300006028 Ga0070717_10168653 Ga0070717_101686531 273
132 3300006163 Ga0070715_10155099 Ga0070715_101550991 273
133 3300006173 Ga0070716_100169758 Ga0070716_1001697581 273
134 3300006175 Ga0070712_100011165 Ga0070712_1000111653 273
135 3300006237 Ga0097621_100013872 Ga0097621_1000138723 273
136 3300006358 Ga0068871_100020134 Ga0068871_1000201343 273
137 3300006358 Ga0068871_100071473 Ga0068871_1000714732 273
138 3300006846 Ga0075430_100039753 Ga0075430_1000397533 273
139 3300006847 Ga0075431_100061700 Ga0075431_1000617003 273
140 3300006852 Ga0075433_10126573 Ga0075433_101265732 273
141 3300006871 Ga0075434_100018138 Ga0075434_1000181383 273
142 3300006871 Ga0075434_100073041 Ga0075434_1000730413 273
143 3300006914 Ga0075436_100003755 Ga0075436_1000037553 273
144 3300006914 Ga0075436_100011708 Ga0075436_1000117084 273
145 3300007076 Ga0075435_100090198 Ga0075435_1000901982 273
146 3300007265 Ga0099794_10006983 Ga0099794_100069834 273
147 3300007265 Ga0099794_10007212 Ga0099794_100072124 273
148 3300007788 Ga0099795_10014966 Ga0099795_100149662 273
149 3300009094 Ga0111539_10108789 Ga0111539_101087892 273
150 3300009147 Ga0114129_10359943 Ga0114129_103599432 273
151 3300010159 Ga0099796_10023342 Ga0099796_100233422 273
152 3300013297 Ga0157378_10001919 Ga0157378_100019193 273
153 3300013307 Ga0157372_10017553 Ga0157372_100175532 273
154 3300014968 Ga0157379_10044037 Ga0157379_100440374 273
155 3300014969 Ga0157376_10000029 Ga0157376_10000029138 273
156 3300021384 Ga0213876_10007228 Ga0213876_100072283 273
157 3300025885 Ga0207653_10001632 Ga0207653_100016324 273
158 3300025898 Ga0207692_10018820 Ga0207692_100188201 273
159 3300025910 Ga0207684_10011777 Ga0207684_100117775 273
160 3300025915 Ga0207693_10044302 Ga0207693_100443022 273
161 3300025915 Ga0207693_10050879 Ga0207693_100508793 273
162 3300025915 Ga0207693_10052284 Ga0207693_100522841 273
163 3300025916 Ga0207663_10023898 Ga0207663_100238982 273
164 3300025917 Ga0207660_10059210 Ga0207660_100592104 273
165 3300025921 Ga0207652_10029177 Ga0207652_100291774 273
166 3300025922 Ga0207646_10255818 Ga0207646_102558181 273
167 3300025929 Ga0207664_10120908 Ga0207664_101209082 273
168 3300025939 Ga0207665_10027229 Ga0207665_100272293 273
169 3300025939 Ga0207665_10068381 Ga0207665_100683812 273
170 3300025939 Ga0207665_10350077 Ga0207665_103500771 273
171 3300026035 Ga0207703_10030592 Ga0207703_100305922 273
172 3300026088 Ga0207641_10002226 Ga0207641_100022266 273
173 3300027671 Ga0209588_1002133 Ga0209588_10021333 273
174 3300027671 Ga0209588_1002305 Ga0209588_10023054 273
175 3300027671 Ga0209588_1004200 Ga0209588_10042003 273
176 3300028379 Ga0268266_10000249 Ga0268266_1000024967 273
177 3300031548 Ga0307408_100020622 Ga0307408_1000206223 273
178 3300031731 Ga0307405_10006562 Ga0307405_100065623 273
179 3300031824 Ga0307413_10128072 Ga0307413_101280722 273
180 3300031852 Ga0307410_10006330 Ga0307410_100063302 273
181 3300031852 Ga0307410_10027767 Ga0307410_100277672 273
182 3300031903 Ga0307407_10000960 Ga0307407_100009606 273
183 3300031903 Ga0307407_10116252 Ga0307407_101162521 273
184 3300031911 Ga0307412_10015390 Ga0307412_100153903 273
185 3300031995 Ga0307409_100008915 Ga0307409_1000089154 273
186 3300032002 Ga0307416_100007749 Ga0307416_1000077493 273
187 3300032004 Ga0307414_10003497 Ga0307414_100034972 273
188 3300032005 Ga0307411_10194515 Ga0307411_101945151 273
189 3300032126 Ga0307415_100003892 Ga0307415_1000038922 273
190 3300035117 Ga0373953_0038249 Ga0373953_0038249_835_1869 273
191 3300035172 Ga0373955_0005887 Ga0373955_0005887_3591_4625 273
192 3300035691 Ga0373931_0181803 Ga0373931_0181803_38_1063 273
193 3300035724 Ga0373933_0028239 Ga0373933_0028239_1449_2483 273
194 3300036401 Ga0373937_0000942 Ga0373937_0000942_20008_21042 273
195 3300037068 Ga0373925_0005079 Ga0373925_0005079_91_1092 273
196 3300037068 Ga0373925_0162271 Ga0373925_0162271_116_1117 273
197 3300039437 Ga0436365_0435927 Ga0436365_0435927_1118_2113 273
198 3300042156 Ga0439446_0005855 Ga0439446_0005855_2161_3165 273
199 3300042876 Ga0451577_0255726 Ga0451577_0255726_257_1258 273
200 3300046461 Ga0495641_0112946 Ga0495641_0112946_65_1066 273
201 3300046462 Ga0495651_0029685 Ga0495651_0029685_93_1088 273
202 3300046462 Ga0495651_0160947 Ga0495651_0160947_152_1186 273
203 3300046472 Ga0495580_0001761 Ga0495580_0001761_6366_7424 273
204 3300046472 Ga0495580_0158757 Ga0495580_0158757_125_1126 273
205 3300046473 Ga0495582_0008252 Ga0495582_0008252_965_2023 273
206 3300046473 Ga0495582_0092703 Ga0495582_0092703_262_1263 273
207 3300046475 Ga0495639_0002770 Ga0495639_0002770_491_1492 273
208 3300046477 Ga0495664_0018090 Ga0495664_0018090_2819_3820 273
209 3300046477 Ga0495664_0037738 Ga0495664_0037738_595_1587 273
210 3300046499 Ga0495594_0027802 Ga0495594_0027802_1984_2985 273
211 3300046511 Ga0495608_0085300 Ga0495608_0085300_613_1647 273
212 3300046522 Ga0495643_0001365 Ga0495643_0001365_9585_10586 273
213 3300046526 Ga0495666_0105321 Ga0495666_0105321_253_1254 273
214 3300046533 Ga0495640_0001536 Ga0495640_0001536_16406_17407 273
215 3300046559 Ga0495667_0020188 Ga0495667_0020188_3179_4213 273
216 3300046642 Ga0495634_0030837 Ga0495634_0030837_620_1621 273
217 3300046679 Ga0495623_0012602 Ga0495623_0012602_264_1298 273
218 3300046683 Ga0495658_0004984 Ga0495658_0004984_4669_5670 273
219 3300046689 Ga0495613_0118005 Ga0495613_0118005_265_1266 273
220 3300047315 Ga0495581_0011949 Ga0495581_0011949_246_1247 273
221 3300047317 Ga0495604_0001058 Ga0495604_0001058_8649_9683 273
222 3300047319 Ga0495674_0012116 Ga0495674_0012116_6962_7963 273
223 3300047321 Ga0495676_0011010 Ga0495676_0011010_5701_6702 273
224 3300047322 Ga0495680_0037013 Ga0495680_0037013_1820_2821 273
225 3300047471 Ga0495684_0049374 Ga0495684_0049374_373_1407 273
226 3300047471 Ga0495684_0069219 Ga0495684_0069219_851_1846 273
227 3300047673 Ga0495593_0127502 Ga0495593_0127502_229_1230 273
228 3300048088 Ga0495602_0077324 Ga0495602_0077324_437_1471 273
229 3300048917 Ga0496114_0087539 Ga0496114_0087539_20_1015 273
230 3300048918 Ga0496115_0071591 Ga0496115_0071591_339_1334 273
231 3300049743 Ga0501081_0080138 Ga0501081_0080138_129_1130 273
232 3300050509 nmdc:mga0qj67_87327_c1 nmdc:mga0qj67_87327_c1_700_1701 273
233 3300050510 nmdc:mga06r32_58415_c1 nmdc:mga06r32_58415_c1_1662_2663 273
234 3300050511 nmdc:mga08y16_93507_c1 nmdc:mga08y16_93507_c1_1729_2730 273
235 3300050512 nmdc:mga0n895_107939_c1 nmdc:mga0n895_107939_c1_66_1070 273
236 3300050512 nmdc:mga0n895_12318_c1 nmdc:mga0n895_12318_c1_5890_6894 273
237 3300050513 nmdc:mga0rr50_75992_c1 nmdc:mga0rr50_75992_c1_772_1797 273
238 3300050514 nmdc:mga08x19_11459_c1 nmdc:mga08x19_11459_c1_2206_3210 273
239 3300050514 nmdc:mga08x19_4823_c1 nmdc:mga08x19_4823_c1_3427_4425 273
240 3300050515 nmdc:mga0a205_109756_c1 nmdc:mga0a205_109756_c1_863_1888 273
241 3300005445 Ga0070708_100061929 Ga0070708_1000619294 274
242 3300005468 Ga0070707_100015685 Ga0070707_10001568510 274
243 3300005468 Ga0070707_100492040 Ga0070707_1004920401 274
244 3300005536 Ga0070697_100030839 Ga0070697_1000308394 274
245 3300006186 Ga0075369_10041701 Ga0075369_100417012 274
246 3300009093 Ga0105240_10088482 Ga0105240_100884823 274
247 3300009545 Ga0105237_10220250 Ga0105237_102202502 274
248 3300025922 Ga0207646_10041211 Ga0207646_100412112 274
249 3300027671 Ga0209588_1020474 Ga0209588_10204743 274
250 3300046522 Ga0495643_0098920 Ga0495643_0098920_243_1256 274
251 3300053085 Ga0495619_0116212 Ga0495619_0116212_182_1192 274
252 3300053153 Ga0500616_0023070 Ga0500616_0023070_1227_2240 274
253 3300005329 Ga0070683_100317230 Ga0070683_1003172301 275
254 3300005548 Ga0070665_100034462 Ga0070665_1000344624 275
255 3300010375 Ga0105239_10049968 Ga0105239_100499684 275
256 3300025913 Ga0207695_10020919 Ga0207695_100209197 275
257 3300031344 Ga0265316_10016603 Ga0265316_100166035 275
258 3300046453 Ga0495627_001886 Ga0495627_001886_6883_7941 276
259 3300005468 Ga0070707_100026356 Ga0070707_1000263564 281
260 3300005536 Ga0070697_100026637 Ga0070697_1000266372 281
261 3300025922 Ga0207646_10006432 Ga0207646_1000643214 281
262 3300046472 Ga0495580_0317865 Ga0495580_0317865_14_1033 282
263 3300046473 Ga0495582_0025280 Ga0495582_0025280_1549_2589 287
264 3300046475 Ga0495639_0004758 Ga0495639_0004758_4503_5543 287
265 3300046477 Ga0495664_0011956 Ga0495664_0011956_2207_3247 287
266 3300046517 Ga0495630_0105812 Ga0495630_0105812_197_1237 287
267 3300046526 Ga0495666_0012101 Ga0495666_0012101_1200_2240 287
268 3300046535 Ga0495586_0024746 Ga0495586_0024746_1903_2943 287
269 3300046642 Ga0495634_0018481 Ga0495634_0018481_2416_3456 287
270 3300046683 Ga0495658_0030122 Ga0495658_0030122_1588_2628 287
271 3300046689 Ga0495613_0167370 Ga0495613_0167370_404_1444 287
272 3300046690 Ga0495624_0083316 Ga0495624_0083316_430_1470 287
273 3300047319 Ga0495674_0023123 Ga0495674_0023123_3186_4226 287
274 3300047321 Ga0495676_0145016 Ga0495676_0145016_297_1337 287
275 3300047322 Ga0495680_0014275 Ga0495680_0014275_5315_6355 287
276 3300048928 Ga0496125_0000177 Ga0496125_0000177_35119_36186 288
277 iso_pu_bacteria 2919509842 2919511330 293
278 iso_pu_bacteria 2881247448 2881249669 294
279 iso_pu_bacteria 2958512119 2958512313 294
280 3300048928 Ga0496125_0037970 Ga0496125_0037970_751_1827 304
281 3300048929 Ga0496126_0005397 Ga0496126_0005397_9529_10671 305
282 3300013105 Ga0157369_10002177 Ga0157369_100021772 307
283 3300013102 Ga0157371_10000012 Ga0157371_10000012108 313
284 iso_pu_bacteria 2738541273 2738700587 320
285 iso_pu_bacteria 2738543014 2739254336 320
286 iso_pu_bacteria 2585428061 2587752908 321
287 iso_pu_bacteria 2511231000 2511232030 322
288 iso_pu_bacteria 2523533629 2524004614 322
289 iso_pu_bacteria 2582581278 2585145239 322
290 iso_pu_bacteria 2582581281 2585156028 322
291 iso_pu_bacteria 2582581282 2585160048 322
292 iso_pu_bacteria 2582581873 2585426546 322
293 iso_pu_bacteria 2585428045 2587681240 322
294 iso_pu_bacteria 2585428060 2587748129 322
295 iso_pu_bacteria 2585428095 2587865248 322
296 iso_pu_bacteria 2585428115 2587942188 322
297 iso_pu_bacteria 2585428182 2588209318 322
298 iso_pu_bacteria 2585428183 2588215979 322
299 iso_pu_bacteria 2585428184 2588217441 322
300 iso_pu_bacteria 2585428185 2588222188 322
301 iso_pu_bacteria 2585428187 2588234847 322
302 iso_pu_bacteria 2588253712 2588444484 322
303 iso_pu_bacteria 2588254255 2590600125 322
304 iso_pu_bacteria 2588254257 2590613131 322
305 iso_pu_bacteria 2728369107 2729199681 322
306 iso_pu_bacteria 2739367874 2740061067 322
307 iso_pu_bacteria 2751185877 2753671612 322
308 iso_pu_bacteria 2765235839 2765576384 322
309 iso_pu_bacteria 2772190705 2772606824 322
310 iso_pu_bacteria 2775506739 2775673756 322
311 iso_pu_bacteria 2816332188 2816871829 322
312 iso_pu_bacteria 2842083920 2842088363 322
313 iso_pu_bacteria 2871720351 2871721199 322
314 iso_pu_bacteria 2889290771 2889293107 322
315 iso_pu_bacteria 2905999023 2906002584 322
316 iso_pu_bacteria 2919097161 2919097858 322
317 iso_pu_bacteria 2919399522 2919400955 322
318 iso_pu_bacteria 2945924605 2945926350 322
319 iso_pu_bacteria 2946019816 2946022356 322
320 iso_pu_bacteria 2977243572 2977247100 322
321 iso_pu_bacteria 2984572630 2984572971 322
322 iso_pu_bacteria 2984606641 2984610420 322
323 iso_pu_bacteria 2993372514 2993372601 322
324 iso_pu_bacteria 2993480792 2993483367 322
325 3300032004 Ga0307414_10000010 Ga0307414_10000010156 325
326 3300046525 Ga0495663_0005302 Ga0495663_0005302_655_1797 325
327 2162886007 SwRhRL2b_contig_971772 SwRhRL2b_0108.00004450 326
328 3300001915 JGI24741J21665_1001136 JGI24741J21665_10011365 326
329 3300003322 rootL2_10256953 rootL2_102569534 326
330 3300003784 Ga0055534_1008916 Ga0055534_10089163 326
331 3300005288 Ga0065714_10064864 Ga0065714_1006486416 326
332 3300005289 Ga0065704_10076605 Ga0065704_100766052 326
333 3300005289 Ga0065704_10090573 Ga0065704_100905732 326
334 3300005329 Ga0070683_100003563 Ga0070683_1000035632 326
335 3300005337 Ga0070682_100000487 Ga0070682_10000048719 326
336 3300005339 Ga0070660_100057193 Ga0070660_1000571933 326
337 3300009036 Ga0105244_10000043 Ga0105244_1000004316 326
338 3300009148 Ga0105243_10001102 Ga0105243_100011023 326
339 3300013100 Ga0157373_10000163 Ga0157373_1000016338 326
340 3300013104 Ga0157370_10004679 Ga0157370_100046798 326
341 3300013104 Ga0157370_10243856 Ga0157370_102438562 326
342 3300013105 Ga0157369_10064398 Ga0157369_100643983 326
343 3300013308 Ga0157375_10000690 Ga0157375_100006903 326
344 3300014497 Ga0182008_10000033 Ga0182008_1000003353 326
345 3300015261 Ga0182006_1000016 Ga0182006_1000016282 326
346 3300017792 Ga0163161_10002751 Ga0163161_100027516 326
347 3300017792 Ga0163161_10157227 Ga0163161_101572271 326
348 3300025291 Ga0209675_1000095 Ga0209675_1000095124 326
349 3300025728 Ga0207655_1000237 Ga0207655_100023738 326
350 3300025919 Ga0207657_10099603 Ga0207657_100996031 326
351 3300025935 Ga0207709_10000774 Ga0207709_100007745 326
352 3300025944 Ga0207661_10062981 Ga0207661_100629813 326
353 3300031911 Ga0307412_10000079 Ga0307412_1000007972 326
354 3300031911 Ga0307412_10003135 Ga0307412_100031352 326
355 3300032002 Ga0307416_100000051 Ga0307416_10000005144 326
356 3300032004 Ga0307414_10100284 Ga0307414_101002842 326
357 3300041413 Ga0439465_0000613 Ga0439465_0000613_4718_5860 326
358 3300042004 Ga0439445_0000003 Ga0439445_0000003_18566_19708 326
359 3300046453 Ga0495627_000025 Ga0495627_000025_186259_187401 326
360 3300046453 Ga0495627_003047 Ga0495627_003047_6473_7615 326
361 3300046460 Ga0495638_0051297 Ga0495638_0051297_1318_2460 326
362 3300046500 Ga0495596_0000747 Ga0495596_0000747_1754_2896 326
363 3300046507 Ga0495606_0028401 Ga0495606_0028401_2179_3321 326
364 3300046512 Ga0495610_0000009 Ga0495610_0000009_544477_545619 326
365 3300046525 Ga0495663_0000655 Ga0495663_0000655_4995_6137 326
366 3300046530 Ga0495654_0000242 Ga0495654_0000242_19000_20142 326
367 3300046538 Ga0495609_0000047 Ga0495609_0000047_69602_70744 326
368 3300046558 Ga0495633_0000341 Ga0495633_0000341_15497_16639 326
369 3300046558 Ga0495633_0001668 Ga0495633_0001668_4859_6001 326
370 3300047472 Ga0495686_0000485 Ga0495686_0000485_23208_24350 326
371 3300047472 Ga0495686_0012111 Ga0495686_0012111_4420_5562 326
372 3300048905 Ga0496102_0024248 Ga0496102_0024248_3755_4897 326
373 3300048919 Ga0496116_0000919 Ga0496116_0000919_31769_32911 326
374 3300048920 Ga0496117_0000285 Ga0496117_0000285_59656_60798 326
375 3300048921 Ga0496118_0001982 Ga0496118_0001982_15958_17100 326
376 3300048922 Ga0496119_0000004 Ga0496119_0000004_475913_477055 326
377 3300048924 Ga0496121_0066933 Ga0496121_0066933_1546_2688 326
378 3300048925 Ga0496122_0000856 Ga0496122_0000856_37175_38317 326
379 3300048925 Ga0496122_0001202 Ga0496122_0001202_31679_32821 326
380 3300048925 Ga0496122_0003831 Ga0496122_0003831_17206_18348 326
381 3300048925 Ga0496122_0003925 Ga0496122_0003925_4844_5986 326
382 3300048926 Ga0496123_0006239 Ga0496123_0006239_8132_9274 326
383 3300048926 Ga0496123_0027340 Ga0496123_0027340_3060_4202 326
384 3300048926 Ga0496123_0050555 Ga0496123_0050555_797_1939 326
385 3300048927 Ga0496124_0006237 Ga0496124_0006237_9335_10477 326
386 3300048928 Ga0496125_0000552 Ga0496125_0000552_61064_62206 326
387 3300049758 Ga0501241_000014 Ga0501241_000014_57019_58161 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01384

PHO4

Phosphate transporter family

21

358

0.8

Feature Viewer

pLDDT pTM Quality
67.78 0.38 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map