F430665
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 386 | 240 | 379 | 421 |
Family's Representative Sequence
| Representative Sequence | 3300050492|nmdc:mga0yw44_77914_c1|nmdc:mga0yw44_77914_c1_527_2047 |
| Length | 506 |
| Sequence | VRTRACEAAKRKARHHAVTCQRQLFPARQPDAIWHKGCYYEYKRILNDEVRVNKGVHPHESRARCCAFFVSIQPWNISAMKPSKPVAPATTVVANEGRRSLLKHAGVLGGAGLMSMLTPGLRGAVHAAGSDAPEKKEVKVGFIPLTDCASVVMASVMEFDKKYGIKIVPTKEASWASVRDKLVNGELDAAHVLYGLIYGVHNGVGGPKKDMAVLMNLNHNGQAITLSKKLNEKGVKDGASLKALMDKEKREYIFAQTFPTGTHAMWIYYWLAAQGIDPLKDAKAITVPPPQMVANMRVGNMDGYCVGEPWGNRAIADGIGFTVETTQAIWKDHPEKVLGTSADWVAKNPNTARAMTAAILDAGRWIDASLSNRQKTAQTVADRSYVNTDADIIVARMLGRYDNGIGKKWDDPDYMKFYNDGAVNFPYLSDGMWFMTQHRRWGLMKTDLDYLAVAKQVNRIDIYKDAATAAKTSVAKSDMRTHKLIDGTVWDGKDPKKYASGFKIHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 2 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 3 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 4 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 5 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 6 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 61 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 62 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 149 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 154 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 155 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 156 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 157 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 158 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 162 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 170 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 171 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 172 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 173 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 174 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 175 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 176 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 177 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 178 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 179 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 180 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 181 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 182 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 183 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 184 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 185 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 186 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 187 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 188 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 189 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 190 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 191 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 216 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 217 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 218 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 219 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 220 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 221 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 222 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 223 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 224 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 225 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 226 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 227 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 228 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 229 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 236 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 237 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 238 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 239 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 240 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.19 |
| Metatranscriptomes | 0 |
| Isolates | 1.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.06 |
| Nodule | 0.52 |
| Rhizoplane | 2.33 |
| Rhizosphere | 79.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10001315 | 3300003187 | Bacteria | 17394 |
| 2 | JGI25151J46595_10038402 | 3300003187 | Bacteria | 1782 |
| 3 | JGI25161J50226_1000835 | 3300003374 | Bacteria | 11514 |
| 4 | Ga0055526_1006460 | 3300003771 | Bacteria | 6356 |
| 5 | Ga0055537_1002374 | 3300003773 | Bacteria | 6371 |
| 6 | Ga0055524_1002073 | 3300003775 | Bacteria | 10626 |
| 7 | Ga0055524_1002533 | 3300003775 | Bacteria | 9356 |
| 8 | Ga0055524_1005230 | 3300003775 | Bacteria | 5834 |
| 9 | Ga0055536_1000134 | 3300003781 | Bacteria | 63257 |
| 10 | Ga0055534_1001576 | 3300003784 | Bacteria | 8862 |
| 11 | Ga0055534_1002439 | 3300003784 | Bacteria | 6434 |
| 12 | Ga0055530_10001933 | 3300003791 | Bacteria | 14134 |
| 13 | Ga0055543_1001437 | 3300004625 | Bacteria | 9469 |
| 14 | Ga0065165_1004653 | 3300005262 | Bacteria | 8311 |
| 15 | Ga0065165_1013869 | 3300005262 | Bacteria | 3169 |
| 16 | Ga0070658_10179121 | 3300005327 | Bacteria | 1783 |
| 17 | Ga0070676_10047775 | 3300005328 | Bacteria | 2500 |
| 18 | Ga0070683_100017689 | 3300005329 | Bacteria | 6299 |
| 19 | Ga0070690_100014451 | 3300005330 | Bacteria | 4683 |
| 20 | Ga0070670_100005362 | 3300005331 | Bacteria | 10823 |
| 21 | Ga0070670_100028987 | 3300005331 | Bacteria | 4764 |
| 22 | Ga0070670_100037626 | 3300005331 | Bacteria | 4162 |
| 23 | Ga0068869_100000106 | 3300005334 | Bacteria | 39499 |
| 24 | Ga0068869_100016487 | 3300005334 | Bacteria | 4980 |
| 25 | Ga0068869_100068815 | 3300005334 | Bacteria | 2616 |
| 26 | Ga0070680_100070604 | 3300005336 | Bacteria | 2868 |
| 27 | Ga0070680_100126122 | 3300005336 | Bacteria | 2139 |
| 28 | Ga0068868_100008784 | 3300005338 | Bacteria | 7240 |
| 29 | Ga0068868_100024020 | 3300005338 | Bacteria | 4620 |
| 30 | Ga0070660_100005509 | 3300005339 | Bacteria | 8766 |
| 31 | Ga0070660_100027633 | 3300005339 | Bacteria | 4236 |
| 32 | Ga0070660_100132541 | 3300005339 | Bacteria | 1995 |
| 33 | Ga0070689_100025034 | 3300005340 | Bacteria | 4482 |
| 34 | Ga0070661_100020266 | 3300005344 | Bacteria | 4740 |
| 35 | Ga0070661_100052636 | 3300005344 | Bacteria | 2980 |
| 36 | Ga0070661_100105734 | 3300005344 | Bacteria | 2098 |
| 37 | Ga0070692_10063593 | 3300005345 | Bacteria | 1949 |
| 38 | Ga0070668_100011697 | 3300005347 | Bacteria | 6534 |
| 39 | Ga0070668_100014416 | 3300005347 | Bacteria | 5908 |
| 40 | Ga0070668_100065440 | 3300005347 | Bacteria | 2820 |
| 41 | Ga0070669_100000995 | 3300005353 | Bacteria | 20639 |
| 42 | Ga0070669_100064627 | 3300005353 | Bacteria | 2695 |
| 43 | Ga0070675_100047235 | 3300005354 | Bacteria | 3527 |
| 44 | Ga0070675_100060882 | 3300005354 | Bacteria | 3116 |
| 45 | Ga0070675_100148081 | 3300005354 | Bacteria | 2011 |
| 46 | Ga0070675_100340440 | 3300005354 | Bacteria | 1328 |
| 47 | Ga0070671_100064651 | 3300005355 | Bacteria | 3046 |
| 48 | Ga0070671_100184858 | 3300005355 | Bacteria | 1765 |
| 49 | Ga0070673_100015414 | 3300005364 | Bacteria | 5368 |
| 50 | Ga0070673_100031370 | 3300005364 | Bacteria | 3987 |
| 51 | Ga0070667_100000861 | 3300005367 | Bacteria | 28255 |
| 52 | Ga0070667_100159908 | 3300005367 | Bacteria | 1983 |
| 53 | Ga0070667_100160301 | 3300005367 | Bacteria | 1981 |
| 54 | Ga0070701_10012992 | 3300005438 | Bacteria | 3776 |
| 55 | Ga0070700_100009006 | 3300005441 | Bacteria | 5466 |
| 56 | Ga0070700_100090817 | 3300005441 | Bacteria | 1992 |
| 57 | Ga0070662_100075759 | 3300005457 | Bacteria | 2492 |
| 58 | Ga0068867_100000742 | 3300005459 | Bacteria | 21874 |
| 59 | Ga0068867_100010377 | 3300005459 | Bacteria | 6572 |
| 60 | Ga0068867_100164266 | 3300005459 | Bacteria | 1753 |
| 61 | Ga0068867_100228382 | 3300005459 | Bacteria | 1503 |
| 62 | Ga0070698_100009492 | 3300005471 | Bacteria | 10421 |
| 63 | Ga0068853_100166382 | 3300005539 | Bacteria | 1993 |
| 64 | Ga0070672_100024857 | 3300005543 | Bacteria | 4434 |
| 65 | Ga0070672_100051058 | 3300005543 | Bacteria | 3223 |
| 66 | Ga0070672_100123335 | 3300005543 | Bacteria | 2123 |
| 67 | Ga0070665_100029022 | 3300005548 | Bacteria | 5569 |
| 68 | Ga0070665_100145120 | 3300005548 | Bacteria | 2377 |
| 69 | Ga0070704_100222609 | 3300005549 | Bacteria | 1535 |
| 70 | Ga0068855_100085413 | 3300005563 | Bacteria | 3651 |
| 71 | Ga0068855_100378172 | 3300005563 | Bacteria | 1555 |
| 72 | Ga0070664_100012340 | 3300005564 | Bacteria | 6943 |
| 73 | Ga0070664_100265034 | 3300005564 | Bacteria | 1546 |
| 74 | Ga0068854_100014861 | 3300005578 | Bacteria | 5141 |
| 75 | Ga0070702_100013820 | 3300005615 | Bacteria | 4085 |
| 76 | Ga0070702_100037916 | 3300005615 | Bacteria | 2680 |
| 77 | Ga0068852_100002785 | 3300005616 | Bacteria | 12109 |
| 78 | Ga0068859_100000273 | 3300005617 | Bacteria | 51339 |
| 79 | Ga0068859_100034835 | 3300005617 | Bacteria | 5051 |
| 80 | Ga0068859_100140283 | 3300005617 | Bacteria | 2490 |
| 81 | Ga0068864_100000963 | 3300005618 | Bacteria | 24153 |
| 82 | Ga0068864_100092240 | 3300005618 | Bacteria | 2673 |
| 83 | Ga0068866_10044936 | 3300005718 | Bacteria | 2213 |
| 84 | Ga0068861_100002534 | 3300005719 | Bacteria | 11939 |
| 85 | Ga0068861_100004902 | 3300005719 | Bacteria | 9011 |
| 86 | Ga0068870_10005790 | 3300005840 | Bacteria | 5421 |
| 87 | Ga0068870_10112724 | 3300005840 | Bacteria | 1555 |
| 88 | Ga0068863_100010467 | 3300005841 | Bacteria | 9016 |
| 89 | Ga0068863_100052150 | 3300005841 | Bacteria | 3877 |
| 90 | Ga0068858_100013306 | 3300005842 | Bacteria | 7759 |
| 91 | Ga0068858_100027046 | 3300005842 | Bacteria | 5328 |
| 92 | Ga0068860_100017893 | 3300005843 | Bacteria | 6901 |
| 93 | Ga0068862_100003118 | 3300005844 | Bacteria | 14450 |
| 94 | Ga0068862_100008725 | 3300005844 | Bacteria | 8391 |
| 95 | Ga0068862_100043133 | 3300005844 | Bacteria | 3845 |
| 96 | Ga0075363_100020767 | 3300006048 | Bacteria | 3298 |
| 97 | Ga0075364_10009289 | 3300006051 | Bacteria | 5893 |
| 98 | Ga0075364_10022937 | 3300006051 | Bacteria | 3947 |
| 99 | Ga0075362_10043758 | 3300006177 | Bacteria | 1983 |
| 100 | Ga0075367_10005208 | 3300006178 | Bacteria | 6429 |
| 101 | Ga0075369_10002991 | 3300006186 | Bacteria | 6108 |
| 102 | Ga0075369_10005360 | 3300006186 | Bacteria | 4785 |
| 103 | Ga0075369_10006359 | 3300006186 | Bacteria | 4463 |
| 104 | Ga0075366_10011139 | 3300006195 | Bacteria | 5069 |
| 105 | Ga0075366_10013373 | 3300006195 | Bacteria | 4670 |
| 106 | Ga0075366_10023572 | 3300006195 | Bacteria | 3586 |
| 107 | Ga0075366_10031818 | 3300006195 | Bacteria | 3105 |
| 108 | Ga0097621_100047184 | 3300006237 | Bacteria | 3489 |
| 109 | Ga0075370_10016055 | 3300006353 | Bacteria | 4023 |
| 110 | Ga0068871_100011520 | 3300006358 | Bacteria | 6486 |
| 111 | Ga0068871_100111107 | 3300006358 | Bacteria | 2305 |
| 112 | Ga0075428_100268160 | 3300006844 | Bacteria | 1837 |
| 113 | Ga0075430_100012580 | 3300006846 | Bacteria | 7205 |
| 114 | Ga0075430_100050787 | 3300006846 | Bacteria | 3495 |
| 115 | Ga0075431_100019741 | 3300006847 | Bacteria | 6878 |
| 116 | Ga0075431_100093331 | 3300006847 | Bacteria | 3106 |
| 117 | Ga0075431_100100742 | 3300006847 | Bacteria | 2981 |
| 118 | Ga0075431_100323921 | 3300006847 | Bacteria | 1553 |
| 119 | Ga0075429_100000015 | 3300006880 | Bacteria | 78823 |
| 120 | Ga0075429_100001431 | 3300006880 | Bacteria | 19585 |
| 121 | Ga0075429_100137692 | 3300006880 | Bacteria | 2137 |
| 122 | Ga0075429_100160873 | 3300006880 | Bacteria | 1966 |
| 123 | Ga0097620_100000273 | 3300006931 | Bacteria | 51339 |
| 124 | Ga0097620_100034835 | 3300006931 | Bacteria | 5051 |
| 125 | Ga0097620_100140282 | 3300006931 | Bacteria | 2490 |
| 126 | Ga0099826_10000007 | 3300006948 | Bacteria | 393518 |
| 127 | Ga0099794_10012839 | 3300007265 | Bacteria | 3629 |
| 128 | Ga0111539_10158327 | 3300009094 | Bacteria | 2649 |
| 129 | Ga0114129_10002286 | 3300009147 | Bacteria | 26528 |
| 130 | Ga0114129_10050630 | 3300009147 | Bacteria | 5834 |
| 131 | Ga0114129_10056195 | 3300009147 | Bacteria | 5514 |
| 132 | Ga0114129_10300099 | 3300009147 | Bacteria | 2141 |
| 133 | Ga0105243_10017446 | 3300009148 | Bacteria | 5427 |
| 134 | Ga0105243_10029716 | 3300009148 | Bacteria | 4205 |
| 135 | Ga0105243_10211775 | 3300009148 | Bacteria | 1707 |
| 136 | Ga0105241_10017747 | 3300009174 | Bacteria | 5234 |
| 137 | Ga0105242_10027042 | 3300009176 | Bacteria | 4550 |
| 138 | Ga0105242_10086265 | 3300009176 | Bacteria | 2634 |
| 139 | Ga0105248_10005623 | 3300009177 | Bacteria | 13763 |
| 140 | Ga0105237_10068023 | 3300009545 | Bacteria | 3556 |
| 141 | Ga0105238_10324503 | 3300009551 | Bacteria | 1526 |
| 142 | Ga0105249_10001620 | 3300009553 | Bacteria | 19709 |
| 143 | Ga0105246_10057403 | 3300011119 | Bacteria | 2693 |
| 144 | Ga0157373_10130153 | 3300013100 | Bacteria | 1770 |
| 145 | Ga0157378_10009669 | 3300013297 | Bacteria | 8398 |
| 146 | Ga0157378_10059018 | 3300013297 | Bacteria | 3423 |
| 147 | Ga0163162_10005803 | 3300013306 | Bacteria | 11947 |
| 148 | Ga0163162_10063815 | 3300013306 | Bacteria | 3728 |
| 149 | Ga0157375_10039512 | 3300013308 | Bacteria | 4542 |
| 150 | Ga0157375_10324099 | 3300013308 | Bacteria | 1705 |
| 151 | Ga0163163_10073189 | 3300014325 | Bacteria | 3417 |
| 152 | Ga0157380_10011934 | 3300014326 | Bacteria | 6286 |
| 153 | Ga0157380_10028648 | 3300014326 | Bacteria | 4248 |
| 154 | Ga0157380_10213030 | 3300014326 | Bacteria | 1723 |
| 155 | Ga0157380_10261486 | 3300014326 | Bacteria | 1572 |
| 156 | Ga0157377_10010373 | 3300014745 | Bacteria | 4607 |
| 157 | Ga0157377_10012505 | 3300014745 | Bacteria | 4270 |
| 158 | Ga0157377_10034527 | 3300014745 | Bacteria | 2767 |
| 159 | Ga0157377_10047751 | 3300014745 | Bacteria | 2399 |
| 160 | Ga0157379_10000629 | 3300014968 | Bacteria | 28451 |
| 161 | Ga0157376_10007184 | 3300014969 | Bacteria | 7918 |
| 162 | Ga0157376_10066377 | 3300014969 | Bacteria | 3050 |
| 163 | Ga0157376_10093549 | 3300014969 | Bacteria | 2610 |
| 164 | Ga0209436_100521 | 3300025208 | Bacteria | 16709 |
| 165 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 166 | Ga0209565_1000104 | 3300025263 | Bacteria | 124432 |
| 167 | Ga0209565_1001401 | 3300025263 | Bacteria | 10731 |
| 168 | Ga0209565_1010479 | 3300025263 | Bacteria | 2297 |
| 169 | Ga0209130_1001287 | 3300025284 | Bacteria | 17337 |
| 170 | Ga0209675_1000191 | 3300025291 | Bacteria | 67500 |
| 171 | Ga0209675_1002151 | 3300025291 | Bacteria | 10391 |
| 172 | Ga0209676_1000036 | 3300025292 | Bacteria | 457623 |
| 173 | Ga0209025_1000905 | 3300025294 | Bacteria | 45998 |
| 174 | Ga0209025_1001806 | 3300025294 | Bacteria | 25356 |
| 175 | Ga0209025_1002048 | 3300025294 | Bacteria | 22965 |
| 176 | Ga0209564_1000639 | 3300025295 | Bacteria | 53129 |
| 177 | Ga0209564_1000688 | 3300025295 | Bacteria | 49680 |
| 178 | Ga0209564_1002275 | 3300025295 | Bacteria | 15701 |
| 179 | Ga0209564_1004020 | 3300025295 | Bacteria | 9304 |
| 180 | Ga0209050_1000469 | 3300025298 | Bacteria | 71511 |
| 181 | Ga0209256_1001092 | 3300025299 | Bacteria | 31208 |
| 182 | Ga0209256_1001334 | 3300025299 | Bacteria | 26338 |
| 183 | Ga0209256_1001909 | 3300025299 | Bacteria | 19072 |
| 184 | Ga0207426_1010077 | 3300025302 | Bacteria | 3694 |
| 185 | Ga0209051_1026910 | 3300025303 | Bacteria | 2304 |
| 186 | Ga0207655_1045729 | 3300025728 | Bacteria | 1824 |
| 187 | Ga0207682_10013444 | 3300025893 | Bacteria | 3189 |
| 188 | Ga0207642_10071679 | 3300025899 | Bacteria | 1651 |
| 189 | Ga0207688_10016217 | 3300025901 | Bacteria | 4040 |
| 190 | Ga0207680_10042399 | 3300025903 | Bacteria | 2662 |
| 191 | Ga0207645_10011275 | 3300025907 | Bacteria | 6109 |
| 192 | Ga0207645_10018600 | 3300025907 | Bacteria | 4565 |
| 193 | Ga0207643_10004615 | 3300025908 | Bacteria | 7398 |
| 194 | Ga0207705_10101798 | 3300025909 | Bacteria | 2113 |
| 195 | Ga0207684_10051223 | 3300025910 | Bacteria | 3503 |
| 196 | Ga0207654_10016090 | 3300025911 | Bacteria | 3890 |
| 197 | Ga0207671_10030997 | 3300025914 | Bacteria | 3987 |
| 198 | Ga0207660_10027301 | 3300025917 | Bacteria | 3894 |
| 199 | Ga0207660_10056327 | 3300025917 | Bacteria | 2812 |
| 200 | Ga0207662_10013720 | 3300025918 | Bacteria | 4535 |
| 201 | Ga0207662_10061849 | 3300025918 | Bacteria | 2249 |
| 202 | Ga0207657_10002609 | 3300025919 | Bacteria | 19479 |
| 203 | Ga0207649_10009052 | 3300025920 | Bacteria | 5440 |
| 204 | Ga0207649_10013731 | 3300025920 | Bacteria | 4527 |
| 205 | Ga0207681_10080811 | 3300025923 | Bacteria | 2294 |
| 206 | Ga0207650_10004337 | 3300025925 | Bacteria | 9688 |
| 207 | Ga0207650_10007639 | 3300025925 | Bacteria | 7365 |
| 208 | Ga0207650_10046549 | 3300025925 | Bacteria | 3194 |
| 209 | Ga0207650_10208530 | 3300025925 | Bacteria | 1568 |
| 210 | Ga0207659_10009785 | 3300025926 | Bacteria | 5997 |
| 211 | Ga0207659_10044984 | 3300025926 | Bacteria | 3109 |
| 212 | Ga0207659_10103492 | 3300025926 | Bacteria | 2151 |
| 213 | Ga0207687_10039974 | 3300025927 | Bacteria | 3213 |
| 214 | Ga0207687_10088779 | 3300025927 | Bacteria | 2250 |
| 215 | Ga0207644_10019514 | 3300025931 | Bacteria | 4599 |
| 216 | Ga0207644_10021558 | 3300025931 | Bacteria | 4391 |
| 217 | Ga0207690_10002750 | 3300025932 | Bacteria | 10627 |
| 218 | Ga0207690_10003354 | 3300025932 | Bacteria | 9572 |
| 219 | Ga0207706_10082841 | 3300025933 | Bacteria | 2820 |
| 220 | Ga0207709_10019286 | 3300025935 | Bacteria | 3832 |
| 221 | Ga0207709_10154304 | 3300025935 | Bacteria | 1594 |
| 222 | Ga0207670_10010367 | 3300025936 | Bacteria | 5364 |
| 223 | Ga0207704_10012882 | 3300025938 | Bacteria | 4165 |
| 224 | Ga0207704_10076425 | 3300025938 | Bacteria | 2146 |
| 225 | Ga0207691_10002613 | 3300025940 | Bacteria | 17590 |
| 226 | Ga0207691_10006268 | 3300025940 | Bacteria | 11483 |
| 227 | Ga0207689_10000118 | 3300025942 | Bacteria | 65374 |
| 228 | Ga0207689_10003339 | 3300025942 | Bacteria | 14703 |
| 229 | Ga0207689_10141217 | 3300025942 | Bacteria | 1984 |
| 230 | Ga0207679_10000906 | 3300025945 | Bacteria | 18937 |
| 231 | Ga0207667_10006079 | 3300025949 | Bacteria | 14670 |
| 232 | Ga0207651_10014268 | 3300025960 | Bacteria | 4580 |
| 233 | Ga0207651_10019279 | 3300025960 | Bacteria | 4083 |
| 234 | Ga0207712_10070883 | 3300025961 | Bacteria | 2505 |
| 235 | Ga0207712_10153066 | 3300025961 | Bacteria | 1783 |
| 236 | Ga0207668_10022551 | 3300025972 | Bacteria | 4033 |
| 237 | Ga0207668_10043293 | 3300025972 | Bacteria | 3054 |
| 238 | Ga0207658_10153632 | 3300025986 | Bacteria | 1878 |
| 239 | Ga0207677_10022469 | 3300026023 | Bacteria | 3877 |
| 240 | Ga0207703_10001578 | 3300026035 | Bacteria | 20652 |
| 241 | Ga0207703_10038294 | 3300026035 | Bacteria | 3825 |
| 242 | Ga0207703_10188046 | 3300026035 | Bacteria | 1827 |
| 243 | Ga0207639_10029242 | 3300026041 | Bacteria | 4032 |
| 244 | Ga0207708_10007316 | 3300026075 | Bacteria | 8159 |
| 245 | Ga0207648_10000238 | 3300026089 | Bacteria | 59053 |
| 246 | Ga0207648_10001056 | 3300026089 | Bacteria | 30829 |
| 247 | Ga0207648_10007566 | 3300026089 | Bacteria | 10660 |
| 248 | Ga0207648_10029709 | 3300026089 | Bacteria | 4847 |
| 249 | Ga0207676_10016917 | 3300026095 | Bacteria | 5280 |
| 250 | Ga0207676_10077609 | 3300026095 | Bacteria | 2687 |
| 251 | Ga0207674_10026030 | 3300026116 | Bacteria | 6225 |
| 252 | Ga0207675_100000979 | 3300026118 | Bacteria | 28349 |
| 253 | Ga0207675_100012412 | 3300026118 | Bacteria | 7958 |
| 254 | Ga0207675_100099797 | 3300026118 | Bacteria | 2735 |
| 255 | Ga0207683_10033260 | 3300026121 | Bacteria | 4478 |
| 256 | Ga0207698_10008426 | 3300026142 | Bacteria | 6521 |
| 257 | Ga0207698_10075271 | 3300026142 | Bacteria | 2697 |
| 258 | Ga0209282_1000021 | 3300027666 | Bacteria | 177705 |
| 259 | Ga0209588_1010205 | 3300027671 | Bacteria | 2819 |
| 260 | Ga0268266_10255791 | 3300028379 | Bacteria | 1621 |
| 261 | Ga0268265_10000459 | 3300028380 | Bacteria | 43185 |
| 262 | Ga0268264_10001039 | 3300028381 | Bacteria | 27889 |
| 263 | Ga0268264_10244393 | 3300028381 | Bacteria | 1664 |
| 264 | Ga0265318_10012590 | 3300028577 | Bacteria | 3594 |
| 265 | Ga0307515_10000020 | 3300028794 | Bacteria | 411735 |
| 266 | Ga0307511_10017009 | 3300030521 | Bacteria | 6990 |
| 267 | Ga0316177_1151259 | 3300030731 | Bacteria | 3985 |
| 268 | Ga0316180_1100674 | 3300030736 | Bacteria | 4776 |
| 269 | Ga0265332_10002147 | 3300031238 | Bacteria | 10174 |
| 270 | Ga0265331_10001179 | 3300031250 | Bacteria | 19910 |
| 271 | Ga0265327_10000235 | 3300031251 | Bacteria | 111362 |
| 272 | Ga0265327_10011126 | 3300031251 | Bacteria | 6241 |
| 273 | Ga0265327_10044005 | 3300031251 | Bacteria | 2384 |
| 274 | Ga0307508_10032307 | 3300031616 | Bacteria | 4728 |
| 275 | Ga0265314_10000887 | 3300031711 | Bacteria | 35662 |
| 276 | Ga0307416_100009076 | 3300032002 | Bacteria | 6475 |
| 277 | Ga0373923_0035349 | 3300035111 | Bacteria | 2034 |
| 278 | Ga0373960_0014627 | 3300035121 | Bacteria | 1991 |
| 279 | Ga0373924_0027520 | 3300035410 | Bacteria | 2261 |
| 280 | Ga0373933_0009629 | 3300035724 | Bacteria | 5278 |
| 281 | Ga0373937_0049635 | 3300036401 | Bacteria | 3842 |
| 282 | Ga0395899_0013433 | 3300037312 | Bacteria | 6264 |
| 283 | Ga0395899_0017193 | 3300037312 | Bacteria | 5509 |
| 284 | Ga0395899_0045648 | 3300037312 | Bacteria | 3264 |
| 285 | Ga0395900_0001738 | 3300037418 | Bacteria | 25108 |
| 286 | Ga0395900_0004356 | 3300037418 | Bacteria | 15021 |
| 287 | Ga0395898_0016407 | 3300037466 | Bacteria | 7580 |
| 288 | Ga0395898_0049958 | 3300037466 | Bacteria | 4095 |
| 289 | Ga0395898_0232929 | 3300037466 | Bacteria | 1756 |
| 290 | Ga0395905_0054285 | 3300037471 | Bacteria | 3750 |
| 291 | Ga0395905_0149866 | 3300037471 | Bacteria | 2194 |
| 292 | Ga0395901_0001782 | 3300038443 | Bacteria | 22209 |
| 293 | Ga0439441_000604 | 3300042001 | Bacteria | 4037 |
| 294 | Ga0439448_0001936 | 3300042005 | Bacteria | 5517 |
| 295 | Ga0439450_002808 | 3300042008 | Bacteria | 2795 |
| 296 | Ga0439455_0003148 | 3300042012 | Bacteria | 3111 |
| 297 | Ga0439435_0003266 | 3300042436 | Bacteria | 3350 |
| 298 | Ga0439460_0021753 | 3300042461 | Bacteria | 1756 |
| 299 | Ga0466972_0020642 | 3300044658 | Bacteria | 3291 |
| 300 | Ga0466965_0010530 | 3300044683 | Bacteria | 4319 |
| 301 | Ga0466965_0024429 | 3300044683 | Bacteria | 2923 |
| 302 | Ga0466966_0013081 | 3300044684 | Bacteria | 5494 |
| 303 | Ga0466966_0056758 | 3300044684 | Bacteria | 2476 |
| 304 | Ga0466961_0000232 | 3300044693 | Bacteria | 37669 |
| 305 | Ga0466964_0055629 | 3300044706 | Bacteria | 1634 |
| 306 | Ga0453684_0023507 | 3300044712 | Bacteria | 9070 |
| 307 | Ga0466971_0104350 | 3300044719 | Bacteria | 1304 |
| 308 | Ga0466957_0027728 | 3300044842 | Bacteria | 3367 |
| 309 | Ga0466959_0012677 | 3300045049 | Bacteria | 6097 |
| 310 | Ga0466959_0036373 | 3300045049 | Bacteria | 3638 |
| 311 | Ga0466959_0061224 | 3300045049 | Bacteria | 2737 |
| 312 | Ga0451576_0236095 | 3300045051 | Bacteria | 1910 |
| 313 | Ga0466967_0008988 | 3300045976 | Bacteria | 7381 |
| 314 | Ga0495605_0000085 | 3300046474 | Bacteria | 121011 |
| 315 | Ga0495607_0034853 | 3300046501 | Bacteria | 3050 |
| 316 | Ga0495583_0000205 | 3300046506 | Bacteria | 99711 |
| 317 | Ga0495616_0000145 | 3300046513 | Bacteria | 62415 |
| 318 | Ga0495643_0004391 | 3300046522 | Bacteria | 9879 |
| 319 | Ga0495643_0015686 | 3300046522 | Bacteria | 4469 |
| 320 | Ga0495648_0011756 | 3300046524 | Bacteria | 6569 |
| 321 | Ga0495642_0000973 | 3300046528 | Bacteria | 13340 |
| 322 | Ga0495598_0001997 | 3300046537 | Bacteria | 4145 |
| 323 | Ga0495609_0000002 | 3300046538 | Bacteria | 739816 |
| 324 | Ga0495661_0000271 | 3300046665 | Bacteria | 59543 |
| 325 | Ga0495661_0000669 | 3300046665 | Bacteria | 34300 |
| 326 | Ga0495661_0002269 | 3300046665 | Bacteria | 14874 |
| 327 | Ga0495588_0000135 | 3300046674 | Bacteria | 117387 |
| 328 | Ga0495669_0069456 | 3300046684 | Bacteria | 1604 |
| 329 | Ga0495589_0000030 | 3300046794 | Bacteria | 170254 |
| 330 | Ga0495589_0001070 | 3300046794 | Bacteria | 16432 |
| 331 | Ga0495660_0000423 | 3300046810 | Bacteria | 35820 |
| 332 | Ga0495636_0015916 | 3300047318 | Bacteria | 3000 |
| 333 | Ga0495672_0000833 | 3300047320 | Bacteria | 32978 |
| 334 | Ga0495687_000047 | 3300047443 | Bacteria | 206452 |
| 335 | Ga0495687_000112 | 3300047443 | Bacteria | 124725 |
| 336 | Ga0495687_001101 | 3300047443 | Bacteria | 26384 |
| 337 | Ga0495687_002457 | 3300047443 | Bacteria | 14827 |
| 338 | Ga0495677_0000044 | 3300047445 | Bacteria | 74340 |
| 339 | Ga0495677_0007472 | 3300047445 | Bacteria | 4082 |
| 340 | Ga0495615_0002476 | 3300048090 | Bacteria | 2966 |
| 341 | Ga0495626_0000006 | 3300048091 | Bacteria | 284977 |
| 342 | Ga0495626_0000266 | 3300048091 | Bacteria | 59029 |
| 343 | Ga0496101_0017179 | 3300048904 | Bacteria | 4904 |
| 344 | Ga0496102_0028837 | 3300048905 | Bacteria | 4962 |
| 345 | Ga0496102_0034795 | 3300048905 | Bacteria | 4533 |
| 346 | Ga0496102_0079152 | 3300048905 | Bacteria | 3026 |
| 347 | Ga0496108_0226075 | 3300048911 | Bacteria | 1627 |
| 348 | Ga0496109_0055775 | 3300048912 | Bacteria | 3605 |
| 349 | Ga0496110_0164352 | 3300048913 | Bacteria | 2012 |
| 350 | Ga0496111_0138359 | 3300048914 | Bacteria | 1804 |
| 351 | Ga0496113_0052467 | 3300048916 | Bacteria | 3046 |
| 352 | Ga0496122_0019569 | 3300048925 | Bacteria | 6174 |
| 353 | Ga0496123_0005792 | 3300048926 | Bacteria | 12268 |
| 354 | Ga0501198_000006 | 3300049649 | Bacteria | 129954 |
| 355 | Ga0501209_002850 | 3300049656 | Bacteria | 2750 |
| 356 | Ga0501222_000007 | 3300049662 | Bacteria | 126703 |
| 357 | nmdc:mga03683_5252_c1 | 3300050489 | Bacteria | 4363 |
| 358 | nmdc:mga03n38_2426_c1 | 3300050490 | Bacteria | 5756 |
| 359 | nmdc:mga00v17_36998_c1 | 3300050491 | Bacteria | 2912 |
| 360 | nmdc:mga0yw44_77914_c1 | 3300050492 | Bacteria | 2072 |
| 361 | nmdc:mga0k408_14707_c1 | 3300050493 | Bacteria | 4318 |
| 362 | nmdc:mga0k408_203_c2 | 3300050493 | Bacteria | 31214 |
| 363 | nmdc:mga0k408_3682_c1 | 3300050493 | Bacteria | 8115 |
| 364 | nmdc:mga06z11_6653_c1 | 3300050494 | Bacteria | 4723 |
| 365 | nmdc:mga05p37_109994_c1 | 3300050507 | Bacteria | 3390 |
| 366 | nmdc:mga05p37_211_c1 | 3300050507 | Bacteria | 58827 |
| 367 | nmdc:mga09592_221138_c1 | 3300050508 | Bacteria | 1641 |
| 368 | nmdc:mga09592_311_c1 | 3300050508 | Bacteria | 35521 |
| 369 | nmdc:mga0qj67_33680_c1 | 3300050509 | Bacteria | 3998 |
| 370 | nmdc:mga0qj67_8468_c1 | 3300050509 | Bacteria | 7631 |
| 371 | nmdc:mga06r32_220197_c1 | 3300050510 | Bacteria | 1886 |
| 372 | nmdc:mga06r32_244778_c1 | 3300050510 | Bacteria | 1781 |
| 373 | nmdc:mga08y16_103324_c1 | 3300050511 | Bacteria | 2967 |
| 374 | nmdc:mga0rr50_54374_c1 | 3300050513 | Bacteria | 2982 |
| 375 | nmdc:mga0sz30_26204_c1 | 3300050516 | Bacteria | 1503 |
| 376 | Ga0500655_001489 | 3300053133 | Bacteria | 4433 |
| 377 | Ga0500636_0000086 | 3300053177 | Bacteria | 46124 |
| 378 | Ga0500625_014769 | 3300053729 | Bacteria | 3612 |
| 379 | Ga0466962_0017199 | 3300061719 | Bacteria | 3483 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035121 | Ga0373960_0014627 | Ga0373960_0014627_283_1554 | 402 |
| 2 | 3300003374 | JGI25161J50226_1000835 | JGI25161J50226_10008358 | 406 |
| 3 | 3300003775 | Ga0055524_1002533 | Ga0055524_10025337 | 406 |
| 4 | 3300003791 | Ga0055530_10001933 | Ga0055530_1000193311 | 406 |
| 5 | 3300004625 | Ga0055543_1001437 | Ga0055543_10014375 | 406 |
| 6 | 3300005262 | Ga0065165_1004653 | Ga0065165_10046533 | 406 |
| 7 | 3300025208 | Ga0209436_100521 | Ga0209436_10052111 | 406 |
| 8 | 3300025263 | Ga0209565_1001401 | Ga0209565_10014016 | 406 |
| 9 | 3300025284 | Ga0209130_1001287 | Ga0209130_100128711 | 406 |
| 10 | 3300025295 | Ga0209564_1000639 | Ga0209564_100063939 | 406 |
| 11 | 3300025298 | Ga0209050_1000469 | Ga0209050_100046967 | 406 |
| 12 | 3300025299 | Ga0209256_1001909 | Ga0209256_100190915 | 406 |
| 13 | 3300025302 | Ga0207426_1010077 | Ga0207426_10100772 | 406 |
| 14 | 3300032002 | Ga0307416_100009076 | Ga0307416_1000090767 | 406 |
| 15 | iso_pu_bacteria | 8047673197 | 8047677869 | 406 |
| 16 | 3300006186 | Ga0075369_10006359 | Ga0075369_100063593 | 407 |
| 17 | 3300050493 | nmdc:mga0k408_203_c2 | nmdc:mga0k408_203_c2_24218_25441 | 407 |
| 18 | 3300006880 | Ga0075429_100137692 | Ga0075429_1001376922 | 408 |
| 19 | 3300050493 | nmdc:mga0k408_14707_c1 | nmdc:mga0k408_14707_c1_957_2306 | 408 |
| 20 | 3300005336 | Ga0070680_100070604 | Ga0070680_1000706042 | 409 |
| 21 | 3300005345 | Ga0070692_10063593 | Ga0070692_100635931 | 409 |
| 22 | 3300005347 | Ga0070668_100014416 | Ga0070668_1000144164 | 409 |
| 23 | 3300005353 | Ga0070669_100000995 | Ga0070669_10000099520 | 409 |
| 24 | 3300005354 | Ga0070675_100060882 | Ga0070675_1000608824 | 409 |
| 25 | 3300005441 | Ga0070700_100009006 | Ga0070700_1000090065 | 409 |
| 26 | 3300005459 | Ga0068867_100010377 | Ga0068867_1000103775 | 409 |
| 27 | 3300005718 | Ga0068866_10044936 | Ga0068866_100449362 | 409 |
| 28 | 3300005719 | Ga0068861_100004902 | Ga0068861_1000049026 | 409 |
| 29 | 3300005844 | Ga0068862_100008725 | Ga0068862_1000087256 | 409 |
| 30 | 3300006844 | Ga0075428_100268160 | Ga0075428_1002681602 | 409 |
| 31 | 3300006846 | Ga0075430_100012580 | Ga0075430_1000125805 | 409 |
| 32 | 3300006846 | Ga0075430_100050787 | Ga0075430_1000507874 | 409 |
| 33 | 3300006847 | Ga0075431_100019741 | Ga0075431_1000197417 | 409 |
| 34 | 3300006847 | Ga0075431_100093331 | Ga0075431_1000933313 | 409 |
| 35 | 3300006847 | Ga0075431_100323921 | Ga0075431_1003239211 | 409 |
| 36 | 3300006880 | Ga0075429_100160873 | Ga0075429_1001608732 | 409 |
| 37 | 3300007265 | Ga0099794_10012839 | Ga0099794_100128392 | 409 |
| 38 | 3300009147 | Ga0114129_10050630 | Ga0114129_100506305 | 409 |
| 39 | 3300009148 | Ga0105243_10017446 | Ga0105243_100174464 | 409 |
| 40 | 3300009553 | Ga0105249_10001620 | Ga0105249_1000162012 | 409 |
| 41 | 3300014326 | Ga0157380_10028648 | Ga0157380_100286482 | 409 |
| 42 | 3300014745 | Ga0157377_10047751 | Ga0157377_100477513 | 409 |
| 43 | 3300025917 | Ga0207660_10027301 | Ga0207660_100273014 | 409 |
| 44 | 3300025926 | Ga0207659_10103492 | Ga0207659_101034922 | 409 |
| 45 | 3300025935 | Ga0207709_10019286 | Ga0207709_100192861 | 409 |
| 46 | 3300025938 | Ga0207704_10012882 | Ga0207704_100128822 | 409 |
| 47 | 3300025942 | Ga0207689_10141217 | Ga0207689_101412172 | 409 |
| 48 | 3300025961 | Ga0207712_10070883 | Ga0207712_100708832 | 409 |
| 49 | 3300025972 | Ga0207668_10022551 | Ga0207668_100225511 | 409 |
| 50 | 3300026075 | Ga0207708_10007316 | Ga0207708_100073166 | 409 |
| 51 | 3300026089 | Ga0207648_10000238 | Ga0207648_1000023860 | 409 |
| 52 | 3300026118 | Ga0207675_100012412 | Ga0207675_1000124126 | 409 |
| 53 | 3300028380 | Ga0268265_10000459 | Ga0268265_100004596 | 409 |
| 54 | 3300035111 | Ga0373923_0035349 | Ga0373923_0035349_668_1897 | 409 |
| 55 | 3300035410 | Ga0373924_0027520 | Ga0373924_0027520_786_2015 | 409 |
| 56 | 3300035724 | Ga0373933_0009629 | Ga0373933_0009629_2038_3267 | 409 |
| 57 | 3300036401 | Ga0373937_0049635 | Ga0373937_0049635_1390_2619 | 409 |
| 58 | 3300042461 | Ga0439460_0021753 | Ga0439460_0021753_46_1275 | 409 |
| 59 | 3300046684 | Ga0495669_0069456 | Ga0495669_0069456_70_1299 | 409 |
| 60 | 3300050507 | nmdc:mga05p37_109994_c1 | nmdc:mga05p37_109994_c1_186_1415 | 409 |
| 61 | 3300050508 | nmdc:mga09592_221138_c1 | nmdc:mga09592_221138_c1_279_1508 | 409 |
| 62 | 3300050509 | nmdc:mga0qj67_33680_c1 | nmdc:mga0qj67_33680_c1_1939_3168 | 409 |
| 63 | 3300050509 | nmdc:mga0qj67_8468_c1 | nmdc:mga0qj67_8468_c1_6127_7356 | 409 |
| 64 | 3300050510 | nmdc:mga06r32_220197_c1 | nmdc:mga06r32_220197_c1_526_1755 | 409 |
| 65 | 3300050510 | nmdc:mga06r32_244778_c1 | nmdc:mga06r32_244778_c1_158_1387 | 409 |
| 66 | 3300050511 | nmdc:mga08y16_103324_c1 | nmdc:mga08y16_103324_c1_1502_2731 | 409 |
| 67 | 3300050513 | nmdc:mga0rr50_54374_c1 | nmdc:mga0rr50_54374_c1_330_1559 | 409 |
| 68 | 3300005262 | Ga0065165_1013869 | Ga0065165_10138693 | 410 |
| 69 | 3300005327 | Ga0070658_10179121 | Ga0070658_101791211 | 410 |
| 70 | 3300005339 | Ga0070660_100027633 | Ga0070660_1000276333 | 410 |
| 71 | 3300005339 | Ga0070660_100132541 | Ga0070660_1001325412 | 410 |
| 72 | 3300005563 | Ga0068855_100085413 | Ga0068855_1000854133 | 410 |
| 73 | 3300005563 | Ga0068855_100378172 | Ga0068855_1003781722 | 410 |
| 74 | 3300009174 | Ga0105241_10017747 | Ga0105241_100177471 | 410 |
| 75 | 3300009176 | Ga0105242_10086265 | Ga0105242_100862652 | 410 |
| 76 | 3300009545 | Ga0105237_10068023 | Ga0105237_100680232 | 410 |
| 77 | 3300009551 | Ga0105238_10324503 | Ga0105238_103245032 | 410 |
| 78 | 3300013100 | Ga0157373_10130153 | Ga0157373_101301532 | 410 |
| 79 | 3300025230 | Ga0209563_100015 | Ga0209563_100015349 | 410 |
| 80 | 3300025728 | Ga0207655_1045729 | Ga0207655_10457292 | 410 |
| 81 | 3300025909 | Ga0207705_10101798 | Ga0207705_101017982 | 410 |
| 82 | 3300025911 | Ga0207654_10016090 | Ga0207654_100160903 | 410 |
| 83 | 3300025917 | Ga0207660_10056327 | Ga0207660_100563271 | 410 |
| 84 | 3300025932 | Ga0207690_10003354 | Ga0207690_100033544 | 410 |
| 85 | 3300025933 | Ga0207706_10082841 | Ga0207706_100828412 | 410 |
| 86 | 3300025949 | Ga0207667_10006079 | Ga0207667_100060795 | 410 |
| 87 | 3300026142 | Ga0207698_10075271 | Ga0207698_100752712 | 410 |
| 88 | 3300028794 | Ga0307515_10000020 | Ga0307515_10000020341 | 410 |
| 89 | 3300037312 | Ga0395899_0013433 | Ga0395899_0013433_2005_3237 | 410 |
| 90 | 3300037312 | Ga0395899_0017193 | Ga0395899_0017193_909_2141 | 410 |
| 91 | 3300037312 | Ga0395899_0045648 | Ga0395899_0045648_558_1790 | 410 |
| 92 | 3300037418 | Ga0395900_0001738 | Ga0395900_0001738_22879_24111 | 410 |
| 93 | 3300037418 | Ga0395900_0004356 | Ga0395900_0004356_10168_11400 | 410 |
| 94 | 3300037466 | Ga0395898_0016407 | Ga0395898_0016407_4344_5576 | 410 |
| 95 | 3300037466 | Ga0395898_0049958 | Ga0395898_0049958_453_1685 | 410 |
| 96 | 3300037466 | Ga0395898_0232929 | Ga0395898_0232929_442_1674 | 410 |
| 97 | 3300037471 | Ga0395905_0054285 | Ga0395905_0054285_1953_3185 | 410 |
| 98 | 3300037471 | Ga0395905_0149866 | Ga0395905_0149866_417_1649 | 410 |
| 99 | 3300038443 | Ga0395901_0001782 | Ga0395901_0001782_17535_18767 | 410 |
| 100 | 3300042005 | Ga0439448_0001936 | Ga0439448_0001936_2972_4204 | 410 |
| 101 | 3300042008 | Ga0439450_002808 | Ga0439450_002808_428_1660 | 410 |
| 102 | 3300042012 | Ga0439455_0003148 | Ga0439455_0003148_431_1663 | 410 |
| 103 | 3300044658 | Ga0466972_0020642 | Ga0466972_0020642_609_1841 | 410 |
| 104 | 3300044683 | Ga0466965_0010530 | Ga0466965_0010530_1449_2681 | 410 |
| 105 | 3300044683 | Ga0466965_0024429 | Ga0466965_0024429_282_1514 | 410 |
| 106 | 3300044684 | Ga0466966_0056758 | Ga0466966_0056758_652_1884 | 410 |
| 107 | 3300044719 | Ga0466971_0104350 | Ga0466971_0104350_24_1256 | 410 |
| 108 | 3300044842 | Ga0466957_0027728 | Ga0466957_0027728_1467_2699 | 410 |
| 109 | 3300045049 | Ga0466959_0012677 | Ga0466959_0012677_392_1624 | 410 |
| 110 | 3300045049 | Ga0466959_0061224 | Ga0466959_0061224_1241_2473 | 410 |
| 111 | 3300045976 | Ga0466967_0008988 | Ga0466967_0008988_4805_6037 | 410 |
| 112 | 3300046474 | Ga0495605_0000085 | Ga0495605_0000085_113277_114509 | 410 |
| 113 | 3300046501 | Ga0495607_0034853 | Ga0495607_0034853_1346_2578 | 410 |
| 114 | 3300046513 | Ga0495616_0000145 | Ga0495616_0000145_44643_45875 | 410 |
| 115 | 3300046522 | Ga0495643_0004391 | Ga0495643_0004391_1369_2685 | 410 |
| 116 | 3300046522 | Ga0495643_0015686 | Ga0495643_0015686_473_1705 | 410 |
| 117 | 3300046524 | Ga0495648_0011756 | Ga0495648_0011756_2643_3875 | 410 |
| 118 | 3300046528 | Ga0495642_0000973 | Ga0495642_0000973_3152_4384 | 410 |
| 119 | 3300046538 | Ga0495609_0000002 | Ga0495609_0000002_115352_116584 | 410 |
| 120 | 3300046665 | Ga0495661_0000271 | Ga0495661_0000271_6898_8130 | 410 |
| 121 | 3300046665 | Ga0495661_0000669 | Ga0495661_0000669_10028_11260 | 410 |
| 122 | 3300046665 | Ga0495661_0002269 | Ga0495661_0002269_167_1399 | 410 |
| 123 | 3300046674 | Ga0495588_0000135 | Ga0495588_0000135_10955_12187 | 410 |
| 124 | 3300046794 | Ga0495589_0000030 | Ga0495589_0000030_102206_103438 | 410 |
| 125 | 3300046794 | Ga0495589_0001070 | Ga0495589_0001070_11790_13022 | 410 |
| 126 | 3300046810 | Ga0495660_0000423 | Ga0495660_0000423_11787_13019 | 410 |
| 127 | 3300047320 | Ga0495672_0000833 | Ga0495672_0000833_12803_14035 | 410 |
| 128 | 3300047443 | Ga0495687_000047 | Ga0495687_000047_102208_103440 | 410 |
| 129 | 3300047443 | Ga0495687_000112 | Ga0495687_000112_44823_46055 | 410 |
| 130 | 3300047443 | Ga0495687_001101 | Ga0495687_001101_1547_2779 | 410 |
| 131 | 3300047445 | Ga0495677_0000044 | Ga0495677_0000044_66211_67443 | 410 |
| 132 | 3300047445 | Ga0495677_0007472 | Ga0495677_0007472_127_1359 | 410 |
| 133 | 3300048091 | Ga0495626_0000006 | Ga0495626_0000006_263021_264253 | 410 |
| 134 | 3300048091 | Ga0495626_0000266 | Ga0495626_0000266_6898_8130 | 410 |
| 135 | 3300048905 | Ga0496102_0079152 | Ga0496102_0079152_152_1384 | 410 |
| 136 | 3300048911 | Ga0496108_0226075 | Ga0496108_0226075_228_1460 | 410 |
| 137 | 3300048916 | Ga0496113_0052467 | Ga0496113_0052467_1028_2260 | 410 |
| 138 | 3300048925 | Ga0496122_0019569 | Ga0496122_0019569_528_1760 | 410 |
| 139 | 3300048926 | Ga0496123_0005792 | Ga0496123_0005792_606_1838 | 410 |
| 140 | 3300061719 | Ga0466962_0017199 | Ga0466962_0017199_346_1578 | 410 |
| 141 | 3300005471 | Ga0070698_100009492 | Ga0070698_1000094924 | 411 |
| 142 | 3300006880 | Ga0075429_100000015 | Ga0075429_10000001516 | 411 |
| 143 | 3300009147 | Ga0114129_10002286 | Ga0114129_1000228611 | 411 |
| 144 | 3300031251 | Ga0265327_10000235 | Ga0265327_100002359 | 411 |
| 145 | 3300050507 | nmdc:mga05p37_211_c1 | nmdc:mga05p37_211_c1_44593_45828 | 411 |
| 146 | 3300050508 | nmdc:mga09592_311_c1 | nmdc:mga09592_311_c1_24862_26097 | 411 |
| 147 | 3300006195 | Ga0075366_10031818 | Ga0075366_100318183 | 412 |
| 148 | 3300006847 | Ga0075431_100100742 | Ga0075431_1001007422 | 412 |
| 149 | 3300025986 | Ga0207658_10153632 | Ga0207658_101536322 | 412 |
| 150 | 3300030731 | Ga0316177_1151259 | Ga0316177_11512594 | 412 |
| 151 | 3300030736 | Ga0316180_1100674 | Ga0316180_11006741 | 412 |
| 152 | 3300031251 | Ga0265327_10011126 | Ga0265327_100111263 | 412 |
| 153 | 3300046506 | Ga0495583_0000205 | Ga0495583_0000205_81742_82980 | 412 |
| 154 | 3300048905 | Ga0496102_0034795 | Ga0496102_0034795_637_1875 | 412 |
| 155 | 3300044712 | Ga0453684_0023507 | Ga0453684_0023507_91_1344 | 413 |
| 156 | 3300047443 | Ga0495687_002457 | Ga0495687_002457_8117_9376 | 413 |
| 157 | 3300048090 | Ga0495615_0002476 | Ga0495615_0002476_1063_2304 | 413 |
| 158 | 3300006195 | Ga0075366_10013373 | Ga0075366_100133734 | 414 |
| 159 | 3300005328 | Ga0070676_10047775 | Ga0070676_100477752 | 415 |
| 160 | 3300005339 | Ga0070660_100005509 | Ga0070660_10000550910 | 415 |
| 161 | 3300005344 | Ga0070661_100105734 | Ga0070661_1001057342 | 415 |
| 162 | 3300005539 | Ga0068853_100166382 | Ga0068853_1001663822 | 415 |
| 163 | 3300005548 | Ga0070665_100145120 | Ga0070665_1001451202 | 415 |
| 164 | 3300006177 | Ga0075362_10043758 | Ga0075362_100437582 | 415 |
| 165 | 3300025914 | Ga0207671_10030997 | Ga0207671_100309972 | 415 |
| 166 | 3300025919 | Ga0207657_10002609 | Ga0207657_100026093 | 415 |
| 167 | 3300025920 | Ga0207649_10009052 | Ga0207649_100090523 | 415 |
| 168 | 3300025932 | Ga0207690_10002750 | Ga0207690_100027503 | 415 |
| 169 | 3300026041 | Ga0207639_10029242 | Ga0207639_100292424 | 415 |
| 170 | 3300028379 | Ga0268266_10255791 | Ga0268266_102557912 | 415 |
| 171 | 3300042001 | Ga0439441_000604 | Ga0439441_000604_648_1895 | 415 |
| 172 | 3300045051 | Ga0451576_0236095 | Ga0451576_0236095_288_1535 | 415 |
| 173 | 3300049656 | Ga0501209_002850 | Ga0501209_002850_745_2004 | 415 |
| 174 | iso_pu_bacteria | 2919704043 | 2919709066 | 415 |
| 175 | iso_pu_bacteria | 2998344455 | 2998346625 | 415 |
| 176 | 3300006048 | Ga0075363_100020767 | Ga0075363_1000207672 | 416 |
| 177 | 3300006051 | Ga0075364_10022937 | Ga0075364_100229375 | 416 |
| 178 | 3300006178 | Ga0075367_10005208 | Ga0075367_100052082 | 416 |
| 179 | 3300006186 | Ga0075369_10002991 | Ga0075369_100029914 | 416 |
| 180 | 3300006195 | Ga0075366_10011139 | Ga0075366_100111395 | 416 |
| 181 | 3300006195 | Ga0075366_10023572 | Ga0075366_100235723 | 416 |
| 182 | 3300006353 | Ga0075370_10016055 | Ga0075370_100160552 | 416 |
| 183 | 3300009147 | Ga0114129_10056195 | Ga0114129_100561955 | 416 |
| 184 | 3300050490 | nmdc:mga03n38_2426_c1 | nmdc:mga03n38_2426_c1_1356_2642 | 416 |
| 185 | 3300050491 | nmdc:mga00v17_36998_c1 | nmdc:mga00v17_36998_c1_1593_2879 | 416 |
| 186 | 3300050494 | nmdc:mga06z11_6653_c1 | nmdc:mga06z11_6653_c1_34_1320 | 416 |
| 187 | 3300050489 | nmdc:mga03683_5252_c1 | nmdc:mga03683_5252_c1_3080_4339 | 417 |
| 188 | 3300050493 | nmdc:mga0k408_3682_c1 | nmdc:mga0k408_3682_c1_2450_3709 | 417 |
| 189 | 3300005340 | Ga0070689_100025034 | Ga0070689_1000250343 | 418 |
| 190 | 3300005543 | Ga0070672_100051058 | Ga0070672_1000510581 | 418 |
| 191 | 3300005617 | Ga0068859_100140283 | Ga0068859_1001402833 | 418 |
| 192 | 3300006931 | Ga0097620_100140282 | Ga0097620_1001402823 | 418 |
| 193 | 3300009147 | Ga0114129_10300099 | Ga0114129_103000992 | 418 |
| 194 | 3300014326 | Ga0157380_10261486 | Ga0157380_102614861 | 418 |
| 195 | 3300014745 | Ga0157377_10012505 | Ga0157377_100125052 | 418 |
| 196 | 3300025936 | Ga0207670_10010367 | Ga0207670_100103674 | 418 |
| 197 | 3300025940 | Ga0207691_10002613 | Ga0207691_100026134 | 418 |
| 198 | 3300026116 | Ga0207674_10026030 | Ga0207674_100260304 | 418 |
| 199 | 3300053177 | Ga0500636_0000086 | Ga0500636_0000086_42184_43452 | 418 |
| 200 | 3300053729 | Ga0500625_014769 | Ga0500625_014769_1015_2283 | 418 |
| 201 | 3300005336 | Ga0070680_100126122 | Ga0070680_1001261222 | 420 |
| 202 | 3300006880 | Ga0075429_100001431 | Ga0075429_10000143110 | 420 |
| 203 | 3300027671 | Ga0209588_1010205 | Ga0209588_10102052 | 420 |
| 204 | 3300049649 | Ga0501198_000006 | Ga0501198_000006_93997_95259 | 420 |
| 205 | 3300049662 | Ga0501222_000007 | Ga0501222_000007_53972_55234 | 420 |
| 206 | 3300009094 | Ga0111539_10158327 | Ga0111539_101583271 | 421 |
| 207 | 3300044684 | Ga0466966_0013081 | Ga0466966_0013081_4159_5436 | 421 |
| 208 | 3300044693 | Ga0466961_0000232 | Ga0466961_0000232_29908_31185 | 421 |
| 209 | 3300044706 | Ga0466964_0055629 | Ga0466964_0055629_27_1304 | 421 |
| 210 | 3300045049 | Ga0466959_0036373 | Ga0466959_0036373_78_1355 | 421 |
| 211 | 3300025923 | Ga0207681_10080811 | Ga0207681_100808113 | 423 |
| 212 | 3300031616 | Ga0307508_10032307 | Ga0307508_100323074 | 424 |
| 213 | 3300050492 | nmdc:mga0yw44_77914_c1 | nmdc:mga0yw44_77914_c1_527_2047 | 424 |
| 214 | iso_pu_bacteria | 2808606386 | 2808984966 | 424 |
| 215 | iso_pu_bacteria | 2808606415 | 2809131853 | 424 |
| 216 | iso_pu_bacteria | 2808606419 | 2809151335 | 424 |
| 217 | iso_pu_bacteria | 2852618963 | 2852620815 | 424 |
| 218 | 3300006186 | Ga0075369_10005360 | Ga0075369_100053603 | 425 |
| 219 | 3300025910 | Ga0207684_10051223 | Ga0207684_100512233 | 425 |
| 220 | 3300031251 | Ga0265327_10044005 | Ga0265327_100440052 | 425 |
| 221 | 3300005329 | Ga0070683_100017689 | Ga0070683_1000176892 | 426 |
| 222 | 3300005331 | Ga0070670_100028987 | Ga0070670_1000289876 | 426 |
| 223 | 3300005334 | Ga0068869_100068815 | Ga0068869_1000688153 | 426 |
| 224 | 3300005338 | Ga0068868_100024020 | Ga0068868_1000240203 | 426 |
| 225 | 3300005344 | Ga0070661_100020266 | Ga0070661_1000202661 | 426 |
| 226 | 3300005354 | Ga0070675_100047235 | Ga0070675_1000472352 | 426 |
| 227 | 3300005355 | Ga0070671_100064651 | Ga0070671_1000646513 | 426 |
| 228 | 3300005364 | Ga0070673_100015414 | Ga0070673_1000154145 | 426 |
| 229 | 3300005367 | Ga0070667_100160301 | Ga0070667_1001603012 | 426 |
| 230 | 3300005457 | Ga0070662_100075759 | Ga0070662_1000757591 | 426 |
| 231 | 3300005459 | Ga0068867_100164266 | Ga0068867_1001642661 | 426 |
| 232 | 3300005543 | Ga0070672_100024857 | Ga0070672_1000248575 | 426 |
| 233 | 3300005564 | Ga0070664_100012340 | Ga0070664_1000123402 | 426 |
| 234 | 3300005578 | Ga0068854_100014861 | Ga0068854_1000148613 | 426 |
| 235 | 3300005615 | Ga0070702_100037916 | Ga0070702_1000379162 | 426 |
| 236 | 3300005616 | Ga0068852_100002785 | Ga0068852_10000278515 | 426 |
| 237 | 3300005618 | Ga0068864_100092240 | Ga0068864_1000922403 | 426 |
| 238 | 3300005841 | Ga0068863_100052150 | Ga0068863_1000521504 | 426 |
| 239 | 3300006237 | Ga0097621_100047184 | Ga0097621_1000471843 | 426 |
| 240 | 3300006358 | Ga0068871_100011520 | Ga0068871_1000115203 | 426 |
| 241 | 3300011119 | Ga0105246_10057403 | Ga0105246_100574031 | 426 |
| 242 | 3300013297 | Ga0157378_10059018 | Ga0157378_100590181 | 426 |
| 243 | 3300013306 | Ga0163162_10005803 | Ga0163162_100058039 | 426 |
| 244 | 3300013308 | Ga0157375_10039512 | Ga0157375_100395123 | 426 |
| 245 | 3300014745 | Ga0157377_10034527 | Ga0157377_100345272 | 426 |
| 246 | 3300014969 | Ga0157376_10066377 | Ga0157376_100663773 | 426 |
| 247 | 3300025295 | Ga0209564_1002275 | Ga0209564_100227512 | 426 |
| 248 | 3300025920 | Ga0207649_10013731 | Ga0207649_100137314 | 426 |
| 249 | 3300025925 | Ga0207650_10007639 | Ga0207650_100076396 | 426 |
| 250 | 3300025925 | Ga0207650_10208530 | Ga0207650_102085301 | 426 |
| 251 | 3300025926 | Ga0207659_10009785 | Ga0207659_100097852 | 426 |
| 252 | 3300025927 | Ga0207687_10088779 | Ga0207687_100887792 | 426 |
| 253 | 3300025931 | Ga0207644_10019514 | Ga0207644_100195146 | 426 |
| 254 | 3300025940 | Ga0207691_10006268 | Ga0207691_100062682 | 426 |
| 255 | 3300025945 | Ga0207679_10000906 | Ga0207679_100009062 | 426 |
| 256 | 3300025960 | Ga0207651_10014268 | Ga0207651_100142684 | 426 |
| 257 | 3300026023 | Ga0207677_10022469 | Ga0207677_100224692 | 426 |
| 258 | 3300026089 | Ga0207648_10007566 | Ga0207648_1000756612 | 426 |
| 259 | 3300026095 | Ga0207676_10016917 | Ga0207676_100169173 | 426 |
| 260 | 3300026121 | Ga0207683_10033260 | Ga0207683_100332604 | 426 |
| 261 | 3300026142 | Ga0207698_10008426 | Ga0207698_100084262 | 426 |
| 262 | 3300048904 | Ga0496101_0017179 | Ga0496101_0017179_313_1614 | 426 |
| 263 | 3300048912 | Ga0496109_0055775 | Ga0496109_0055775_1317_2618 | 426 |
| 264 | 3300048913 | Ga0496110_0164352 | Ga0496110_0164352_20_1321 | 426 |
| 265 | 3300048914 | Ga0496111_0138359 | Ga0496111_0138359_421_1722 | 426 |
| 266 | 3300005330 | Ga0070690_100014451 | Ga0070690_1000144515 | 427 |
| 267 | 3300005334 | Ga0068869_100016487 | Ga0068869_1000164874 | 427 |
| 268 | 3300005344 | Ga0070661_100052636 | Ga0070661_1000526362 | 427 |
| 269 | 3300005353 | Ga0070669_100064627 | Ga0070669_1000646271 | 427 |
| 270 | 3300005354 | Ga0070675_100148081 | Ga0070675_1001480811 | 427 |
| 271 | 3300005354 | Ga0070675_100340440 | Ga0070675_1003404401 | 427 |
| 272 | 3300005355 | Ga0070671_100184858 | Ga0070671_1001848581 | 427 |
| 273 | 3300005367 | Ga0070667_100159908 | Ga0070667_1001599081 | 427 |
| 274 | 3300005438 | Ga0070701_10012992 | Ga0070701_100129923 | 427 |
| 275 | 3300005441 | Ga0070700_100090817 | Ga0070700_1000908172 | 427 |
| 276 | 3300005459 | Ga0068867_100228382 | Ga0068867_1002283821 | 427 |
| 277 | 3300005543 | Ga0070672_100123335 | Ga0070672_1001233351 | 427 |
| 278 | 3300005549 | Ga0070704_100222609 | Ga0070704_1002226091 | 427 |
| 279 | 3300005564 | Ga0070664_100265034 | Ga0070664_1002650341 | 427 |
| 280 | 3300005615 | Ga0070702_100013820 | Ga0070702_1000138203 | 427 |
| 281 | 3300005617 | Ga0068859_100034835 | Ga0068859_1000348355 | 427 |
| 282 | 3300005840 | Ga0068870_10112724 | Ga0068870_101127242 | 427 |
| 283 | 3300005844 | Ga0068862_100043133 | Ga0068862_1000431334 | 427 |
| 284 | 3300006358 | Ga0068871_100111107 | Ga0068871_1001111072 | 427 |
| 285 | 3300006931 | Ga0097620_100034835 | Ga0097620_1000348355 | 427 |
| 286 | 3300009148 | Ga0105243_10029716 | Ga0105243_100297163 | 427 |
| 287 | 3300013308 | Ga0157375_10324099 | Ga0157375_103240991 | 427 |
| 288 | 3300014326 | Ga0157380_10213030 | Ga0157380_102130302 | 427 |
| 289 | 3300014745 | Ga0157377_10010373 | Ga0157377_100103734 | 427 |
| 290 | 3300014969 | Ga0157376_10093549 | Ga0157376_100935493 | 427 |
| 291 | 3300025893 | Ga0207682_10013444 | Ga0207682_100134443 | 427 |
| 292 | 3300025899 | Ga0207642_10071679 | Ga0207642_100716792 | 427 |
| 293 | 3300025901 | Ga0207688_10016217 | Ga0207688_100162171 | 427 |
| 294 | 3300025903 | Ga0207680_10042399 | Ga0207680_100423993 | 427 |
| 295 | 3300025907 | Ga0207645_10011275 | Ga0207645_100112751 | 427 |
| 296 | 3300025918 | Ga0207662_10013720 | Ga0207662_100137204 | 427 |
| 297 | 3300025925 | Ga0207650_10046549 | Ga0207650_100465492 | 427 |
| 298 | 3300025926 | Ga0207659_10044984 | Ga0207659_100449841 | 427 |
| 299 | 3300025935 | Ga0207709_10154304 | Ga0207709_101543041 | 427 |
| 300 | 3300025938 | Ga0207704_10076425 | Ga0207704_100764252 | 427 |
| 301 | 3300025942 | Ga0207689_10003339 | Ga0207689_100033392 | 427 |
| 302 | 3300026035 | Ga0207703_10038294 | Ga0207703_100382942 | 427 |
| 303 | 3300026089 | Ga0207648_10029709 | Ga0207648_100297091 | 427 |
| 304 | 3300026118 | Ga0207675_100099797 | Ga0207675_1000997973 | 427 |
| 305 | 3300028381 | Ga0268264_10244393 | Ga0268264_102443932 | 427 |
| 306 | 3300028577 | Ga0265318_10012590 | Ga0265318_100125903 | 427 |
| 307 | 3300031238 | Ga0265332_10002147 | Ga0265332_100021476 | 427 |
| 308 | 3300031250 | Ga0265331_10001179 | Ga0265331_1000117912 | 427 |
| 309 | 3300031711 | Ga0265314_10000887 | Ga0265314_1000088710 | 427 |
| 310 | 3300046537 | Ga0495598_0001997 | Ga0495598_0001997_1482_2774 | 427 |
| 311 | 3300030521 | Ga0307511_10017009 | Ga0307511_100170095 | 429 |
| 312 | 3300050516 | nmdc:mga0sz30_26204_c1 | nmdc:mga0sz30_26204_c1_135_1433 | 429 |
| 313 | 3300053133 | Ga0500655_001489 | Ga0500655_001489_2388_3686 | 429 |
| 314 | 3300003187 | JGI25151J46595_10038402 | JGI25151J46595_100384021 | 430 |
| 315 | 3300003775 | Ga0055524_1005230 | Ga0055524_10052306 | 430 |
| 316 | 3300006051 | Ga0075364_10009289 | Ga0075364_100092891 | 430 |
| 317 | 3300025263 | Ga0209565_1010479 | Ga0209565_10104792 | 430 |
| 318 | 3300025294 | Ga0209025_1001806 | Ga0209025_100180615 | 430 |
| 319 | 3300025299 | Ga0209256_1001334 | Ga0209256_100133427 | 430 |
| 320 | 3300025303 | Ga0209051_1026910 | Ga0209051_10269101 | 430 |
| 321 | 3300005347 | Ga0070668_100011697 | Ga0070668_1000116974 | 431 |
| 322 | 3300014326 | Ga0157380_10011934 | Ga0157380_100119342 | 431 |
| 323 | 3300005548 | Ga0070665_100029022 | Ga0070665_1000290224 | 432 |
| 324 | 3300014325 | Ga0163163_10073189 | Ga0163163_100731892 | 432 |
| 325 | 3300014969 | Ga0157376_10007184 | Ga0157376_100071845 | 432 |
| 326 | 3300025931 | Ga0207644_10021558 | Ga0207644_100215583 | 432 |
| 327 | 3300042436 | Ga0439435_0003266 | Ga0439435_0003266_1041_2366 | 432 |
| 328 | 3300047318 | Ga0495636_0015916 | Ga0495636_0015916_803_2125 | 432 |
| 329 | 3300005331 | Ga0070670_100005362 | Ga0070670_1000053626 | 433 |
| 330 | 3300005334 | Ga0068869_100000106 | Ga0068869_10000010633 | 433 |
| 331 | 3300005338 | Ga0068868_100008784 | Ga0068868_1000087845 | 433 |
| 332 | 3300005347 | Ga0070668_100065440 | Ga0070668_1000654403 | 433 |
| 333 | 3300005364 | Ga0070673_100031370 | Ga0070673_1000313702 | 433 |
| 334 | 3300005367 | Ga0070667_100000861 | Ga0070667_10000086110 | 433 |
| 335 | 3300005459 | Ga0068867_100000742 | Ga0068867_10000074213 | 433 |
| 336 | 3300005617 | Ga0068859_100000273 | Ga0068859_1000002734 | 433 |
| 337 | 3300005618 | Ga0068864_100000963 | Ga0068864_1000009639 | 433 |
| 338 | 3300005719 | Ga0068861_100002534 | Ga0068861_1000025344 | 433 |
| 339 | 3300005840 | Ga0068870_10005790 | Ga0068870_100057904 | 433 |
| 340 | 3300005841 | Ga0068863_100010467 | Ga0068863_1000104674 | 433 |
| 341 | 3300005842 | Ga0068858_100013306 | Ga0068858_1000133069 | 433 |
| 342 | 3300005842 | Ga0068858_100027046 | Ga0068858_1000270464 | 433 |
| 343 | 3300005843 | Ga0068860_100017893 | Ga0068860_1000178935 | 433 |
| 344 | 3300005844 | Ga0068862_100003118 | Ga0068862_1000031189 | 433 |
| 345 | 3300006931 | Ga0097620_100000273 | Ga0097620_10000027348 | 433 |
| 346 | 3300006948 | Ga0099826_10000007 | Ga0099826_10000007321 | 433 |
| 347 | 3300009148 | Ga0105243_10211775 | Ga0105243_102117752 | 433 |
| 348 | 3300009177 | Ga0105248_10005623 | Ga0105248_100056236 | 433 |
| 349 | 3300013297 | Ga0157378_10009669 | Ga0157378_100096692 | 433 |
| 350 | 3300013306 | Ga0163162_10063815 | Ga0163162_100638153 | 433 |
| 351 | 3300014968 | Ga0157379_10000629 | Ga0157379_1000062913 | 433 |
| 352 | 3300025907 | Ga0207645_10018600 | Ga0207645_100186003 | 433 |
| 353 | 3300025908 | Ga0207643_10004615 | Ga0207643_100046153 | 433 |
| 354 | 3300025918 | Ga0207662_10061849 | Ga0207662_100618492 | 433 |
| 355 | 3300025925 | Ga0207650_10004337 | Ga0207650_100043378 | 433 |
| 356 | 3300025927 | Ga0207687_10039974 | Ga0207687_100399743 | 433 |
| 357 | 3300025942 | Ga0207689_10000118 | Ga0207689_100001183 | 433 |
| 358 | 3300025960 | Ga0207651_10019279 | Ga0207651_100192793 | 433 |
| 359 | 3300025961 | Ga0207712_10153066 | Ga0207712_101530661 | 433 |
| 360 | 3300025972 | Ga0207668_10043293 | Ga0207668_100432933 | 433 |
| 361 | 3300026035 | Ga0207703_10001578 | Ga0207703_1000157813 | 433 |
| 362 | 3300026035 | Ga0207703_10188046 | Ga0207703_101880461 | 433 |
| 363 | 3300026089 | Ga0207648_10001056 | Ga0207648_1000105613 | 433 |
| 364 | 3300026095 | Ga0207676_10077609 | Ga0207676_100776092 | 433 |
| 365 | 3300026118 | Ga0207675_100000979 | Ga0207675_10000097911 | 433 |
| 366 | 3300027666 | Ga0209282_1000021 | Ga0209282_100002154 | 433 |
| 367 | 3300028381 | Ga0268264_10001039 | Ga0268264_1000103912 | 433 |
| 368 | 3300048905 | Ga0496102_0028837 | Ga0496102_0028837_583_1887 | 433 |
| 369 | 3300005331 | Ga0070670_100037626 | Ga0070670_1000376263 | 434 |
| 370 | 3300009176 | Ga0105242_10027042 | Ga0105242_100270425 | 434 |
| 371 | 3300003187 | JGI25151J46595_10001315 | JGI25151J46595_100013155 | 436 |
| 372 | 3300003771 | Ga0055526_1006460 | Ga0055526_10064606 | 436 |
| 373 | 3300003773 | Ga0055537_1002374 | Ga0055537_10023745 | 436 |
| 374 | 3300003775 | Ga0055524_1002073 | Ga0055524_10020735 | 436 |
| 375 | 3300003781 | Ga0055536_1000134 | Ga0055536_100013443 | 436 |
| 376 | 3300003784 | Ga0055534_1001576 | Ga0055534_10015766 | 436 |
| 377 | 3300003784 | Ga0055534_1002439 | Ga0055534_10024395 | 436 |
| 378 | 3300025263 | Ga0209565_1000104 | Ga0209565_100010427 | 436 |
| 379 | 3300025291 | Ga0209675_1000191 | Ga0209675_10001919 | 436 |
| 380 | 3300025291 | Ga0209675_1002151 | Ga0209675_10021512 | 436 |
| 381 | 3300025292 | Ga0209676_1000036 | Ga0209676_1000036397 | 436 |
| 382 | 3300025294 | Ga0209025_1000905 | Ga0209025_100090541 | 436 |
| 383 | 3300025294 | Ga0209025_1002048 | Ga0209025_10020489 | 436 |
| 384 | 3300025295 | Ga0209564_1000688 | Ga0209564_10006882 | 436 |
| 385 | 3300025295 | Ga0209564_1004020 | Ga0209564_10040205 | 436 |
| 386 | 3300025299 | Ga0209256_1001092 | Ga0209256_10010929 | 436 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2g29-assembly1.cif.gz_A | crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 | 0.947 | 58 | 430 |
| 2i49-assembly1.cif.gz_A | crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 | 0.9185 | 59 | 431 |
| 2g29-assembly1.cif.gz_A | crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 | 0.916 | 58 | 430 |
| 3un6-assembly1.cif.gz_A | 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound | 0.8813 | 61 | 391 |
| 3un6-assembly1.cif.gz_A | 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound | 0.8699 | 61 | 391 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2g29A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9003 | 58 | 403 | 3.40.190.10 |
| 2g29A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8971 | 145 | 251 | 3.40.190.10 |
| 2g29A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8664 | 58 | 403 | 3.40.190.10 |
| 2i4cA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8656 | 146 | 251 | 3.40.190.10 |
| 3ksxA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.846 | 144 | 250 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X9K6E8-F1-model_v4 | deleted | 0.9911 | 123 | 432 |
|
| AF-A0A7X9K6E8-F1-model_v4 | deleted | 0.9879 | 123 | 432 |
|
| AF-H0PXH3-F1-model_v4 | Assimilatory nitrate transport system, periplasmic-binding protein | 0.9872 | 49 | 432 |
GO:0005886
GO:0012505 |
| AF-A0A2X5CFR1-F1-model_v4 | deleted | 0.9855 | 65 | 366 |
|
| AF-A0A0Q7XEK8-F1-model_v4 | Nitrate transporter | 0.9852 | 59 | 431 |
GO:0005886
GO:0012505 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar