F430576

General Info

Members Datasets Scaffolds Average Seq Length
386 265 772 412

Family's Representative Sequence

Representative Sequence 3300038741|Ga0400488_49889|Ga0400488_49889_6452_7720
Length 399
Sequence VGAVKVLVVGSGAREHALVRALSQDPAVDAVACAPGNAGIALVADCRPLDVADPEAGAADAVRARGISCFGPSAGAARLEGSKAFAKEVMAAAGVPTAMAHVCTGLGEVDAAMDAFGPPYVIKDDGLAAGKGVVVTDDAEAARSHAASCLARPDGRVVVEEYLDGPEVSLFCITDGTTVVPLAPAQDFKRVGDGDTGPNTGGMGAYSPLPWAPEDLVDGVVDRVAQPCVDEMARRGTPFAGLLYCGLALTSRGVRVVEFNARFGDPETQVVLARLVTPLAGVLRAAAAGTLDQIPSLRWREEAAVTVVVAARDYPASPHTGDPIGGLEEAGAVPGAWVLHAGTRTDADGVVVSSGGRVLSVVGTGSDLATARDVAYRAVALIELDGSHHRRDIAERAAG

Samples

Sample ID Description Type Environment
1 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
11 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
12 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
13 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
14 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
15 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
16 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
17 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
18 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
19 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
20 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
21 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
22 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
31 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
32 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
33 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
34 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
35 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
36 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
37 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
38 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
39 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
40 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
41 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
42 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
43 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
44 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
45 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
46 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
47 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
48 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
49 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
53 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
54 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
55 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
56 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
57 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
58 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
59 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
60 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
61 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
62 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
63 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
64 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
65 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
66 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
67 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
122 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
140 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
143 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
174 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
175 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
176 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
177 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
178 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
179 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
180 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
181 2643221548 Streptomyces sp. Root55 Isolate Unclassified
182 2643221578 Streptomyces sp. Root63 Isolate Unclassified
183 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
184 2643221647 Streptomyces sp. Root369 Isolate Unclassified
185 2643221670 Streptomyces sp. Root431 Isolate Unclassified
186 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
187 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
188 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
189 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
190 2643221711 Terrabacter sp. Root85 Isolate Unclassified
191 2643221714 Streptomyces sp. Root264 Isolate Unclassified
192 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
193 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
194 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
195 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
196 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
197 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
198 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
199 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
200 2808606448 Streptomyces sp. 193411 Isolate Unclassified
201 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
202 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
203 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
204 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
205 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
206 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
207 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
208 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
209 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
210 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
211 2862574272 Streptomyces sp. AcE210 Isolate Nodule
212 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
213 2867369537 Streptomyces sp. Z26 Isolate Unclassified
214 2867428634 Streptomyces sp. RP5T Isolate Unclassified
215 2867475112 Streptomyces sp. TM32 Isolate Unclassified
216 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
217 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
218 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
219 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
220 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
221 2891562705 Microbispora tritici MT50 Isolate Unclassified
222 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
223 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
224 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
225 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
226 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
227 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
228 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
229 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
230 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
231 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
232 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
233 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
234 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
235 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
236 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
237 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
238 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
239 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
240 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
241 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
242 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
243 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
244 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
245 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
246 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
247 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
248 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
249 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
250 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
251 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
252 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
253 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
254 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
255 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
256 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
257 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
258 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
259 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
260 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
261 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
262 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
263 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
264 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
265 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.13
Metatranscriptomes 0.78
Isolates 24.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.07
Nodule 0.52
Rhizoplane 1.3
Rhizosphere 79.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400488_49889 3300038741 Bacteria 10795
2 JGI24739J22299_10015915 3300001989 Bacteria 2729
3 JGI24739J22299_10018718 3300001989 Bacteria 2486
4 JGI25160J50197_1014865 3300003354 Bacteria 2580
5 Ga0006562J51391_1031748 3300003578 Bacteria 1590
6 Ga0006562J51391_1031749 3300003578 Bacteria 1665
7 Ga0006562J51391_1095072 3300003578 Bacteria 3700
8 Ga0070658_10216222 3300005327 Bacteria 1620
9 Ga0070714_100010164 3300005435 Bacteria 7427
10 Ga0070708_100023458 3300005445 Bacteria 5248
11 Ga0070679_100096626 3300005530 Bacteria 2942
12 Ga0070679_100115947 3300005530 Bacteria 2663
13 Ga0081539_10001917 3300005985 Bacteria 32201
14 Ga0105250_10021939 3300009092 Bacteria 2576
15 Ga0105240_10013320 3300009093 Bacteria 11302
16 Ga0105243_10067092 3300009148 Bacteria 2887
17 Ga0157370_10004912 3300013104 Bacteria 15148
18 Ga0157369_10014171 3300013105 Bacteria 9007
19 Ga0157369_10066426 3300013105 Bacteria 3880
20 Ga0163162_10024734 3300013306 Bacteria 5931
21 Ga0182008_10014685 3300014497 Bacteria 4095
22 Ga0182007_10001033 3300015262 Bacteria 15217
23 Ga0183367_1008 3300015688 Bacteria 490626
24 Ga0163161_10097107 3300017792 Bacteria 2188
25 Ga0209758_1019241 3300025297 Bacteria 3302
26 Ga0207426_1002142 3300025302 Bacteria 13473
27 Ga0207426_1004059 3300025302 Bacteria 7398
28 Ga0207426_1006202 3300025302 Bacteria 5254
29 Ga0207647_10007957 3300025904 Bacteria 7621
30 Ga0207684_10028238 3300025910 Bacteria 4779
31 Ga0207695_10045010 3300025913 Bacteria 4689
32 Ga0207652_10193247 3300025921 Bacteria 1830
33 Ga0207664_10026514 3300025929 Bacteria 4382
34 Ga0207709_10035190 3300025935 Bacteria 2959
35 Ga0207661_10198952 3300025944 Bacteria 1761
36 Ga0207667_10060107 3300025949 Bacteria 3978
37 Ga0207667_10163948 3300025949 Bacteria 2285
38 Ga0265336_10001711 3300028666 Bacteria 9654
39 Ga0307517_10075927 3300028786 Bacteria 2941
40 Ga0307515_10006510 3300028794 Bacteria 23364
41 Ga0265338_10001250 3300028800 Bacteria 41890
42 Ga0307511_10000678 3300030521 Bacteria 36277
43 Ga0307511_10055840 3300030521 Bacteria 3095
44 Ga0307512_10069272 3300030522 Bacteria 2638
45 Ga0307513_10010619 3300031456 Bacteria 11522
46 Ga0307513_10259083 3300031456 Bacteria 1530
47 Ga0307509_10014615 3300031507 Bacteria 9219
48 Ga0307509_10097080 3300031507 Bacteria 2996
49 Ga0307508_10029408 3300031616 Bacteria 4967
50 Ga0307508_10057800 3300031616 Bacteria 3432
51 Ga0307508_10071305 3300031616 Bacteria 3048
52 Ga0316575_10021611 3300031665 Bacteria 2478
53 Ga0316579_10000898 3300031691 Bacteria 10329
54 Ga0316579_10022420 3300031691 Bacteria 2823
55 Ga0316576_10193827 3300031727 Bacteria 1531
56 Ga0307516_10005221 3300031730 Bacteria 15640
57 Ga0316577_10016792 3300031733 Bacteria 4038
58 Ga0316577_10034625 3300031733 Bacteria 2822
59 Ga0307518_10098164 3300031838 Bacteria 2100
60 Ga0307518_10169298 3300031838 Bacteria 1491
61 Ga0316580_10012786 3300032139 Bacteria 2558
62 Ga0307507_10048441 3300033179 Bacteria 4134
63 Ga0307510_10047941 3300033180 Bacteria 4565
64 Ga0307510_10063471 3300033180 Bacteria 3762
65 Ga0307510_10106571 3300033180 Bacteria 2565
66 Ga0307510_10126089 3300033180 Bacteria 2249
67 Ga0316574_0021386 3300035398 Bacteria 3840
68 Ga0316574_0110863 3300035398 Bacteria 1759
69 Ga0316582_0051396 3300036647 Bacteria 2615
70 Ga0395898_0005703 3300037466 Bacteria 13413
71 Ga0395898_0007305 3300037466 Bacteria 11728
72 Ga0395901_0085329 3300038443 Bacteria 3301
73 Ga0400485_19226 3300038735 Bacteria 11624
74 Ga0400486_29975 3300038742 Bacteria 11815
75 Ga0439436_0026974 3300041404 Bacteria 1682
76 Ga0439439_0007695 3300041406 Bacteria 2524
77 Ga0439439_0019798 3300041406 Bacteria 1672
78 Ga0451837_1811269 3300041494 Bacteria 3482
79 Ga0439433_0004033 3300041999 Bacteria 3158
80 Ga0439449_0007964 3300042007 Bacteria 4026
81 Ga0439455_0002096 3300042012 Bacteria 3552
82 Ga0439457_001647 3300042014 Bacteria 6651
83 Ga0439462_0021881 3300042015 Bacteria 1672
84 Ga0450895_000384 3300042132 Bacteria 2453
85 Ga0450896_000418 3300042133 Bacteria 4314
86 Ga0450898_006537 3300042134 Bacteria 1793
87 Ga0450903_000183 3300042138 Bacteria 13862
88 Ga0450906_000873 3300042145 Bacteria 6622
89 Ga0439458_0003051 3300042157 Bacteria 3991
90 Ga0466969_0014522 3300044656 Bacteria 4140
91 Ga0466972_0010450 3300044658 Bacteria 4662
92 Ga0466972_0011563 3300044658 Bacteria 4432
93 Ga0466972_0013151 3300044658 Bacteria 4157
94 Ga0466965_0033236 3300044683 Bacteria 2520
95 Ga0466965_0059058 3300044683 Bacteria 1913
96 Ga0466965_0097089 3300044683 Bacteria 1504
97 Ga0466966_0004869 3300044684 Bacteria 8831
98 Ga0466966_0034427 3300044684 Bacteria 3274
99 Ga0466961_0044961 3300044693 Bacteria 2825
100 Ga0466961_0135000 3300044693 Bacteria 1546
101 Ga0466963_0000277 3300044694 Bacteria 22841
102 Ga0466963_0000404 3300044694 Bacteria 19724
103 Ga0466964_0007040 3300044706 Bacteria 4208
104 Ga0466971_0006722 3300044719 Bacteria 5004
105 Ga0466970_0001400 3300044765 Bacteria 11649
106 Ga0466957_0000940 3300044842 Bacteria 14902
107 Ga0466960_0003726 3300044901 Bacteria 5894
108 Ga0466959_0004593 3300045049 Bacteria 9269
109 Ga0466959_0006114 3300045049 Bacteria 8314
110 Ga0466959_0045399 3300045049 Bacteria 3235
111 Ga0466958_0004671 3300045836 Bacteria 7268
112 Ga0466967_0001066 3300045976 Bacteria 15136
113 Ga0466967_0012576 3300045976 Bacteria 6485
114 Ga0466967_0181308 3300045976 Bacteria 1986
115 Ga0495627_017381 3300046453 Bacteria 2445
116 Ga0495627_037849 3300046453 Bacteria 1495
117 Ga0495592_0011151 3300046454 Bacteria 6788
118 Ga0495592_0014927 3300046454 Bacteria 5896
119 Ga0495603_0002960 3300046455 Bacteria 10047
120 Ga0495603_0007885 3300046455 Bacteria 6422
121 Ga0495603_0035889 3300046455 Bacteria 2977
122 Ga0495603_0114112 3300046455 Bacteria 1575
123 Ga0495590_0026835 3300046457 Bacteria 2021
124 Ga0495629_0007636 3300046459 Bacteria 7961
125 Ga0495629_0008217 3300046459 Bacteria 7673
126 Ga0495629_0045139 3300046459 Bacteria 3092
127 Ga0495629_0050962 3300046459 Bacteria 2898
128 Ga0495629_0063751 3300046459 Bacteria 2573
129 Ga0495629_0120433 3300046459 Bacteria 1828
130 Ga0495651_0015551 3300046462 Bacteria 5888
131 Ga0495653_0012792 3300046463 Bacteria 6851
132 Ga0495653_0024656 3300046463 Bacteria 4842
133 Ga0495582_0018974 3300046473 Bacteria 3763
134 Ga0495605_0017136 3300046474 Bacteria 3909
135 Ga0495662_0001873 3300046476 Bacteria 10531
136 Ga0495662_0007339 3300046476 Bacteria 5451
137 Ga0495664_0008510 3300046477 Bacteria 5720
138 Ga0495664_0017261 3300046477 Bacteria 4125
139 Ga0495584_0037334 3300046491 Bacteria 2455
140 Ga0495594_0000230 3300046499 Bacteria 27077
141 Ga0495594_0008766 3300046499 Bacteria 5214
142 Ga0495583_0014872 3300046506 Bacteria 4261
143 Ga0495606_0002627 3300046507 Bacteria 20492
144 Ga0495608_0006339 3300046511 Bacteria 8394
145 Ga0495608_0032772 3300046511 Bacteria 3512
146 Ga0495610_0034865 3300046512 Bacteria 2588
147 Ga0495620_0013159 3300046515 Bacteria 4245
148 Ga0495620_0019555 3300046515 Bacteria 3327
149 Ga0495628_0002613 3300046516 Bacteria 16167
150 Ga0495628_0018569 3300046516 Bacteria 5758
151 Ga0495630_0007982 3300046517 Bacteria 7599
152 Ga0495630_0109525 3300046517 Bacteria 2092
153 Ga0495631_0001549 3300046518 Bacteria 13832
154 Ga0495631_0048340 3300046518 Bacteria 1866
155 Ga0495666_0000236 3300046526 Bacteria 23671
156 Ga0495666_0029730 3300046526 Bacteria 2687
157 Ga0495666_0061055 3300046526 Bacteria 1801
158 Ga0495652_0045574 3300046529 Bacteria 3768
159 Ga0495652_0056078 3300046529 Bacteria 3348
160 Ga0495652_0068160 3300046529 Bacteria 2981
161 Ga0495665_0006437 3300046531 Bacteria 6341
162 Ga0495640_0019957 3300046533 Bacteria 4942
163 Ga0495586_0021807 3300046535 Bacteria 3418
164 Ga0495587_0015143 3300046536 Bacteria 4819
165 Ga0495587_0061952 3300046536 Bacteria 2191
166 Ga0495597_0017277 3300046542 Bacteria 3398
167 Ga0495645_0015089 3300046543 Bacteria 5490
168 Ga0495645_0024576 3300046543 Bacteria 4372
169 Ga0495645_0135439 3300046543 Bacteria 1723
170 Ga0495645_0189630 3300046543 Bacteria 1402
171 Ga0495622_0001355 3300046557 Bacteria 12516
172 Ga0495622_0044657 3300046557 Bacteria 2059
173 Ga0495622_0079454 3300046557 Bacteria 1509
174 Ga0495633_0013472 3300046558 Bacteria 4308
175 Ga0495667_0001508 3300046559 Bacteria 15358
176 Ga0495667_0156646 3300046559 Bacteria 1466
177 Ga0495668_0062569 3300046616 Bacteria 2050
178 Ga0495668_0114223 3300046616 Bacteria 1477
179 Ga0495634_0007640 3300046642 Bacteria 8098
180 Ga0495634_0033331 3300046642 Bacteria 3539
181 Ga0495634_0053419 3300046642 Bacteria 2706
182 Ga0495611_0035113 3300046648 Bacteria 2219
183 Ga0495611_0074627 3300046648 Bacteria 1553
184 Ga0495625_0007913 3300046660 Bacteria 9144
185 Ga0495635_0007040 3300046663 Bacteria 7858
186 Ga0495635_0024337 3300046663 Bacteria 4220
187 Ga0495588_0002634 3300046674 Bacteria 7687
188 Ga0495588_0031817 3300046674 Bacteria 2657
189 Ga0495588_0073784 3300046674 Bacteria 1777
190 Ga0495657_0016249 3300046675 Bacteria 5425
191 Ga0495599_0002709 3300046678 Bacteria 10335
192 Ga0495623_0007247 3300046679 Bacteria 7197
193 Ga0495623_0146074 3300046679 Bacteria 1402
194 Ga0495646_0003333 3300046680 Bacteria 9987
195 Ga0495646_0025905 3300046680 Bacteria 3683
196 Ga0495646_0102424 3300046680 Bacteria 1640
197 Ga0495658_0015737 3300046683 Bacteria 3884
198 Ga0495613_0000765 3300046689 Bacteria 25123
199 Ga0495613_0002591 3300046689 Bacteria 13587
200 Ga0495613_0005919 3300046689 Bacteria 9153
201 Ga0495613_0006567 3300046689 Bacteria 8696
202 Ga0495613_0071304 3300046689 Bacteria 2533
203 Ga0495624_0104192 3300046690 Bacteria 1746
204 Ga0495671_0003664 3300046692 Bacteria 9359
205 Ga0495649_0018660 3300046694 Bacteria 3899
206 Ga0495649_0038352 3300046694 Bacteria 2629
207 Ga0495589_0014400 3300046794 Bacteria 4073
208 Ga0495589_0016403 3300046794 Bacteria 3808
209 Ga0495600_0021409 3300046809 Bacteria 4140
210 Ga0495660_0031226 3300046810 Bacteria 2995
211 Ga0495581_0013553 3300047315 Bacteria 4728
212 Ga0495604_0004135 3300047317 Bacteria 11521
213 Ga0495604_0004664 3300047317 Bacteria 10867
214 Ga0495604_0005785 3300047317 Bacteria 9809
215 Ga0495604_0046585 3300047317 Bacteria 3380
216 Ga0495636_0002673 3300047318 Bacteria 6883
217 Ga0495636_0012519 3300047318 Bacteria 3359
218 Ga0495636_0039847 3300047318 Bacteria 1946
219 Ga0495674_0032566 3300047319 Bacteria 4727
220 Ga0495674_0132668 3300047319 Bacteria 2098
221 Ga0495672_0044387 3300047320 Bacteria 2667
222 Ga0495676_0002298 3300047321 Bacteria 16968
223 Ga0495676_0004244 3300047321 Bacteria 13082
224 Ga0495676_0025098 3300047321 Bacteria 5149
225 Ga0495676_0055201 3300047321 Bacteria 3151
226 Ga0495680_0007785 3300047322 Bacteria 9782
227 Ga0495683_0052220 3300047323 Bacteria 2041
228 Ga0495687_002091 3300047443 Bacteria 16779
229 Ga0495687_004497 3300047443 Bacteria 9378
230 Ga0495675_0002341 3300047444 Bacteria 11309
231 Ga0495675_0023781 3300047444 Bacteria 3904
232 Ga0495685_001478 3300047447 Bacteria 7203
233 Ga0495685_006810 3300047447 Bacteria 3757
234 Ga0495685_007866 3300047447 Bacteria 3529
235 Ga0495685_013247 3300047447 Bacteria 2797
236 Ga0495685_023037 3300047447 Bacteria 2143
237 Ga0495681_0006593 3300047470 Bacteria 7603
238 Ga0495684_0020825 3300047471 Bacteria 5053
239 Ga0495686_0069694 3300047472 Bacteria 2167
240 Ga0495593_0000936 3300047673 Bacteria 17005
241 Ga0495593_0010918 3300047673 Bacteria 5232
242 Ga0495593_0052327 3300047673 Bacteria 2158
243 Ga0495602_0049370 3300048088 Bacteria 3769
244 Ga0495614_0001871 3300048089 Bacteria 9227
245 Ga0495614_0001978 3300048089 Bacteria 9006
246 Ga0495614_0007236 3300048089 Bacteria 4944
247 Ga0495614_0030808 3300048089 Bacteria 2309
248 Ga0496105_0018297 3300048908 Bacteria 5628
249 Ga0496109_0012902 3300048912 Bacteria 7225
250 Ga0496114_0047175 3300048917 Bacteria 3582
251 Ga0496114_0247041 3300048917 Bacteria 1570
252 Ga0495678_023222 3300049459 Bacteria 2700
253 Ga0501031_0050618 3300049568 Bacteria 2706
254 Ga0501031_0052612 3300049568 Bacteria 2653
255 Ga0501032_0047635 3300049569 Bacteria 2894
256 Ga0501033_0039362 3300049570 Bacteria 3531
257 Ga0501034_0009173 3300049571 Bacteria 10378
258 Ga0501034_0033208 3300049571 Bacteria 5237
259 Ga0501034_0083688 3300049571 Bacteria 3192
260 Ga0501034_0138697 3300049571 Bacteria 2412
261 Ga0501034_0248819 3300049571 Bacteria 1722
262 Ga0501036_0008450 3300049572 Bacteria 8436
263 Ga0501036_0239921 3300049572 Bacteria 1520
264 Ga0501037_0077539 3300049573 Bacteria 2411
265 Ga0501037_0099656 3300049573 Bacteria 2098
266 Ga0501037_0127274 3300049573 Bacteria 1828
267 Ga0501038_0000303 3300049574 Bacteria 41854
268 Ga0501039_0027323 3300049575 Bacteria 4388
269 Ga0501039_0136344 3300049575 Bacteria 1927
270 Ga0501043_0008745 3300049579 Bacteria 7971
271 Ga0501043_0026940 3300049579 Bacteria 4510
272 Ga0501043_0065395 3300049579 Bacteria 2855
273 Ga0501043_0176482 3300049579 Bacteria 1665
274 Ga0501046_0003787 3300049580 Bacteria 13845
275 Ga0501046_0047016 3300049580 Bacteria 3423
276 Ga0501047_0000083 3300049581 Bacteria 121172
277 Ga0501047_0113191 3300049581 Bacteria 2595
278 Ga0501047_0181451 3300049581 Bacteria 1971
279 Ga0501048_0012159 3300049582 Bacteria 6413
280 Ga0501048_0239255 3300049582 Bacteria 1288
281 Ga0501070_0001534 3300049586 Bacteria 20554
282 Ga0501070_0205333 3300049586 Bacteria 1618
283 Ga0501070_0291964 3300049586 Bacteria 1329
284 Ga0501083_0181593 3300049744 Bacteria 1374
285 Ga0501035_0011075 3300049822 Bacteria 8351
286 Ga0501035_0058524 3300049822 Bacteria 3433
287 Ga0501044_0058986 3300049823 Bacteria 3933
288 Ga0501044_0082401 3300049823 Bacteria 3255
289 Ga0501044_0159029 3300049823 Bacteria 2237
290 nmdc:mga06z11_18736_c1 3300050494 Bacteria 3168
291 Ga0500644_0036561 3300053088 Bacteria 1599
292 Ga0500616_0001913 3300053153 Bacteria 18601
293 Ga0466962_0012630 3300061719 Bacteria 4063
294 2515852435 2515154155 Bacteria 7985436
295 2547412464 2547132111 Bacteria 8013147
296 2554257377 2554235005 Bacteria 6457341
297 2585300303 2582581312 Bacteria 7308206
298 2585310648 2582581313 Bacteria 10042643
299 2585314415 2582581314 Bacteria 11452267
300 2616700216 2616644814 Bacteria 11555299
301 2616905267 2616644941 Bacteria 8510691
302 2643763002 2643221548 Bacteria 8053412
303 2643899948 2643221578 Bacteria 9213798
304 2643947766 2643221587 Bacteria 7586415
305 2644263011 2643221647 Bacteria 10741251
306 2644390800 2643221670 Bacteria 6497041
307 2644405829 2643221673 Bacteria 9196637
308 2644433631 2643221677 Bacteria 7584031
309 2644443229 2643221678 Bacteria 9540101
310 2644464140 2643221682 Bacteria 6743283
311 2644607914 2643221711 Bacteria 4865335
312 2644626960 2643221714 Bacteria 9015452
313 2768642749 2767802112 Bacteria 6465194
314 2784588888 2784132148 Bacteria 8627943
315 2785342999 2784746763 Bacteria 9783172
316 2785369828 2784746768 Bacteria 10036182
317 2786670917 2786546132 Bacteria 10419719
318 2793979717 2791355406 Bacteria 11364898
319 2808842332 2808606359 Bacteria 9866990
320 2808920856 2808606375 Bacteria 9466072
321 2809232504 2808606448 Bacteria 8656184
322 2812357783 2811994879 Bacteria 9313447
323 2812480256 2811994917 Bacteria 7761064
324 2819697176 2818991463 Bacteria 7948711
325 2819741640 2818991472 Bacteria 10089953
326 2852637092 2852635781 Bacteria 8251373
327 2856747155 2856741275 Bacteria 8096094
328 2862183414 2862178590 Bacteria 8583590
329 2862285950 2862281513 Bacteria 9621493
330 2862291276 2862290372 Bacteria 7471434
331 2862508003 2862507626 Bacteria 9425308
332 2862578961 2862574272 Bacteria 10567477
333 2863404261 2863404153 Bacteria 9672205
334 2867372225 2867369537 Bacteria 6501581
335 2867437733 2867428634 Bacteria 9590268
336 2867476930 2867475112 Bacteria 6909112
337 2873155447 2873151551 Bacteria 8625867
338 2875395382 2875391855 Bacteria 7600475
339 2877680811 2877676314 Bacteria 9512378
340 2891402346 2891395885 Bacteria 9251614
341 2891556217 2891554331 Bacteria 8812224
342 2891562896 2891562705 Bacteria 8039471
343 2912719621 2912715099 Bacteria 9460473
344 2912731315 2912723979 Bacteria 8557534
345 2912761094 2912757875 Bacteria 7940295
346 2918505290 2918501144 Bacteria 8668083
347 2935390936 2935390628 Bacteria 7043367
348 2946049699 2946045630 Bacteria 8527308
349 2946068083 2946064051 Bacteria 8957905
350 2946076185 2946072368 Bacteria 8999607
351 2947228853 2947224130 Bacteria 9938529
352 2954006679 2954002825 Bacteria 9173742
353 2954385910 2954380949 Bacteria 10050426
354 2954677243 2954673503 Bacteria 9685905
355 2954686912 2954682443 Bacteria 9862841
356 2954696561 2954691527 Bacteria 10720516
357 2954705663 2954701450 Bacteria 10834262
358 2954715921 2954711539 Bacteria 10867210
359 2954725860 2954721474 Bacteria 10456478
360 2954735938 2954731030 Bacteria 10243860
361 2954744798 2954740390 Bacteria 10229294
362 2954754801 2954749733 Bacteria 10366972
363 2954763783 2954759201 Bacteria 9358192
364 2966601972 2966598605 Bacteria 7676064
365 2990065666 2990059506 Bacteria 9321252
366 2990093040 2990088156 Bacteria 6657676
367 2995468975 2995463766 Bacteria 8577691
368 2997454696 2997451912 Bacteria 8492419
369 2997604418 2997600082 Bacteria 9896405
370 3006491693 3006486233 Bacteria 8157040
371 3006499279 3006493962 Bacteria 8825450
372 8008566952 8008558824 Bacteria 10610750
373 8008578625 8008574985 Bacteria 7815457
374 8023629419 8023623736 Bacteria 8593882
375 8025478867 8025478263 Bacteria 8209203
376 8025536372 8025530807 Bacteria 8495698
377 8047897324 8047893842 Bacteria 11723082
378 8048128237 8048127548 Bacteria 11053136
379 8048361620 8048356638 Bacteria 11044339
380 8048374312 8048369669 Bacteria 11666822
381 8048383911 8048379754 Bacteria 11877923
382 8048407189 8048406513 Bacteria 8936924
383 8054162977 8054160619 Bacteria 7783213
384 8056451905 8056447290 Bacteria 7680491
385 8056672374 8056667051 Bacteria 6953971
386 8056833378 8056829672 Bacteria 9045328
387 Ga0400488_49889
388 JGI24739J22299_10015915
389 JGI24739J22299_10018718
390 JGI25160J50197_1014865
391 Ga0006562J51391_1031748
392 Ga0006562J51391_1031749
393 Ga0006562J51391_1095072
394 Ga0070658_10216222
395 Ga0070714_100010164
396 Ga0070708_100023458
397 Ga0070679_100096626
398 Ga0070679_100115947
399 Ga0081539_10001917
400 Ga0105250_10021939
401 Ga0105240_10013320
402 Ga0105243_10067092
403 Ga0157370_10004912
404 Ga0157369_10014171
405 Ga0157369_10066426
406 Ga0163162_10024734
407 Ga0182008_10014685
408 Ga0182007_10001033
409 Ga0183367_1008
410 Ga0163161_10097107
411 Ga0209758_1019241
412 Ga0207426_1002142
413 Ga0207426_1004059
414 Ga0207426_1006202
415 Ga0207647_10007957
416 Ga0207684_10028238
417 Ga0207695_10045010
418 Ga0207652_10193247
419 Ga0207664_10026514
420 Ga0207709_10035190
421 Ga0207661_10198952
422 Ga0207667_10060107
423 Ga0207667_10163948
424 Ga0265336_10001711
425 Ga0307517_10075927
426 Ga0307515_10006510
427 Ga0265338_10001250
428 Ga0307511_10000678
429 Ga0307511_10055840
430 Ga0307512_10069272
431 Ga0307513_10010619
432 Ga0307513_10259083
433 Ga0307509_10014615
434 Ga0307509_10097080
435 Ga0307508_10029408
436 Ga0307508_10057800
437 Ga0307508_10071305
438 Ga0316575_10021611
439 Ga0316579_10000898
440 Ga0316579_10022420
441 Ga0316576_10193827
442 Ga0307516_10005221
443 Ga0316577_10016792
444 Ga0316577_10034625
445 Ga0307518_10098164
446 Ga0307518_10169298
447 Ga0316580_10012786
448 Ga0307507_10048441
449 Ga0307510_10047941
450 Ga0307510_10063471
451 Ga0307510_10106571
452 Ga0307510_10126089
453 Ga0316574_0021386
454 Ga0316574_0110863
455 Ga0316582_0051396
456 Ga0395898_0005703
457 Ga0395898_0007305
458 Ga0395901_0085329
459 Ga0400485_19226
460 Ga0400486_29975
461 Ga0439436_0026974
462 Ga0439439_0007695
463 Ga0439439_0019798
464 Ga0451837_1811269
465 Ga0439433_0004033
466 Ga0439449_0007964
467 Ga0439455_0002096
468 Ga0439457_001647
469 Ga0439462_0021881
470 Ga0450895_000384
471 Ga0450896_000418
472 Ga0450898_006537
473 Ga0450903_000183
474 Ga0450906_000873
475 Ga0439458_0003051
476 Ga0466969_0014522
477 Ga0466972_0010450
478 Ga0466972_0011563
479 Ga0466972_0013151
480 Ga0466965_0033236
481 Ga0466965_0059058
482 Ga0466965_0097089
483 Ga0466966_0004869
484 Ga0466966_0034427
485 Ga0466961_0044961
486 Ga0466961_0135000
487 Ga0466963_0000277
488 Ga0466963_0000404
489 Ga0466964_0007040
490 Ga0466971_0006722
491 Ga0466970_0001400
492 Ga0466957_0000940
493 Ga0466960_0003726
494 Ga0466959_0004593
495 Ga0466959_0006114
496 Ga0466959_0045399
497 Ga0466958_0004671
498 Ga0466967_0001066
499 Ga0466967_0012576
500 Ga0466967_0181308
501 Ga0495627_017381
502 Ga0495627_037849
503 Ga0495592_0011151
504 Ga0495592_0014927
505 Ga0495603_0002960
506 Ga0495603_0007885
507 Ga0495603_0035889
508 Ga0495603_0114112
509 Ga0495590_0026835
510 Ga0495629_0007636
511 Ga0495629_0008217
512 Ga0495629_0045139
513 Ga0495629_0050962
514 Ga0495629_0063751
515 Ga0495629_0120433
516 Ga0495651_0015551
517 Ga0495653_0012792
518 Ga0495653_0024656
519 Ga0495582_0018974
520 Ga0495605_0017136
521 Ga0495662_0001873
522 Ga0495662_0007339
523 Ga0495664_0008510
524 Ga0495664_0017261
525 Ga0495584_0037334
526 Ga0495594_0000230
527 Ga0495594_0008766
528 Ga0495583_0014872
529 Ga0495606_0002627
530 Ga0495608_0006339
531 Ga0495608_0032772
532 Ga0495610_0034865
533 Ga0495620_0013159
534 Ga0495620_0019555
535 Ga0495628_0002613
536 Ga0495628_0018569
537 Ga0495630_0007982
538 Ga0495630_0109525
539 Ga0495631_0001549
540 Ga0495631_0048340
541 Ga0495666_0000236
542 Ga0495666_0029730
543 Ga0495666_0061055
544 Ga0495652_0045574
545 Ga0495652_0056078
546 Ga0495652_0068160
547 Ga0495665_0006437
548 Ga0495640_0019957
549 Ga0495586_0021807
550 Ga0495587_0015143
551 Ga0495587_0061952
552 Ga0495597_0017277
553 Ga0495645_0015089
554 Ga0495645_0024576
555 Ga0495645_0135439
556 Ga0495645_0189630
557 Ga0495622_0001355
558 Ga0495622_0044657
559 Ga0495622_0079454
560 Ga0495633_0013472
561 Ga0495667_0001508
562 Ga0495667_0156646
563 Ga0495668_0062569
564 Ga0495668_0114223
565 Ga0495634_0007640
566 Ga0495634_0033331
567 Ga0495634_0053419
568 Ga0495611_0035113
569 Ga0495611_0074627
570 Ga0495625_0007913
571 Ga0495635_0007040
572 Ga0495635_0024337
573 Ga0495588_0002634
574 Ga0495588_0031817
575 Ga0495588_0073784
576 Ga0495657_0016249
577 Ga0495599_0002709
578 Ga0495623_0007247
579 Ga0495623_0146074
580 Ga0495646_0003333
581 Ga0495646_0025905
582 Ga0495646_0102424
583 Ga0495658_0015737
584 Ga0495613_0000765
585 Ga0495613_0002591
586 Ga0495613_0005919
587 Ga0495613_0006567
588 Ga0495613_0071304
589 Ga0495624_0104192
590 Ga0495671_0003664
591 Ga0495649_0018660
592 Ga0495649_0038352
593 Ga0495589_0014400
594 Ga0495589_0016403
595 Ga0495600_0021409
596 Ga0495660_0031226
597 Ga0495581_0013553
598 Ga0495604_0004135
599 Ga0495604_0004664
600 Ga0495604_0005785
601 Ga0495604_0046585
602 Ga0495636_0002673
603 Ga0495636_0012519
604 Ga0495636_0039847
605 Ga0495674_0032566
606 Ga0495674_0132668
607 Ga0495672_0044387
608 Ga0495676_0002298
609 Ga0495676_0004244
610 Ga0495676_0025098
611 Ga0495676_0055201
612 Ga0495680_0007785
613 Ga0495683_0052220
614 Ga0495687_002091
615 Ga0495687_004497
616 Ga0495675_0002341
617 Ga0495675_0023781
618 Ga0495685_001478
619 Ga0495685_006810
620 Ga0495685_007866
621 Ga0495685_013247
622 Ga0495685_023037
623 Ga0495681_0006593
624 Ga0495684_0020825
625 Ga0495686_0069694
626 Ga0495593_0000936
627 Ga0495593_0010918
628 Ga0495593_0052327
629 Ga0495602_0049370
630 Ga0495614_0001871
631 Ga0495614_0001978
632 Ga0495614_0007236
633 Ga0495614_0030808
634 Ga0496105_0018297
635 Ga0496109_0012902
636 Ga0496114_0047175
637 Ga0496114_0247041
638 Ga0495678_023222
639 Ga0501031_0050618
640 Ga0501031_0052612
641 Ga0501032_0047635
642 Ga0501033_0039362
643 Ga0501034_0009173
644 Ga0501034_0033208
645 Ga0501034_0083688
646 Ga0501034_0138697
647 Ga0501034_0248819
648 Ga0501036_0008450
649 Ga0501036_0239921
650 Ga0501037_0077539
651 Ga0501037_0099656
652 Ga0501037_0127274
653 Ga0501038_0000303
654 Ga0501039_0027323
655 Ga0501039_0136344
656 Ga0501043_0008745
657 Ga0501043_0026940
658 Ga0501043_0065395
659 Ga0501043_0176482
660 Ga0501046_0003787
661 Ga0501046_0047016
662 Ga0501047_0000083
663 Ga0501047_0113191
664 Ga0501047_0181451
665 Ga0501048_0012159
666 Ga0501048_0239255
667 Ga0501070_0001534
668 Ga0501070_0205333
669 Ga0501070_0291964
670 Ga0501083_0181593
671 Ga0501035_0011075
672 Ga0501035_0058524
673 Ga0501044_0058986
674 Ga0501044_0082401
675 Ga0501044_0159029
676 nmdc:mga06z11_18736_c1
677 Ga0500644_0036561
678 Ga0500616_0001913
679 Ga0466962_0012630
680 2515852435
681 2547412464
682 2554257377
683 2585300303
684 2585310648
685 2585314415
686 2616700216
687 2616905267
688 2643763002
689 2643899948
690 2643947766
691 2644263011
692 2644390800
693 2644405829
694 2644433631
695 2644443229
696 2644464140
697 2644607914
698 2644626960
699 2768642749
700 2784588888
701 2785342999
702 2785369828
703 2786670917
704 2793979717
705 2808842332
706 2808920856
707 2809232504
708 2812357783
709 2812480256
710 2819697176
711 2819741640
712 2852637092
713 2856747155
714 2862183414
715 2862285950
716 2862291276
717 2862508003
718 2862578961
719 2863404261
720 2867372225
721 2867437733
722 2867476930
723 2873155447
724 2875395382
725 2877680811
726 2891402346
727 2891556217
728 2891562896
729 2912719621
730 2912731315
731 2912761094
732 2918505290
733 2935390936
734 2946049699
735 2946068083
736 2946076185
737 2947228853
738 2954006679
739 2954385910
740 2954677243
741 2954686912
742 2954696561
743 2954705663
744 2954715921
745 2954725860
746 2954735938
747 2954744798
748 2954754801
749 2954763783
750 2966601972
751 2990065666
752 2990093040
753 2995468975
754 2997454696
755 2997604418
756 3006491693
757 3006499279
758 8008566952
759 8008578625
760 8023629419
761 8025478867
762 8025536372
763 8047897324
764 8048128237
765 8048361620
766 8048374312
767 8048383911
768 8048407189
769 8054162977
770 8056451905
771 8056672374
772 8056833378

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01071

GARS_A

Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain

81

268

0.98

PF02843

GARS_C

Phosphoribosylglycinamide synthetase, C domain

304

396

0.96

PF02844

GARS_N

Phosphoribosylglycinamide synthetase, N domain

4

56

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lp8-assembly1.cif.gz_A crystal structure of phosphoribosylamine-glycine ligase from ehrlichia chaffeensis 0.9604 1 409
2yw2-assembly1.cif.gz_A crystal structure of gar synthetase from aquifex aeolicus in complex with atp 0.9421 1 417
3lp8-assembly1.cif.gz_A crystal structure of phosphoribosylamine-glycine ligase from ehrlichia chaffeensis 0.9402 1 409
2yw2-assembly1.cif.gz_A crystal structure of gar synthetase from aquifex aeolicus in complex with atp 0.9399 1 417
2xd4-assembly1.cif.gz_A nucleotide-bound structures of bacillus subtilis glycinamide ribonucleotide synthetase 0.9332 1 415
ID Description Score Start End Superfamily
af_P9WHM9_188_326_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9843 179 315 3.30.470.20
af_P9WHM9_2_93_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.983 2 92 3.40.50.20
3lp8A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9679 2 93 3.40.50.20
af_P9WHM9_188_326_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9635 179 315 3.30.470.20
af_P22102_333_434_3.90.600.10 Alpha Beta;Alpha-Beta Complex;Glycinamide Ribonucleotide Synthetase; Chain A, domain 4;Phosphoribosylglycinamide synthetase, C-terminal domain 0.9622 319 413 3.90.600.10
ID Description Score Start End GO Terms
AF-A0A6B3HMF0-F1-model_v4 Phosphoribosylamine--glycine ligase 1.003 1 88 GO:0004637
GO:0009113
AF-A0A6B3GFZ4-F1-model_v4 Glycinamide ribonucleotide synthetase (Phosphoribosylglycinamide synthetase) 0.9952 272 415 GO:0000166
GO:0004637
GO:0009113
AF-A0A6B3HMF0-F1-model_v4 Phosphoribosylamine--glycine ligase 0.9916 1 88 GO:0004637
GO:0009113
AF-A0A543CL16-F1-model_v4 Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) 0.986 1 412 GO:0004637
GO:0005524
GO:0006189
GO:0009113
GO:0046872
AF-A0A6B3EJ26-F1-model_v4 Phosphoribosylamine--glycine ligase 0.9852 12 118 GO:0004637
GO:0009113

Map