F430665

General Info

Members Datasets Scaffolds Average Seq Length
386 240 379 421

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_77914_c1|nmdc:mga0yw44_77914_c1_527_2047
Length 506
Sequence VRTRACEAAKRKARHHAVTCQRQLFPARQPDAIWHKGCYYEYKRILNDEVRVNKGVHPHESRARCCAFFVSIQPWNISAMKPSKPVAPATTVVANEGRRSLLKHAGVLGGAGLMSMLTPGLRGAVHAAGSDAPEKKEVKVGFIPLTDCASVVMASVMEFDKKYGIKIVPTKEASWASVRDKLVNGELDAAHVLYGLIYGVHNGVGGPKKDMAVLMNLNHNGQAITLSKKLNEKGVKDGASLKALMDKEKREYIFAQTFPTGTHAMWIYYWLAAQGIDPLKDAKAITVPPPQMVANMRVGNMDGYCVGEPWGNRAIADGIGFTVETTQAIWKDHPEKVLGTSADWVAKNPNTARAMTAAILDAGRWIDASLSNRQKTAQTVADRSYVNTDADIIVARMLGRYDNGIGKKWDDPDYMKFYNDGAVNFPYLSDGMWFMTQHRRWGLMKTDLDYLAVAKQVNRIDIYKDAATAAKTSVAKSDMRTHKLIDGTVWDGKDPKKYASGFKIHA

Samples

Sample ID Description Type Environment
1 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
2 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
3 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
4 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
5 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
6 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
149 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
156 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
157 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
177 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
178 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
179 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
197 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
198 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
199 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
204 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
208 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
209 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
210 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
221 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
222 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
237 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
238 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
239 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
240 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 0
Isolates 1.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.06
Nodule 0.52
Rhizoplane 2.33
Rhizosphere 79.53
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10001315 3300003187 Bacteria 17394
2 JGI25151J46595_10038402 3300003187 Bacteria 1782
3 JGI25161J50226_1000835 3300003374 Bacteria 11514
4 Ga0055526_1006460 3300003771 Bacteria 6356
5 Ga0055537_1002374 3300003773 Bacteria 6371
6 Ga0055524_1002073 3300003775 Bacteria 10626
7 Ga0055524_1002533 3300003775 Bacteria 9356
8 Ga0055524_1005230 3300003775 Bacteria 5834
9 Ga0055536_1000134 3300003781 Bacteria 63257
10 Ga0055534_1001576 3300003784 Bacteria 8862
11 Ga0055534_1002439 3300003784 Bacteria 6434
12 Ga0055530_10001933 3300003791 Bacteria 14134
13 Ga0055543_1001437 3300004625 Bacteria 9469
14 Ga0065165_1004653 3300005262 Bacteria 8311
15 Ga0065165_1013869 3300005262 Bacteria 3169
16 Ga0070658_10179121 3300005327 Bacteria 1783
17 Ga0070676_10047775 3300005328 Bacteria 2500
18 Ga0070683_100017689 3300005329 Bacteria 6299
19 Ga0070690_100014451 3300005330 Bacteria 4683
20 Ga0070670_100005362 3300005331 Bacteria 10823
21 Ga0070670_100028987 3300005331 Bacteria 4764
22 Ga0070670_100037626 3300005331 Bacteria 4162
23 Ga0068869_100000106 3300005334 Bacteria 39499
24 Ga0068869_100016487 3300005334 Bacteria 4980
25 Ga0068869_100068815 3300005334 Bacteria 2616
26 Ga0070680_100070604 3300005336 Bacteria 2868
27 Ga0070680_100126122 3300005336 Bacteria 2139
28 Ga0068868_100008784 3300005338 Bacteria 7240
29 Ga0068868_100024020 3300005338 Bacteria 4620
30 Ga0070660_100005509 3300005339 Bacteria 8766
31 Ga0070660_100027633 3300005339 Bacteria 4236
32 Ga0070660_100132541 3300005339 Bacteria 1995
33 Ga0070689_100025034 3300005340 Bacteria 4482
34 Ga0070661_100020266 3300005344 Bacteria 4740
35 Ga0070661_100052636 3300005344 Bacteria 2980
36 Ga0070661_100105734 3300005344 Bacteria 2098
37 Ga0070692_10063593 3300005345 Bacteria 1949
38 Ga0070668_100011697 3300005347 Bacteria 6534
39 Ga0070668_100014416 3300005347 Bacteria 5908
40 Ga0070668_100065440 3300005347 Bacteria 2820
41 Ga0070669_100000995 3300005353 Bacteria 20639
42 Ga0070669_100064627 3300005353 Bacteria 2695
43 Ga0070675_100047235 3300005354 Bacteria 3527
44 Ga0070675_100060882 3300005354 Bacteria 3116
45 Ga0070675_100148081 3300005354 Bacteria 2011
46 Ga0070675_100340440 3300005354 Bacteria 1328
47 Ga0070671_100064651 3300005355 Bacteria 3046
48 Ga0070671_100184858 3300005355 Bacteria 1765
49 Ga0070673_100015414 3300005364 Bacteria 5368
50 Ga0070673_100031370 3300005364 Bacteria 3987
51 Ga0070667_100000861 3300005367 Bacteria 28255
52 Ga0070667_100159908 3300005367 Bacteria 1983
53 Ga0070667_100160301 3300005367 Bacteria 1981
54 Ga0070701_10012992 3300005438 Bacteria 3776
55 Ga0070700_100009006 3300005441 Bacteria 5466
56 Ga0070700_100090817 3300005441 Bacteria 1992
57 Ga0070662_100075759 3300005457 Bacteria 2492
58 Ga0068867_100000742 3300005459 Bacteria 21874
59 Ga0068867_100010377 3300005459 Bacteria 6572
60 Ga0068867_100164266 3300005459 Bacteria 1753
61 Ga0068867_100228382 3300005459 Bacteria 1503
62 Ga0070698_100009492 3300005471 Bacteria 10421
63 Ga0068853_100166382 3300005539 Bacteria 1993
64 Ga0070672_100024857 3300005543 Bacteria 4434
65 Ga0070672_100051058 3300005543 Bacteria 3223
66 Ga0070672_100123335 3300005543 Bacteria 2123
67 Ga0070665_100029022 3300005548 Bacteria 5569
68 Ga0070665_100145120 3300005548 Bacteria 2377
69 Ga0070704_100222609 3300005549 Bacteria 1535
70 Ga0068855_100085413 3300005563 Bacteria 3651
71 Ga0068855_100378172 3300005563 Bacteria 1555
72 Ga0070664_100012340 3300005564 Bacteria 6943
73 Ga0070664_100265034 3300005564 Bacteria 1546
74 Ga0068854_100014861 3300005578 Bacteria 5141
75 Ga0070702_100013820 3300005615 Bacteria 4085
76 Ga0070702_100037916 3300005615 Bacteria 2680
77 Ga0068852_100002785 3300005616 Bacteria 12109
78 Ga0068859_100000273 3300005617 Bacteria 51339
79 Ga0068859_100034835 3300005617 Bacteria 5051
80 Ga0068859_100140283 3300005617 Bacteria 2490
81 Ga0068864_100000963 3300005618 Bacteria 24153
82 Ga0068864_100092240 3300005618 Bacteria 2673
83 Ga0068866_10044936 3300005718 Bacteria 2213
84 Ga0068861_100002534 3300005719 Bacteria 11939
85 Ga0068861_100004902 3300005719 Bacteria 9011
86 Ga0068870_10005790 3300005840 Bacteria 5421
87 Ga0068870_10112724 3300005840 Bacteria 1555
88 Ga0068863_100010467 3300005841 Bacteria 9016
89 Ga0068863_100052150 3300005841 Bacteria 3877
90 Ga0068858_100013306 3300005842 Bacteria 7759
91 Ga0068858_100027046 3300005842 Bacteria 5328
92 Ga0068860_100017893 3300005843 Bacteria 6901
93 Ga0068862_100003118 3300005844 Bacteria 14450
94 Ga0068862_100008725 3300005844 Bacteria 8391
95 Ga0068862_100043133 3300005844 Bacteria 3845
96 Ga0075363_100020767 3300006048 Bacteria 3298
97 Ga0075364_10009289 3300006051 Bacteria 5893
98 Ga0075364_10022937 3300006051 Bacteria 3947
99 Ga0075362_10043758 3300006177 Bacteria 1983
100 Ga0075367_10005208 3300006178 Bacteria 6429
101 Ga0075369_10002991 3300006186 Bacteria 6108
102 Ga0075369_10005360 3300006186 Bacteria 4785
103 Ga0075369_10006359 3300006186 Bacteria 4463
104 Ga0075366_10011139 3300006195 Bacteria 5069
105 Ga0075366_10013373 3300006195 Bacteria 4670
106 Ga0075366_10023572 3300006195 Bacteria 3586
107 Ga0075366_10031818 3300006195 Bacteria 3105
108 Ga0097621_100047184 3300006237 Bacteria 3489
109 Ga0075370_10016055 3300006353 Bacteria 4023
110 Ga0068871_100011520 3300006358 Bacteria 6486
111 Ga0068871_100111107 3300006358 Bacteria 2305
112 Ga0075428_100268160 3300006844 Bacteria 1837
113 Ga0075430_100012580 3300006846 Bacteria 7205
114 Ga0075430_100050787 3300006846 Bacteria 3495
115 Ga0075431_100019741 3300006847 Bacteria 6878
116 Ga0075431_100093331 3300006847 Bacteria 3106
117 Ga0075431_100100742 3300006847 Bacteria 2981
118 Ga0075431_100323921 3300006847 Bacteria 1553
119 Ga0075429_100000015 3300006880 Bacteria 78823
120 Ga0075429_100001431 3300006880 Bacteria 19585
121 Ga0075429_100137692 3300006880 Bacteria 2137
122 Ga0075429_100160873 3300006880 Bacteria 1966
123 Ga0097620_100000273 3300006931 Bacteria 51339
124 Ga0097620_100034835 3300006931 Bacteria 5051
125 Ga0097620_100140282 3300006931 Bacteria 2490
126 Ga0099826_10000007 3300006948 Bacteria 393518
127 Ga0099794_10012839 3300007265 Bacteria 3629
128 Ga0111539_10158327 3300009094 Bacteria 2649
129 Ga0114129_10002286 3300009147 Bacteria 26528
130 Ga0114129_10050630 3300009147 Bacteria 5834
131 Ga0114129_10056195 3300009147 Bacteria 5514
132 Ga0114129_10300099 3300009147 Bacteria 2141
133 Ga0105243_10017446 3300009148 Bacteria 5427
134 Ga0105243_10029716 3300009148 Bacteria 4205
135 Ga0105243_10211775 3300009148 Bacteria 1707
136 Ga0105241_10017747 3300009174 Bacteria 5234
137 Ga0105242_10027042 3300009176 Bacteria 4550
138 Ga0105242_10086265 3300009176 Bacteria 2634
139 Ga0105248_10005623 3300009177 Bacteria 13763
140 Ga0105237_10068023 3300009545 Bacteria 3556
141 Ga0105238_10324503 3300009551 Bacteria 1526
142 Ga0105249_10001620 3300009553 Bacteria 19709
143 Ga0105246_10057403 3300011119 Bacteria 2693
144 Ga0157373_10130153 3300013100 Bacteria 1770
145 Ga0157378_10009669 3300013297 Bacteria 8398
146 Ga0157378_10059018 3300013297 Bacteria 3423
147 Ga0163162_10005803 3300013306 Bacteria 11947
148 Ga0163162_10063815 3300013306 Bacteria 3728
149 Ga0157375_10039512 3300013308 Bacteria 4542
150 Ga0157375_10324099 3300013308 Bacteria 1705
151 Ga0163163_10073189 3300014325 Bacteria 3417
152 Ga0157380_10011934 3300014326 Bacteria 6286
153 Ga0157380_10028648 3300014326 Bacteria 4248
154 Ga0157380_10213030 3300014326 Bacteria 1723
155 Ga0157380_10261486 3300014326 Bacteria 1572
156 Ga0157377_10010373 3300014745 Bacteria 4607
157 Ga0157377_10012505 3300014745 Bacteria 4270
158 Ga0157377_10034527 3300014745 Bacteria 2767
159 Ga0157377_10047751 3300014745 Bacteria 2399
160 Ga0157379_10000629 3300014968 Bacteria 28451
161 Ga0157376_10007184 3300014969 Bacteria 7918
162 Ga0157376_10066377 3300014969 Bacteria 3050
163 Ga0157376_10093549 3300014969 Bacteria 2610
164 Ga0209436_100521 3300025208 Bacteria 16709
165 Ga0209563_100015 3300025230 Bacteria 879901
166 Ga0209565_1000104 3300025263 Bacteria 124432
167 Ga0209565_1001401 3300025263 Bacteria 10731
168 Ga0209565_1010479 3300025263 Bacteria 2297
169 Ga0209130_1001287 3300025284 Bacteria 17337
170 Ga0209675_1000191 3300025291 Bacteria 67500
171 Ga0209675_1002151 3300025291 Bacteria 10391
172 Ga0209676_1000036 3300025292 Bacteria 457623
173 Ga0209025_1000905 3300025294 Bacteria 45998
174 Ga0209025_1001806 3300025294 Bacteria 25356
175 Ga0209025_1002048 3300025294 Bacteria 22965
176 Ga0209564_1000639 3300025295 Bacteria 53129
177 Ga0209564_1000688 3300025295 Bacteria 49680
178 Ga0209564_1002275 3300025295 Bacteria 15701
179 Ga0209564_1004020 3300025295 Bacteria 9304
180 Ga0209050_1000469 3300025298 Bacteria 71511
181 Ga0209256_1001092 3300025299 Bacteria 31208
182 Ga0209256_1001334 3300025299 Bacteria 26338
183 Ga0209256_1001909 3300025299 Bacteria 19072
184 Ga0207426_1010077 3300025302 Bacteria 3694
185 Ga0209051_1026910 3300025303 Bacteria 2304
186 Ga0207655_1045729 3300025728 Bacteria 1824
187 Ga0207682_10013444 3300025893 Bacteria 3189
188 Ga0207642_10071679 3300025899 Bacteria 1651
189 Ga0207688_10016217 3300025901 Bacteria 4040
190 Ga0207680_10042399 3300025903 Bacteria 2662
191 Ga0207645_10011275 3300025907 Bacteria 6109
192 Ga0207645_10018600 3300025907 Bacteria 4565
193 Ga0207643_10004615 3300025908 Bacteria 7398
194 Ga0207705_10101798 3300025909 Bacteria 2113
195 Ga0207684_10051223 3300025910 Bacteria 3503
196 Ga0207654_10016090 3300025911 Bacteria 3890
197 Ga0207671_10030997 3300025914 Bacteria 3987
198 Ga0207660_10027301 3300025917 Bacteria 3894
199 Ga0207660_10056327 3300025917 Bacteria 2812
200 Ga0207662_10013720 3300025918 Bacteria 4535
201 Ga0207662_10061849 3300025918 Bacteria 2249
202 Ga0207657_10002609 3300025919 Bacteria 19479
203 Ga0207649_10009052 3300025920 Bacteria 5440
204 Ga0207649_10013731 3300025920 Bacteria 4527
205 Ga0207681_10080811 3300025923 Bacteria 2294
206 Ga0207650_10004337 3300025925 Bacteria 9688
207 Ga0207650_10007639 3300025925 Bacteria 7365
208 Ga0207650_10046549 3300025925 Bacteria 3194
209 Ga0207650_10208530 3300025925 Bacteria 1568
210 Ga0207659_10009785 3300025926 Bacteria 5997
211 Ga0207659_10044984 3300025926 Bacteria 3109
212 Ga0207659_10103492 3300025926 Bacteria 2151
213 Ga0207687_10039974 3300025927 Bacteria 3213
214 Ga0207687_10088779 3300025927 Bacteria 2250
215 Ga0207644_10019514 3300025931 Bacteria 4599
216 Ga0207644_10021558 3300025931 Bacteria 4391
217 Ga0207690_10002750 3300025932 Bacteria 10627
218 Ga0207690_10003354 3300025932 Bacteria 9572
219 Ga0207706_10082841 3300025933 Bacteria 2820
220 Ga0207709_10019286 3300025935 Bacteria 3832
221 Ga0207709_10154304 3300025935 Bacteria 1594
222 Ga0207670_10010367 3300025936 Bacteria 5364
223 Ga0207704_10012882 3300025938 Bacteria 4165
224 Ga0207704_10076425 3300025938 Bacteria 2146
225 Ga0207691_10002613 3300025940 Bacteria 17590
226 Ga0207691_10006268 3300025940 Bacteria 11483
227 Ga0207689_10000118 3300025942 Bacteria 65374
228 Ga0207689_10003339 3300025942 Bacteria 14703
229 Ga0207689_10141217 3300025942 Bacteria 1984
230 Ga0207679_10000906 3300025945 Bacteria 18937
231 Ga0207667_10006079 3300025949 Bacteria 14670
232 Ga0207651_10014268 3300025960 Bacteria 4580
233 Ga0207651_10019279 3300025960 Bacteria 4083
234 Ga0207712_10070883 3300025961 Bacteria 2505
235 Ga0207712_10153066 3300025961 Bacteria 1783
236 Ga0207668_10022551 3300025972 Bacteria 4033
237 Ga0207668_10043293 3300025972 Bacteria 3054
238 Ga0207658_10153632 3300025986 Bacteria 1878
239 Ga0207677_10022469 3300026023 Bacteria 3877
240 Ga0207703_10001578 3300026035 Bacteria 20652
241 Ga0207703_10038294 3300026035 Bacteria 3825
242 Ga0207703_10188046 3300026035 Bacteria 1827
243 Ga0207639_10029242 3300026041 Bacteria 4032
244 Ga0207708_10007316 3300026075 Bacteria 8159
245 Ga0207648_10000238 3300026089 Bacteria 59053
246 Ga0207648_10001056 3300026089 Bacteria 30829
247 Ga0207648_10007566 3300026089 Bacteria 10660
248 Ga0207648_10029709 3300026089 Bacteria 4847
249 Ga0207676_10016917 3300026095 Bacteria 5280
250 Ga0207676_10077609 3300026095 Bacteria 2687
251 Ga0207674_10026030 3300026116 Bacteria 6225
252 Ga0207675_100000979 3300026118 Bacteria 28349
253 Ga0207675_100012412 3300026118 Bacteria 7958
254 Ga0207675_100099797 3300026118 Bacteria 2735
255 Ga0207683_10033260 3300026121 Bacteria 4478
256 Ga0207698_10008426 3300026142 Bacteria 6521
257 Ga0207698_10075271 3300026142 Bacteria 2697
258 Ga0209282_1000021 3300027666 Bacteria 177705
259 Ga0209588_1010205 3300027671 Bacteria 2819
260 Ga0268266_10255791 3300028379 Bacteria 1621
261 Ga0268265_10000459 3300028380 Bacteria 43185
262 Ga0268264_10001039 3300028381 Bacteria 27889
263 Ga0268264_10244393 3300028381 Bacteria 1664
264 Ga0265318_10012590 3300028577 Bacteria 3594
265 Ga0307515_10000020 3300028794 Bacteria 411735
266 Ga0307511_10017009 3300030521 Bacteria 6990
267 Ga0316177_1151259 3300030731 Bacteria 3985
268 Ga0316180_1100674 3300030736 Bacteria 4776
269 Ga0265332_10002147 3300031238 Bacteria 10174
270 Ga0265331_10001179 3300031250 Bacteria 19910
271 Ga0265327_10000235 3300031251 Bacteria 111362
272 Ga0265327_10011126 3300031251 Bacteria 6241
273 Ga0265327_10044005 3300031251 Bacteria 2384
274 Ga0307508_10032307 3300031616 Bacteria 4728
275 Ga0265314_10000887 3300031711 Bacteria 35662
276 Ga0307416_100009076 3300032002 Bacteria 6475
277 Ga0373923_0035349 3300035111 Bacteria 2034
278 Ga0373960_0014627 3300035121 Bacteria 1991
279 Ga0373924_0027520 3300035410 Bacteria 2261
280 Ga0373933_0009629 3300035724 Bacteria 5278
281 Ga0373937_0049635 3300036401 Bacteria 3842
282 Ga0395899_0013433 3300037312 Bacteria 6264
283 Ga0395899_0017193 3300037312 Bacteria 5509
284 Ga0395899_0045648 3300037312 Bacteria 3264
285 Ga0395900_0001738 3300037418 Bacteria 25108
286 Ga0395900_0004356 3300037418 Bacteria 15021
287 Ga0395898_0016407 3300037466 Bacteria 7580
288 Ga0395898_0049958 3300037466 Bacteria 4095
289 Ga0395898_0232929 3300037466 Bacteria 1756
290 Ga0395905_0054285 3300037471 Bacteria 3750
291 Ga0395905_0149866 3300037471 Bacteria 2194
292 Ga0395901_0001782 3300038443 Bacteria 22209
293 Ga0439441_000604 3300042001 Bacteria 4037
294 Ga0439448_0001936 3300042005 Bacteria 5517
295 Ga0439450_002808 3300042008 Bacteria 2795
296 Ga0439455_0003148 3300042012 Bacteria 3111
297 Ga0439435_0003266 3300042436 Bacteria 3350
298 Ga0439460_0021753 3300042461 Bacteria 1756
299 Ga0466972_0020642 3300044658 Bacteria 3291
300 Ga0466965_0010530 3300044683 Bacteria 4319
301 Ga0466965_0024429 3300044683 Bacteria 2923
302 Ga0466966_0013081 3300044684 Bacteria 5494
303 Ga0466966_0056758 3300044684 Bacteria 2476
304 Ga0466961_0000232 3300044693 Bacteria 37669
305 Ga0466964_0055629 3300044706 Bacteria 1634
306 Ga0453684_0023507 3300044712 Bacteria 9070
307 Ga0466971_0104350 3300044719 Bacteria 1304
308 Ga0466957_0027728 3300044842 Bacteria 3367
309 Ga0466959_0012677 3300045049 Bacteria 6097
310 Ga0466959_0036373 3300045049 Bacteria 3638
311 Ga0466959_0061224 3300045049 Bacteria 2737
312 Ga0451576_0236095 3300045051 Bacteria 1910
313 Ga0466967_0008988 3300045976 Bacteria 7381
314 Ga0495605_0000085 3300046474 Bacteria 121011
315 Ga0495607_0034853 3300046501 Bacteria 3050
316 Ga0495583_0000205 3300046506 Bacteria 99711
317 Ga0495616_0000145 3300046513 Bacteria 62415
318 Ga0495643_0004391 3300046522 Bacteria 9879
319 Ga0495643_0015686 3300046522 Bacteria 4469
320 Ga0495648_0011756 3300046524 Bacteria 6569
321 Ga0495642_0000973 3300046528 Bacteria 13340
322 Ga0495598_0001997 3300046537 Bacteria 4145
323 Ga0495609_0000002 3300046538 Bacteria 739816
324 Ga0495661_0000271 3300046665 Bacteria 59543
325 Ga0495661_0000669 3300046665 Bacteria 34300
326 Ga0495661_0002269 3300046665 Bacteria 14874
327 Ga0495588_0000135 3300046674 Bacteria 117387
328 Ga0495669_0069456 3300046684 Bacteria 1604
329 Ga0495589_0000030 3300046794 Bacteria 170254
330 Ga0495589_0001070 3300046794 Bacteria 16432
331 Ga0495660_0000423 3300046810 Bacteria 35820
332 Ga0495636_0015916 3300047318 Bacteria 3000
333 Ga0495672_0000833 3300047320 Bacteria 32978
334 Ga0495687_000047 3300047443 Bacteria 206452
335 Ga0495687_000112 3300047443 Bacteria 124725
336 Ga0495687_001101 3300047443 Bacteria 26384
337 Ga0495687_002457 3300047443 Bacteria 14827
338 Ga0495677_0000044 3300047445 Bacteria 74340
339 Ga0495677_0007472 3300047445 Bacteria 4082
340 Ga0495615_0002476 3300048090 Bacteria 2966
341 Ga0495626_0000006 3300048091 Bacteria 284977
342 Ga0495626_0000266 3300048091 Bacteria 59029
343 Ga0496101_0017179 3300048904 Bacteria 4904
344 Ga0496102_0028837 3300048905 Bacteria 4962
345 Ga0496102_0034795 3300048905 Bacteria 4533
346 Ga0496102_0079152 3300048905 Bacteria 3026
347 Ga0496108_0226075 3300048911 Bacteria 1627
348 Ga0496109_0055775 3300048912 Bacteria 3605
349 Ga0496110_0164352 3300048913 Bacteria 2012
350 Ga0496111_0138359 3300048914 Bacteria 1804
351 Ga0496113_0052467 3300048916 Bacteria 3046
352 Ga0496122_0019569 3300048925 Bacteria 6174
353 Ga0496123_0005792 3300048926 Bacteria 12268
354 Ga0501198_000006 3300049649 Bacteria 129954
355 Ga0501209_002850 3300049656 Bacteria 2750
356 Ga0501222_000007 3300049662 Bacteria 126703
357 nmdc:mga03683_5252_c1 3300050489 Bacteria 4363
358 nmdc:mga03n38_2426_c1 3300050490 Bacteria 5756
359 nmdc:mga00v17_36998_c1 3300050491 Bacteria 2912
360 nmdc:mga0yw44_77914_c1 3300050492 Bacteria 2072
361 nmdc:mga0k408_14707_c1 3300050493 Bacteria 4318
362 nmdc:mga0k408_203_c2 3300050493 Bacteria 31214
363 nmdc:mga0k408_3682_c1 3300050493 Bacteria 8115
364 nmdc:mga06z11_6653_c1 3300050494 Bacteria 4723
365 nmdc:mga05p37_109994_c1 3300050507 Bacteria 3390
366 nmdc:mga05p37_211_c1 3300050507 Bacteria 58827
367 nmdc:mga09592_221138_c1 3300050508 Bacteria 1641
368 nmdc:mga09592_311_c1 3300050508 Bacteria 35521
369 nmdc:mga0qj67_33680_c1 3300050509 Bacteria 3998
370 nmdc:mga0qj67_8468_c1 3300050509 Bacteria 7631
371 nmdc:mga06r32_220197_c1 3300050510 Bacteria 1886
372 nmdc:mga06r32_244778_c1 3300050510 Bacteria 1781
373 nmdc:mga08y16_103324_c1 3300050511 Bacteria 2967
374 nmdc:mga0rr50_54374_c1 3300050513 Bacteria 2982
375 nmdc:mga0sz30_26204_c1 3300050516 Bacteria 1503
376 Ga0500655_001489 3300053133 Bacteria 4433
377 Ga0500636_0000086 3300053177 Bacteria 46124
378 Ga0500625_014769 3300053729 Bacteria 3612
379 Ga0466962_0017199 3300061719 Bacteria 3483

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035121 Ga0373960_0014627 Ga0373960_0014627_283_1554 402
2 3300003374 JGI25161J50226_1000835 JGI25161J50226_10008358 406
3 3300003775 Ga0055524_1002533 Ga0055524_10025337 406
4 3300003791 Ga0055530_10001933 Ga0055530_1000193311 406
5 3300004625 Ga0055543_1001437 Ga0055543_10014375 406
6 3300005262 Ga0065165_1004653 Ga0065165_10046533 406
7 3300025208 Ga0209436_100521 Ga0209436_10052111 406
8 3300025263 Ga0209565_1001401 Ga0209565_10014016 406
9 3300025284 Ga0209130_1001287 Ga0209130_100128711 406
10 3300025295 Ga0209564_1000639 Ga0209564_100063939 406
11 3300025298 Ga0209050_1000469 Ga0209050_100046967 406
12 3300025299 Ga0209256_1001909 Ga0209256_100190915 406
13 3300025302 Ga0207426_1010077 Ga0207426_10100772 406
14 3300032002 Ga0307416_100009076 Ga0307416_1000090767 406
15 iso_pu_bacteria 8047673197 8047677869 406
16 3300006186 Ga0075369_10006359 Ga0075369_100063593 407
17 3300050493 nmdc:mga0k408_203_c2 nmdc:mga0k408_203_c2_24218_25441 407
18 3300006880 Ga0075429_100137692 Ga0075429_1001376922 408
19 3300050493 nmdc:mga0k408_14707_c1 nmdc:mga0k408_14707_c1_957_2306 408
20 3300005336 Ga0070680_100070604 Ga0070680_1000706042 409
21 3300005345 Ga0070692_10063593 Ga0070692_100635931 409
22 3300005347 Ga0070668_100014416 Ga0070668_1000144164 409
23 3300005353 Ga0070669_100000995 Ga0070669_10000099520 409
24 3300005354 Ga0070675_100060882 Ga0070675_1000608824 409
25 3300005441 Ga0070700_100009006 Ga0070700_1000090065 409
26 3300005459 Ga0068867_100010377 Ga0068867_1000103775 409
27 3300005718 Ga0068866_10044936 Ga0068866_100449362 409
28 3300005719 Ga0068861_100004902 Ga0068861_1000049026 409
29 3300005844 Ga0068862_100008725 Ga0068862_1000087256 409
30 3300006844 Ga0075428_100268160 Ga0075428_1002681602 409
31 3300006846 Ga0075430_100012580 Ga0075430_1000125805 409
32 3300006846 Ga0075430_100050787 Ga0075430_1000507874 409
33 3300006847 Ga0075431_100019741 Ga0075431_1000197417 409
34 3300006847 Ga0075431_100093331 Ga0075431_1000933313 409
35 3300006847 Ga0075431_100323921 Ga0075431_1003239211 409
36 3300006880 Ga0075429_100160873 Ga0075429_1001608732 409
37 3300007265 Ga0099794_10012839 Ga0099794_100128392 409
38 3300009147 Ga0114129_10050630 Ga0114129_100506305 409
39 3300009148 Ga0105243_10017446 Ga0105243_100174464 409
40 3300009553 Ga0105249_10001620 Ga0105249_1000162012 409
41 3300014326 Ga0157380_10028648 Ga0157380_100286482 409
42 3300014745 Ga0157377_10047751 Ga0157377_100477513 409
43 3300025917 Ga0207660_10027301 Ga0207660_100273014 409
44 3300025926 Ga0207659_10103492 Ga0207659_101034922 409
45 3300025935 Ga0207709_10019286 Ga0207709_100192861 409
46 3300025938 Ga0207704_10012882 Ga0207704_100128822 409
47 3300025942 Ga0207689_10141217 Ga0207689_101412172 409
48 3300025961 Ga0207712_10070883 Ga0207712_100708832 409
49 3300025972 Ga0207668_10022551 Ga0207668_100225511 409
50 3300026075 Ga0207708_10007316 Ga0207708_100073166 409
51 3300026089 Ga0207648_10000238 Ga0207648_1000023860 409
52 3300026118 Ga0207675_100012412 Ga0207675_1000124126 409
53 3300028380 Ga0268265_10000459 Ga0268265_100004596 409
54 3300035111 Ga0373923_0035349 Ga0373923_0035349_668_1897 409
55 3300035410 Ga0373924_0027520 Ga0373924_0027520_786_2015 409
56 3300035724 Ga0373933_0009629 Ga0373933_0009629_2038_3267 409
57 3300036401 Ga0373937_0049635 Ga0373937_0049635_1390_2619 409
58 3300042461 Ga0439460_0021753 Ga0439460_0021753_46_1275 409
59 3300046684 Ga0495669_0069456 Ga0495669_0069456_70_1299 409
60 3300050507 nmdc:mga05p37_109994_c1 nmdc:mga05p37_109994_c1_186_1415 409
61 3300050508 nmdc:mga09592_221138_c1 nmdc:mga09592_221138_c1_279_1508 409
62 3300050509 nmdc:mga0qj67_33680_c1 nmdc:mga0qj67_33680_c1_1939_3168 409
63 3300050509 nmdc:mga0qj67_8468_c1 nmdc:mga0qj67_8468_c1_6127_7356 409
64 3300050510 nmdc:mga06r32_220197_c1 nmdc:mga06r32_220197_c1_526_1755 409
65 3300050510 nmdc:mga06r32_244778_c1 nmdc:mga06r32_244778_c1_158_1387 409
66 3300050511 nmdc:mga08y16_103324_c1 nmdc:mga08y16_103324_c1_1502_2731 409
67 3300050513 nmdc:mga0rr50_54374_c1 nmdc:mga0rr50_54374_c1_330_1559 409
68 3300005262 Ga0065165_1013869 Ga0065165_10138693 410
69 3300005327 Ga0070658_10179121 Ga0070658_101791211 410
70 3300005339 Ga0070660_100027633 Ga0070660_1000276333 410
71 3300005339 Ga0070660_100132541 Ga0070660_1001325412 410
72 3300005563 Ga0068855_100085413 Ga0068855_1000854133 410
73 3300005563 Ga0068855_100378172 Ga0068855_1003781722 410
74 3300009174 Ga0105241_10017747 Ga0105241_100177471 410
75 3300009176 Ga0105242_10086265 Ga0105242_100862652 410
76 3300009545 Ga0105237_10068023 Ga0105237_100680232 410
77 3300009551 Ga0105238_10324503 Ga0105238_103245032 410
78 3300013100 Ga0157373_10130153 Ga0157373_101301532 410
79 3300025230 Ga0209563_100015 Ga0209563_100015349 410
80 3300025728 Ga0207655_1045729 Ga0207655_10457292 410
81 3300025909 Ga0207705_10101798 Ga0207705_101017982 410
82 3300025911 Ga0207654_10016090 Ga0207654_100160903 410
83 3300025917 Ga0207660_10056327 Ga0207660_100563271 410
84 3300025932 Ga0207690_10003354 Ga0207690_100033544 410
85 3300025933 Ga0207706_10082841 Ga0207706_100828412 410
86 3300025949 Ga0207667_10006079 Ga0207667_100060795 410
87 3300026142 Ga0207698_10075271 Ga0207698_100752712 410
88 3300028794 Ga0307515_10000020 Ga0307515_10000020341 410
89 3300037312 Ga0395899_0013433 Ga0395899_0013433_2005_3237 410
90 3300037312 Ga0395899_0017193 Ga0395899_0017193_909_2141 410
91 3300037312 Ga0395899_0045648 Ga0395899_0045648_558_1790 410
92 3300037418 Ga0395900_0001738 Ga0395900_0001738_22879_24111 410
93 3300037418 Ga0395900_0004356 Ga0395900_0004356_10168_11400 410
94 3300037466 Ga0395898_0016407 Ga0395898_0016407_4344_5576 410
95 3300037466 Ga0395898_0049958 Ga0395898_0049958_453_1685 410
96 3300037466 Ga0395898_0232929 Ga0395898_0232929_442_1674 410
97 3300037471 Ga0395905_0054285 Ga0395905_0054285_1953_3185 410
98 3300037471 Ga0395905_0149866 Ga0395905_0149866_417_1649 410
99 3300038443 Ga0395901_0001782 Ga0395901_0001782_17535_18767 410
100 3300042005 Ga0439448_0001936 Ga0439448_0001936_2972_4204 410
101 3300042008 Ga0439450_002808 Ga0439450_002808_428_1660 410
102 3300042012 Ga0439455_0003148 Ga0439455_0003148_431_1663 410
103 3300044658 Ga0466972_0020642 Ga0466972_0020642_609_1841 410
104 3300044683 Ga0466965_0010530 Ga0466965_0010530_1449_2681 410
105 3300044683 Ga0466965_0024429 Ga0466965_0024429_282_1514 410
106 3300044684 Ga0466966_0056758 Ga0466966_0056758_652_1884 410
107 3300044719 Ga0466971_0104350 Ga0466971_0104350_24_1256 410
108 3300044842 Ga0466957_0027728 Ga0466957_0027728_1467_2699 410
109 3300045049 Ga0466959_0012677 Ga0466959_0012677_392_1624 410
110 3300045049 Ga0466959_0061224 Ga0466959_0061224_1241_2473 410
111 3300045976 Ga0466967_0008988 Ga0466967_0008988_4805_6037 410
112 3300046474 Ga0495605_0000085 Ga0495605_0000085_113277_114509 410
113 3300046501 Ga0495607_0034853 Ga0495607_0034853_1346_2578 410
114 3300046513 Ga0495616_0000145 Ga0495616_0000145_44643_45875 410
115 3300046522 Ga0495643_0004391 Ga0495643_0004391_1369_2685 410
116 3300046522 Ga0495643_0015686 Ga0495643_0015686_473_1705 410
117 3300046524 Ga0495648_0011756 Ga0495648_0011756_2643_3875 410
118 3300046528 Ga0495642_0000973 Ga0495642_0000973_3152_4384 410
119 3300046538 Ga0495609_0000002 Ga0495609_0000002_115352_116584 410
120 3300046665 Ga0495661_0000271 Ga0495661_0000271_6898_8130 410
121 3300046665 Ga0495661_0000669 Ga0495661_0000669_10028_11260 410
122 3300046665 Ga0495661_0002269 Ga0495661_0002269_167_1399 410
123 3300046674 Ga0495588_0000135 Ga0495588_0000135_10955_12187 410
124 3300046794 Ga0495589_0000030 Ga0495589_0000030_102206_103438 410
125 3300046794 Ga0495589_0001070 Ga0495589_0001070_11790_13022 410
126 3300046810 Ga0495660_0000423 Ga0495660_0000423_11787_13019 410
127 3300047320 Ga0495672_0000833 Ga0495672_0000833_12803_14035 410
128 3300047443 Ga0495687_000047 Ga0495687_000047_102208_103440 410
129 3300047443 Ga0495687_000112 Ga0495687_000112_44823_46055 410
130 3300047443 Ga0495687_001101 Ga0495687_001101_1547_2779 410
131 3300047445 Ga0495677_0000044 Ga0495677_0000044_66211_67443 410
132 3300047445 Ga0495677_0007472 Ga0495677_0007472_127_1359 410
133 3300048091 Ga0495626_0000006 Ga0495626_0000006_263021_264253 410
134 3300048091 Ga0495626_0000266 Ga0495626_0000266_6898_8130 410
135 3300048905 Ga0496102_0079152 Ga0496102_0079152_152_1384 410
136 3300048911 Ga0496108_0226075 Ga0496108_0226075_228_1460 410
137 3300048916 Ga0496113_0052467 Ga0496113_0052467_1028_2260 410
138 3300048925 Ga0496122_0019569 Ga0496122_0019569_528_1760 410
139 3300048926 Ga0496123_0005792 Ga0496123_0005792_606_1838 410
140 3300061719 Ga0466962_0017199 Ga0466962_0017199_346_1578 410
141 3300005471 Ga0070698_100009492 Ga0070698_1000094924 411
142 3300006880 Ga0075429_100000015 Ga0075429_10000001516 411
143 3300009147 Ga0114129_10002286 Ga0114129_1000228611 411
144 3300031251 Ga0265327_10000235 Ga0265327_100002359 411
145 3300050507 nmdc:mga05p37_211_c1 nmdc:mga05p37_211_c1_44593_45828 411
146 3300050508 nmdc:mga09592_311_c1 nmdc:mga09592_311_c1_24862_26097 411
147 3300006195 Ga0075366_10031818 Ga0075366_100318183 412
148 3300006847 Ga0075431_100100742 Ga0075431_1001007422 412
149 3300025986 Ga0207658_10153632 Ga0207658_101536322 412
150 3300030731 Ga0316177_1151259 Ga0316177_11512594 412
151 3300030736 Ga0316180_1100674 Ga0316180_11006741 412
152 3300031251 Ga0265327_10011126 Ga0265327_100111263 412
153 3300046506 Ga0495583_0000205 Ga0495583_0000205_81742_82980 412
154 3300048905 Ga0496102_0034795 Ga0496102_0034795_637_1875 412
155 3300044712 Ga0453684_0023507 Ga0453684_0023507_91_1344 413
156 3300047443 Ga0495687_002457 Ga0495687_002457_8117_9376 413
157 3300048090 Ga0495615_0002476 Ga0495615_0002476_1063_2304 413
158 3300006195 Ga0075366_10013373 Ga0075366_100133734 414
159 3300005328 Ga0070676_10047775 Ga0070676_100477752 415
160 3300005339 Ga0070660_100005509 Ga0070660_10000550910 415
161 3300005344 Ga0070661_100105734 Ga0070661_1001057342 415
162 3300005539 Ga0068853_100166382 Ga0068853_1001663822 415
163 3300005548 Ga0070665_100145120 Ga0070665_1001451202 415
164 3300006177 Ga0075362_10043758 Ga0075362_100437582 415
165 3300025914 Ga0207671_10030997 Ga0207671_100309972 415
166 3300025919 Ga0207657_10002609 Ga0207657_100026093 415
167 3300025920 Ga0207649_10009052 Ga0207649_100090523 415
168 3300025932 Ga0207690_10002750 Ga0207690_100027503 415
169 3300026041 Ga0207639_10029242 Ga0207639_100292424 415
170 3300028379 Ga0268266_10255791 Ga0268266_102557912 415
171 3300042001 Ga0439441_000604 Ga0439441_000604_648_1895 415
172 3300045051 Ga0451576_0236095 Ga0451576_0236095_288_1535 415
173 3300049656 Ga0501209_002850 Ga0501209_002850_745_2004 415
174 iso_pu_bacteria 2919704043 2919709066 415
175 iso_pu_bacteria 2998344455 2998346625 415
176 3300006048 Ga0075363_100020767 Ga0075363_1000207672 416
177 3300006051 Ga0075364_10022937 Ga0075364_100229375 416
178 3300006178 Ga0075367_10005208 Ga0075367_100052082 416
179 3300006186 Ga0075369_10002991 Ga0075369_100029914 416
180 3300006195 Ga0075366_10011139 Ga0075366_100111395 416
181 3300006195 Ga0075366_10023572 Ga0075366_100235723 416
182 3300006353 Ga0075370_10016055 Ga0075370_100160552 416
183 3300009147 Ga0114129_10056195 Ga0114129_100561955 416
184 3300050490 nmdc:mga03n38_2426_c1 nmdc:mga03n38_2426_c1_1356_2642 416
185 3300050491 nmdc:mga00v17_36998_c1 nmdc:mga00v17_36998_c1_1593_2879 416
186 3300050494 nmdc:mga06z11_6653_c1 nmdc:mga06z11_6653_c1_34_1320 416
187 3300050489 nmdc:mga03683_5252_c1 nmdc:mga03683_5252_c1_3080_4339 417
188 3300050493 nmdc:mga0k408_3682_c1 nmdc:mga0k408_3682_c1_2450_3709 417
189 3300005340 Ga0070689_100025034 Ga0070689_1000250343 418
190 3300005543 Ga0070672_100051058 Ga0070672_1000510581 418
191 3300005617 Ga0068859_100140283 Ga0068859_1001402833 418
192 3300006931 Ga0097620_100140282 Ga0097620_1001402823 418
193 3300009147 Ga0114129_10300099 Ga0114129_103000992 418
194 3300014326 Ga0157380_10261486 Ga0157380_102614861 418
195 3300014745 Ga0157377_10012505 Ga0157377_100125052 418
196 3300025936 Ga0207670_10010367 Ga0207670_100103674 418
197 3300025940 Ga0207691_10002613 Ga0207691_100026134 418
198 3300026116 Ga0207674_10026030 Ga0207674_100260304 418
199 3300053177 Ga0500636_0000086 Ga0500636_0000086_42184_43452 418
200 3300053729 Ga0500625_014769 Ga0500625_014769_1015_2283 418
201 3300005336 Ga0070680_100126122 Ga0070680_1001261222 420
202 3300006880 Ga0075429_100001431 Ga0075429_10000143110 420
203 3300027671 Ga0209588_1010205 Ga0209588_10102052 420
204 3300049649 Ga0501198_000006 Ga0501198_000006_93997_95259 420
205 3300049662 Ga0501222_000007 Ga0501222_000007_53972_55234 420
206 3300009094 Ga0111539_10158327 Ga0111539_101583271 421
207 3300044684 Ga0466966_0013081 Ga0466966_0013081_4159_5436 421
208 3300044693 Ga0466961_0000232 Ga0466961_0000232_29908_31185 421
209 3300044706 Ga0466964_0055629 Ga0466964_0055629_27_1304 421
210 3300045049 Ga0466959_0036373 Ga0466959_0036373_78_1355 421
211 3300025923 Ga0207681_10080811 Ga0207681_100808113 423
212 3300031616 Ga0307508_10032307 Ga0307508_100323074 424
213 3300050492 nmdc:mga0yw44_77914_c1 nmdc:mga0yw44_77914_c1_527_2047 424
214 iso_pu_bacteria 2808606386 2808984966 424
215 iso_pu_bacteria 2808606415 2809131853 424
216 iso_pu_bacteria 2808606419 2809151335 424
217 iso_pu_bacteria 2852618963 2852620815 424
218 3300006186 Ga0075369_10005360 Ga0075369_100053603 425
219 3300025910 Ga0207684_10051223 Ga0207684_100512233 425
220 3300031251 Ga0265327_10044005 Ga0265327_100440052 425
221 3300005329 Ga0070683_100017689 Ga0070683_1000176892 426
222 3300005331 Ga0070670_100028987 Ga0070670_1000289876 426
223 3300005334 Ga0068869_100068815 Ga0068869_1000688153 426
224 3300005338 Ga0068868_100024020 Ga0068868_1000240203 426
225 3300005344 Ga0070661_100020266 Ga0070661_1000202661 426
226 3300005354 Ga0070675_100047235 Ga0070675_1000472352 426
227 3300005355 Ga0070671_100064651 Ga0070671_1000646513 426
228 3300005364 Ga0070673_100015414 Ga0070673_1000154145 426
229 3300005367 Ga0070667_100160301 Ga0070667_1001603012 426
230 3300005457 Ga0070662_100075759 Ga0070662_1000757591 426
231 3300005459 Ga0068867_100164266 Ga0068867_1001642661 426
232 3300005543 Ga0070672_100024857 Ga0070672_1000248575 426
233 3300005564 Ga0070664_100012340 Ga0070664_1000123402 426
234 3300005578 Ga0068854_100014861 Ga0068854_1000148613 426
235 3300005615 Ga0070702_100037916 Ga0070702_1000379162 426
236 3300005616 Ga0068852_100002785 Ga0068852_10000278515 426
237 3300005618 Ga0068864_100092240 Ga0068864_1000922403 426
238 3300005841 Ga0068863_100052150 Ga0068863_1000521504 426
239 3300006237 Ga0097621_100047184 Ga0097621_1000471843 426
240 3300006358 Ga0068871_100011520 Ga0068871_1000115203 426
241 3300011119 Ga0105246_10057403 Ga0105246_100574031 426
242 3300013297 Ga0157378_10059018 Ga0157378_100590181 426
243 3300013306 Ga0163162_10005803 Ga0163162_100058039 426
244 3300013308 Ga0157375_10039512 Ga0157375_100395123 426
245 3300014745 Ga0157377_10034527 Ga0157377_100345272 426
246 3300014969 Ga0157376_10066377 Ga0157376_100663773 426
247 3300025295 Ga0209564_1002275 Ga0209564_100227512 426
248 3300025920 Ga0207649_10013731 Ga0207649_100137314 426
249 3300025925 Ga0207650_10007639 Ga0207650_100076396 426
250 3300025925 Ga0207650_10208530 Ga0207650_102085301 426
251 3300025926 Ga0207659_10009785 Ga0207659_100097852 426
252 3300025927 Ga0207687_10088779 Ga0207687_100887792 426
253 3300025931 Ga0207644_10019514 Ga0207644_100195146 426
254 3300025940 Ga0207691_10006268 Ga0207691_100062682 426
255 3300025945 Ga0207679_10000906 Ga0207679_100009062 426
256 3300025960 Ga0207651_10014268 Ga0207651_100142684 426
257 3300026023 Ga0207677_10022469 Ga0207677_100224692 426
258 3300026089 Ga0207648_10007566 Ga0207648_1000756612 426
259 3300026095 Ga0207676_10016917 Ga0207676_100169173 426
260 3300026121 Ga0207683_10033260 Ga0207683_100332604 426
261 3300026142 Ga0207698_10008426 Ga0207698_100084262 426
262 3300048904 Ga0496101_0017179 Ga0496101_0017179_313_1614 426
263 3300048912 Ga0496109_0055775 Ga0496109_0055775_1317_2618 426
264 3300048913 Ga0496110_0164352 Ga0496110_0164352_20_1321 426
265 3300048914 Ga0496111_0138359 Ga0496111_0138359_421_1722 426
266 3300005330 Ga0070690_100014451 Ga0070690_1000144515 427
267 3300005334 Ga0068869_100016487 Ga0068869_1000164874 427
268 3300005344 Ga0070661_100052636 Ga0070661_1000526362 427
269 3300005353 Ga0070669_100064627 Ga0070669_1000646271 427
270 3300005354 Ga0070675_100148081 Ga0070675_1001480811 427
271 3300005354 Ga0070675_100340440 Ga0070675_1003404401 427
272 3300005355 Ga0070671_100184858 Ga0070671_1001848581 427
273 3300005367 Ga0070667_100159908 Ga0070667_1001599081 427
274 3300005438 Ga0070701_10012992 Ga0070701_100129923 427
275 3300005441 Ga0070700_100090817 Ga0070700_1000908172 427
276 3300005459 Ga0068867_100228382 Ga0068867_1002283821 427
277 3300005543 Ga0070672_100123335 Ga0070672_1001233351 427
278 3300005549 Ga0070704_100222609 Ga0070704_1002226091 427
279 3300005564 Ga0070664_100265034 Ga0070664_1002650341 427
280 3300005615 Ga0070702_100013820 Ga0070702_1000138203 427
281 3300005617 Ga0068859_100034835 Ga0068859_1000348355 427
282 3300005840 Ga0068870_10112724 Ga0068870_101127242 427
283 3300005844 Ga0068862_100043133 Ga0068862_1000431334 427
284 3300006358 Ga0068871_100111107 Ga0068871_1001111072 427
285 3300006931 Ga0097620_100034835 Ga0097620_1000348355 427
286 3300009148 Ga0105243_10029716 Ga0105243_100297163 427
287 3300013308 Ga0157375_10324099 Ga0157375_103240991 427
288 3300014326 Ga0157380_10213030 Ga0157380_102130302 427
289 3300014745 Ga0157377_10010373 Ga0157377_100103734 427
290 3300014969 Ga0157376_10093549 Ga0157376_100935493 427
291 3300025893 Ga0207682_10013444 Ga0207682_100134443 427
292 3300025899 Ga0207642_10071679 Ga0207642_100716792 427
293 3300025901 Ga0207688_10016217 Ga0207688_100162171 427
294 3300025903 Ga0207680_10042399 Ga0207680_100423993 427
295 3300025907 Ga0207645_10011275 Ga0207645_100112751 427
296 3300025918 Ga0207662_10013720 Ga0207662_100137204 427
297 3300025925 Ga0207650_10046549 Ga0207650_100465492 427
298 3300025926 Ga0207659_10044984 Ga0207659_100449841 427
299 3300025935 Ga0207709_10154304 Ga0207709_101543041 427
300 3300025938 Ga0207704_10076425 Ga0207704_100764252 427
301 3300025942 Ga0207689_10003339 Ga0207689_100033392 427
302 3300026035 Ga0207703_10038294 Ga0207703_100382942 427
303 3300026089 Ga0207648_10029709 Ga0207648_100297091 427
304 3300026118 Ga0207675_100099797 Ga0207675_1000997973 427
305 3300028381 Ga0268264_10244393 Ga0268264_102443932 427
306 3300028577 Ga0265318_10012590 Ga0265318_100125903 427
307 3300031238 Ga0265332_10002147 Ga0265332_100021476 427
308 3300031250 Ga0265331_10001179 Ga0265331_1000117912 427
309 3300031711 Ga0265314_10000887 Ga0265314_1000088710 427
310 3300046537 Ga0495598_0001997 Ga0495598_0001997_1482_2774 427
311 3300030521 Ga0307511_10017009 Ga0307511_100170095 429
312 3300050516 nmdc:mga0sz30_26204_c1 nmdc:mga0sz30_26204_c1_135_1433 429
313 3300053133 Ga0500655_001489 Ga0500655_001489_2388_3686 429
314 3300003187 JGI25151J46595_10038402 JGI25151J46595_100384021 430
315 3300003775 Ga0055524_1005230 Ga0055524_10052306 430
316 3300006051 Ga0075364_10009289 Ga0075364_100092891 430
317 3300025263 Ga0209565_1010479 Ga0209565_10104792 430
318 3300025294 Ga0209025_1001806 Ga0209025_100180615 430
319 3300025299 Ga0209256_1001334 Ga0209256_100133427 430
320 3300025303 Ga0209051_1026910 Ga0209051_10269101 430
321 3300005347 Ga0070668_100011697 Ga0070668_1000116974 431
322 3300014326 Ga0157380_10011934 Ga0157380_100119342 431
323 3300005548 Ga0070665_100029022 Ga0070665_1000290224 432
324 3300014325 Ga0163163_10073189 Ga0163163_100731892 432
325 3300014969 Ga0157376_10007184 Ga0157376_100071845 432
326 3300025931 Ga0207644_10021558 Ga0207644_100215583 432
327 3300042436 Ga0439435_0003266 Ga0439435_0003266_1041_2366 432
328 3300047318 Ga0495636_0015916 Ga0495636_0015916_803_2125 432
329 3300005331 Ga0070670_100005362 Ga0070670_1000053626 433
330 3300005334 Ga0068869_100000106 Ga0068869_10000010633 433
331 3300005338 Ga0068868_100008784 Ga0068868_1000087845 433
332 3300005347 Ga0070668_100065440 Ga0070668_1000654403 433
333 3300005364 Ga0070673_100031370 Ga0070673_1000313702 433
334 3300005367 Ga0070667_100000861 Ga0070667_10000086110 433
335 3300005459 Ga0068867_100000742 Ga0068867_10000074213 433
336 3300005617 Ga0068859_100000273 Ga0068859_1000002734 433
337 3300005618 Ga0068864_100000963 Ga0068864_1000009639 433
338 3300005719 Ga0068861_100002534 Ga0068861_1000025344 433
339 3300005840 Ga0068870_10005790 Ga0068870_100057904 433
340 3300005841 Ga0068863_100010467 Ga0068863_1000104674 433
341 3300005842 Ga0068858_100013306 Ga0068858_1000133069 433
342 3300005842 Ga0068858_100027046 Ga0068858_1000270464 433
343 3300005843 Ga0068860_100017893 Ga0068860_1000178935 433
344 3300005844 Ga0068862_100003118 Ga0068862_1000031189 433
345 3300006931 Ga0097620_100000273 Ga0097620_10000027348 433
346 3300006948 Ga0099826_10000007 Ga0099826_10000007321 433
347 3300009148 Ga0105243_10211775 Ga0105243_102117752 433
348 3300009177 Ga0105248_10005623 Ga0105248_100056236 433
349 3300013297 Ga0157378_10009669 Ga0157378_100096692 433
350 3300013306 Ga0163162_10063815 Ga0163162_100638153 433
351 3300014968 Ga0157379_10000629 Ga0157379_1000062913 433
352 3300025907 Ga0207645_10018600 Ga0207645_100186003 433
353 3300025908 Ga0207643_10004615 Ga0207643_100046153 433
354 3300025918 Ga0207662_10061849 Ga0207662_100618492 433
355 3300025925 Ga0207650_10004337 Ga0207650_100043378 433
356 3300025927 Ga0207687_10039974 Ga0207687_100399743 433
357 3300025942 Ga0207689_10000118 Ga0207689_100001183 433
358 3300025960 Ga0207651_10019279 Ga0207651_100192793 433
359 3300025961 Ga0207712_10153066 Ga0207712_101530661 433
360 3300025972 Ga0207668_10043293 Ga0207668_100432933 433
361 3300026035 Ga0207703_10001578 Ga0207703_1000157813 433
362 3300026035 Ga0207703_10188046 Ga0207703_101880461 433
363 3300026089 Ga0207648_10001056 Ga0207648_1000105613 433
364 3300026095 Ga0207676_10077609 Ga0207676_100776092 433
365 3300026118 Ga0207675_100000979 Ga0207675_10000097911 433
366 3300027666 Ga0209282_1000021 Ga0209282_100002154 433
367 3300028381 Ga0268264_10001039 Ga0268264_1000103912 433
368 3300048905 Ga0496102_0028837 Ga0496102_0028837_583_1887 433
369 3300005331 Ga0070670_100037626 Ga0070670_1000376263 434
370 3300009176 Ga0105242_10027042 Ga0105242_100270425 434
371 3300003187 JGI25151J46595_10001315 JGI25151J46595_100013155 436
372 3300003771 Ga0055526_1006460 Ga0055526_10064606 436
373 3300003773 Ga0055537_1002374 Ga0055537_10023745 436
374 3300003775 Ga0055524_1002073 Ga0055524_10020735 436
375 3300003781 Ga0055536_1000134 Ga0055536_100013443 436
376 3300003784 Ga0055534_1001576 Ga0055534_10015766 436
377 3300003784 Ga0055534_1002439 Ga0055534_10024395 436
378 3300025263 Ga0209565_1000104 Ga0209565_100010427 436
379 3300025291 Ga0209675_1000191 Ga0209675_10001919 436
380 3300025291 Ga0209675_1002151 Ga0209675_10021512 436
381 3300025292 Ga0209676_1000036 Ga0209676_1000036397 436
382 3300025294 Ga0209025_1000905 Ga0209025_100090541 436
383 3300025294 Ga0209025_1002048 Ga0209025_10020489 436
384 3300025295 Ga0209564_1000688 Ga0209564_10006882 436
385 3300025295 Ga0209564_1004020 Ga0209564_10040205 436
386 3300025299 Ga0209256_1001092 Ga0209256_10010929 436

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

131

381

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.947 58 430
2i49-assembly1.cif.gz_A crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 0.9185 59 431
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.916 58 430
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8813 61 391
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8699 61 391
ID Description Score Start End Superfamily
2g29A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9003 58 403 3.40.190.10
2g29A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8971 145 251 3.40.190.10
2g29A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8664 58 403 3.40.190.10
2i4cA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8656 146 251 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.846 144 250 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7X9K6E8-F1-model_v4 deleted 0.9911 123 432
AF-A0A7X9K6E8-F1-model_v4 deleted 0.9879 123 432
AF-H0PXH3-F1-model_v4 Assimilatory nitrate transport system, periplasmic-binding protein 0.9872 49 432 GO:0005886
GO:0012505
AF-A0A2X5CFR1-F1-model_v4 deleted 0.9855 65 366
AF-A0A0Q7XEK8-F1-model_v4 Nitrate transporter 0.9852 59 431 GO:0005886
GO:0012505

Feature Viewer

pLDDT pTM Quality
84.03 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map