F430574

General Info

Members Datasets Scaffolds Average Seq Length
386 251 364 264

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1157350|Ga0436364_1157350_3971_4843
Length 290
Sequence VYPSTNSPFEEEHQMSAPTASRAESGVFSPTRARIAQKTLRTDKWWLPPLITDLGLSAFILYAGTRSLLQSNYWVDKYHYLTPFYSPCVSESCVPGSSHFGQWLPHFPWXIPLGGLVLPFLLGFRLTCYYYRKAYYRSVWQSPSACAVAEPRVHYTGETRLPLILQNSHRYFFYVALVVSLINTYDAIMAFHSDTGPHGFGFGLGNLILTTNVVLLWAYTLSCHSCRHVTGGRLKHFSKHPVRYWIWTQVSKLNTRHMLFAWVTLGTLALTDLYVALVSSGAITDPRFVG

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
3 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
4 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
5 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
6 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
7 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
8 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
9 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
10 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
11 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
12 2855683550 Micromonospora sp. RP3T Isolate Unclassified
13 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
14 2858868258 Micromonospora sp. MH33 Isolate Unclassified
15 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
16 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
17 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
18 2902582711 Micromonospora sp. AP08 Isolate Unclassified
19 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
20 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
21 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
158 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
178 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
191 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
192 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
193 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
194 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
195 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
196 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
246 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
247 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
248 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
251 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.01
Metatranscriptomes 1.3
Isolates 5.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 0
Rhizoplane 6.74
Rhizosphere 84.72
Stem 0
Stem Tuber 0
Unclassified 7.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1006643 3300000549 Bacteria 1437
2 JGI24739J22299_10018386 3300001989 Bacteria 2513
3 JGI24739J22299_10033793 3300001989 Bacteria 1747
4 JGI24737J22298_10025261 3300001990 Bacteria 1879
5 rootL2_10188757 3300003322 Bacteria 1366
6 Ga0070676_10083507 3300005328 Bacteria 1943
7 Ga0070683_100065567 3300005329 Bacteria 3381
8 Ga0070670_100370452 3300005331 Bacteria 1261
9 Ga0068869_100006481 3300005334 Bacteria 7427
10 Ga0070680_100384637 3300005336 Bacteria 1195
11 Ga0070682_100036386 3300005337 Bacteria 3009
12 Ga0070682_100423296 3300005337 Bacteria 1013
13 Ga0070660_100087472 3300005339 Bacteria 2453
14 Ga0070660_100165780 3300005339 Bacteria 1782
15 Ga0070687_100014039 3300005343 Bacteria 3588
16 Ga0070668_100016013 3300005347 Bacteria 5610
17 Ga0070668_100025602 3300005347 Bacteria 4475
18 Ga0070668_100220840 3300005347 Bacteria 1563
19 Ga0070675_100001282 3300005354 Bacteria 18359
20 Ga0070675_100144038 3300005354 Bacteria 2039
21 Ga0070674_100149152 3300005356 Bacteria 1763
22 Ga0070673_100076513 3300005364 Bacteria 2703
23 Ga0070688_100410088 3300005365 Bacteria 1005
24 Ga0070667_100183873 3300005367 Bacteria 1849
25 Ga0070714_100000013 3300005435 Bacteria 211756
26 Ga0070714_100130422 3300005435 Bacteria 2246
27 Ga0070714_100298973 3300005435 Bacteria 1500
28 Ga0070710_10000470 3300005437 Bacteria 18972
29 Ga0070710_10207460 3300005437 Bacteria 1240
30 Ga0070701_10043739 3300005438 Bacteria 2293
31 Ga0070711_100021500 3300005439 Bacteria 4173
32 Ga0070705_100072342 3300005440 Bacteria 2088
33 Ga0070694_100008942 3300005444 Bacteria 6136
34 Ga0070663_100000292 3300005455 Bacteria 25592
35 Ga0070663_100021522 3300005455 Bacteria 4291
36 Ga0070663_100029721 3300005455 Bacteria 3737
37 Ga0070663_100149005 3300005455 Bacteria 1793
38 Ga0070662_100016347 3300005457 Bacteria 4981
39 Ga0070662_100070431 3300005457 Bacteria 2577
40 Ga0068867_100097597 3300005459 Bacteria 2239
41 Ga0070706_100110229 3300005467 Bacteria 2561
42 Ga0070707_100000096 3300005468 Bacteria 79602
43 Ga0070698_100000056 3300005471 Bacteria 80098
44 Ga0070679_100495496 3300005530 Bacteria 1166
45 Ga0068853_100425711 3300005539 Bacteria 1245
46 Ga0070686_100056157 3300005544 Bacteria 2524
47 Ga0070686_100446019 3300005544 Bacteria 994
48 Ga0070695_100002879 3300005545 Bacteria 10014
49 Ga0070665_100051535 3300005548 Bacteria 4127
50 Ga0070665_100183700 3300005548 Bacteria 2092
51 Ga0070665_100707929 3300005548 Bacteria 1020
52 Ga0070704_100015944 3300005549 Bacteria 4735
53 Ga0068855_100039145 3300005563 Bacteria 5628
54 Ga0068855_100634708 3300005563 Bacteria 1149
55 Ga0070664_100005336 3300005564 Bacteria 10314
56 Ga0070664_100146480 3300005564 Bacteria 2083
57 Ga0068857_100018314 3300005577 Bacteria 6143
58 Ga0068857_100024869 3300005577 Bacteria 5275
59 Ga0068857_100209202 3300005577 Bacteria 1780
60 Ga0068857_100673009 3300005577 Bacteria 982
61 Ga0068854_100096597 3300005578 Bacteria 2208
62 Ga0068852_100020128 3300005616 Bacteria 5301
63 Ga0068859_100338634 3300005617 Bacteria 1598
64 Ga0068859_100364822 3300005617 Bacteria 1539
65 Ga0068864_100292031 3300005618 Bacteria 1524
66 Ga0068864_100451310 3300005618 Bacteria 1230
67 Ga0068870_10153449 3300005840 Bacteria 1359
68 Ga0068863_100090427 3300005841 Bacteria 2902
69 Ga0068863_100373135 3300005841 Bacteria 1392
70 Ga0068863_100608428 3300005841 Bacteria 1082
71 Ga0068858_100111664 3300005842 Bacteria 2553
72 Ga0068858_100126946 3300005842 Bacteria 2389
73 Ga0068862_100112355 3300005844 Bacteria 2393
74 Ga0081455_10050249 3300005937 Bacteria 3587
75 Ga0081540_1012338 3300005983 Bacteria 5637
76 Ga0070717_10111687 3300006028 Bacteria 2332
77 Ga0075364_10291508 3300006051 Bacteria 1110
78 Ga0070715_10031166 3300006163 Bacteria 2162
79 Ga0075427_10002742 3300006194 Bacteria 2388
80 Ga0075428_100047032 3300006844 Bacteria 4740
81 Ga0075428_100077762 3300006844 Bacteria 3621
82 Ga0075430_100002740 3300006846 Bacteria 14714
83 Ga0075430_100008682 3300006846 Bacteria 8575
84 Ga0075431_100005471 3300006847 Bacteria 12544
85 Ga0075433_10022816 3300006852 Bacteria 5258
86 Ga0075434_100011710 3300006871 Bacteria 8282
87 Ga0075434_100077091 3300006871 Bacteria 3328
88 Ga0075429_100004129 3300006880 Bacteria 12432
89 Ga0075429_100174877 3300006880 Bacteria 1881
90 Ga0075429_100238044 3300006880 Bacteria 1594
91 Ga0068865_100116280 3300006881 Bacteria 1981
92 Ga0075436_100048777 3300006914 Bacteria 2921
93 Ga0097620_100338636 3300006931 Bacteria 1598
94 Ga0097620_100364838 3300006931 Bacteria 1539
95 Ga0105240_10157686 3300009093 Bacteria 2698
96 Ga0111539_10028090 3300009094 Bacteria 6868
97 Ga0111539_10248980 3300009094 Bacteria 2069
98 Ga0111539_10382543 3300009094 Bacteria 1639
99 Ga0105245_10021139 3300009098 Bacteria 5706
100 Ga0105245_10122022 3300009098 Bacteria 2435
101 Ga0105247_10007755 3300009101 Bacteria 6568
102 Ga0105247_10301444 3300009101 Bacteria 1112
103 Ga0114129_10000001 3300009147 Bacteria 292978
104 Ga0114129_10493884 3300009147 Bacteria 1599
105 Ga0105243_10115929 3300009148 Bacteria 2250
106 Ga0105242_10033344 3300009176 Bacteria 4123
107 Ga0105248_10099026 3300009177 Bacteria 3285
108 Ga0105238_10354018 3300009551 Bacteria 1457
109 Ga0105249_10020700 3300009553 Bacteria 5883
110 Ga0105239_10064777 3300010375 Bacteria 4012
111 Ga0105239_10177061 3300010375 Bacteria 2386
112 Ga0105246_10018858 3300011119 Bacteria 4400
113 Ga0157373_10159638 3300013100 Bacteria 1586
114 Ga0157370_10143916 3300013104 Bacteria 2220
115 Ga0157369_10122456 3300013105 Bacteria 2759
116 Ga0157369_10325468 3300013105 Bacteria 1598
117 Ga0157369_10436617 3300013105 Bacteria 1356
118 Ga0157374_10345381 3300013296 Bacteria 1478
119 Ga0163162_10015732 3300013306 Bacteria 7394
120 Ga0163162_10235336 3300013306 Bacteria 1962
121 Ga0157372_10306602 3300013307 Bacteria 1847
122 Ga0157372_10378413 3300013307 Bacteria 1650
123 Ga0157372_10915599 3300013307 Bacteria 1017
124 Ga0157375_10156267 3300013308 Bacteria 2420
125 Ga0157375_10435278 3300013308 Bacteria 1477
126 Ga0163163_10276105 3300014325 Bacteria 1732
127 Ga0163163_10388201 3300014325 Bacteria 1454
128 Ga0163163_10476979 3300014325 Bacteria 1308
129 Ga0157380_10151971 3300014326 Bacteria 2002
130 Ga0157380_10276876 3300014326 Bacteria 1533
131 Ga0157377_10123487 3300014745 Bacteria 1572
132 Ga0157379_10034122 3300014968 Bacteria 4535
133 Ga0157376_10044605 3300014969 Bacteria 3646
134 Ga0163161_10003506 3300017792 Bacteria 10982
135 Ga0206354_10367004 3300020081 Bacteria 1404
136 Ga0206353_11747325 3300020082 Bacteria 1924
137 Ga0213876_10003250 3300021384 Bacteria 9323
138 Ga0213875_10067994 3300021388 Bacteria 1664
139 Ga0224712_10050725 3300022467 Bacteria 1613
140 Ga0207692_10004299 3300025898 Bacteria 5632
141 Ga0207692_10153500 3300025898 Bacteria 1321
142 Ga0207710_10147682 3300025900 Bacteria 1139
143 Ga0207647_10005865 3300025904 Bacteria 8953
144 Ga0207685_10039370 3300025905 Bacteria 1754
145 Ga0207643_10031171 3300025908 Bacteria 2970
146 Ga0207671_10217000 3300025914 Bacteria 1498
147 Ga0207660_10226934 3300025917 Bacteria 1467
148 Ga0207662_10061077 3300025918 Bacteria 2262
149 Ga0207657_10005909 3300025919 Bacteria 12736
150 Ga0207657_10134261 3300025919 Bacteria 2026
151 Ga0207657_10307562 3300025919 Bacteria 1255
152 Ga0207649_10178229 3300025920 Bacteria 1486
153 Ga0207646_10000157 3300025922 Bacteria 92709
154 Ga0207659_10008237 3300025926 Bacteria 6460
155 Ga0207659_10293083 3300025926 Bacteria 1334
156 Ga0207687_10011612 3300025927 Bacteria 5755
157 Ga0207700_10085171 3300025928 Bacteria 2480
158 Ga0207664_10000001 3300025929 Bacteria 724213
159 Ga0207664_10027180 3300025929 Bacteria 4334
160 Ga0207664_10035393 3300025929 Bacteria 3853
161 Ga0207664_10251988 3300025929 Bacteria 1541
162 Ga0207690_10186979 3300025932 Bacteria 1564
163 Ga0207706_10032995 3300025933 Bacteria 4608
164 Ga0207706_10309516 3300025933 Bacteria 1376
165 Ga0207709_10015782 3300025935 Bacteria 4192
166 Ga0207665_10004569 3300025939 Bacteria 9186
167 Ga0207711_10142354 3300025941 Bacteria 2158
168 Ga0207689_10002432 3300025942 Bacteria 17338
169 Ga0207689_10111016 3300025942 Bacteria 2253
170 Ga0207661_10183872 3300025944 Bacteria 1828
171 Ga0207661_10543541 3300025944 Bacteria 1064
172 Ga0207679_10007303 3300025945 Bacteria 7005
173 Ga0207667_10013390 3300025949 Bacteria 9385
174 Ga0207712_10005635 3300025961 Bacteria 7898
175 Ga0207668_10078512 3300025972 Bacteria 2384
176 Ga0207668_10239804 3300025972 Bacteria 1466
177 Ga0207640_10304912 3300025981 Bacteria 1261
178 Ga0207677_10051348 3300026023 Bacteria 2795
179 Ga0207677_10339561 3300026023 Bacteria 1254
180 Ga0207703_10193733 3300026035 Bacteria 1802
181 Ga0207639_10122727 3300026041 Bacteria 2137
182 Ga0207678_10000166 3300026067 Bacteria 55793
183 Ga0207678_10007369 3300026067 Bacteria 9738
184 Ga0207678_10011366 3300026067 Bacteria 7812
185 Ga0207678_10198314 3300026067 Bacteria 1716
186 Ga0207708_10008274 3300026075 Bacteria 7705
187 Ga0207708_10014691 3300026075 Bacteria 5861
188 Ga0207708_10142248 3300026075 Bacteria 1883
189 Ga0207641_10017172 3300026088 Bacteria 5920
190 Ga0207648_10149494 3300026089 Bacteria 2060
191 Ga0207676_10206872 3300026095 Bacteria 1738
192 Ga0207674_10044183 3300026116 Bacteria 4590
193 Ga0207674_10287728 3300026116 Bacteria 1592
194 Ga0207675_100017948 3300026118 Bacteria 6598
195 Ga0207675_100110997 3300026118 Bacteria 2587
196 Ga0207683_10016445 3300026121 Bacteria 6297
197 Ga0207683_10463804 3300026121 Bacteria 1168
198 Ga0207698_10068690 3300026142 Bacteria 2799
199 Ga0207428_10002783 3300027907 Bacteria 17364
200 Ga0207428_10084277 3300027907 Bacteria 2477
201 Ga0268266_10063856 3300028379 Bacteria 3179
202 Ga0268266_10177337 3300028379 Bacteria 1938
203 Ga0268266_10185001 3300028379 Bacteria 1899
204 Ga0268264_10548932 3300028381 Bacteria 1133
205 Ga0307517_10056726 3300028786 Bacteria 3814
206 Ga0307511_10087972 3300030521 Bacteria 2128
207 Ga0316177_1024091 3300030731 Bacteria 1813
208 Ga0314311_1089512 3300030733 Bacteria 2644
209 Ga0265327_10000041 3300031251 Bacteria 288506
210 Ga0265327_10000125 3300031251 Bacteria 167832
211 Ga0307513_10000001 3300031456 Bacteria 1660464
212 Ga0307513_10044439 3300031456 Bacteria 4867
213 Ga0307509_10091007 3300031507 Bacteria 3124
214 Ga0307405_10113184 3300031731 Bacteria 1842
215 Ga0307405_10138119 3300031731 Bacteria 1695
216 Ga0307413_10505508 3300031824 Bacteria 971
217 Ga0307410_10146110 3300031852 Bacteria 1755
218 Ga0307406_10117335 3300031901 Bacteria 1843
219 Ga0307406_10226815 3300031901 Bacteria 1392
220 Ga0307407_10064268 3300031903 Bacteria 2156
221 Ga0307407_10086450 3300031903 Bacteria 1910
222 Ga0307407_10295698 3300031903 Bacteria 1127
223 Ga0307412_10145979 3300031911 Bacteria 1739
224 Ga0307412_10294743 3300031911 Bacteria 1279
225 Ga0307409_100037569 3300031995 Bacteria 3571
226 Ga0307409_100054450 3300031995 Bacteria 3081
227 Ga0307409_100073356 3300031995 Bacteria 2729
228 Ga0307416_100104183 3300032002 Bacteria 2479
229 Ga0307416_100147943 3300032002 Bacteria 2148
230 Ga0307416_100290844 3300032002 Bacteria 1617
231 Ga0307416_100684033 3300032002 Bacteria 1114
232 Ga0307414_10557013 3300032004 Bacteria 1022
233 Ga0307411_10093525 3300032005 Bacteria 2105
234 Ga0307415_100016303 3300032126 Bacteria 4426
235 Ga0307415_100073353 3300032126 Bacteria 2414
236 Ga0307415_100091893 3300032126 Bacteria 2199
237 Ga0307415_100149852 3300032126 Bacteria 1794
238 Ga0307507_10010095 3300033179 Bacteria 12338
239 Ga0307507_10096600 3300033179 Bacteria 2498
240 Ga0307510_10178091 3300033180 Bacteria 1694
241 Ga0373928_0084779 3300035084 Bacteria 804
242 Ga0373949_0007635 3300035090 Bacteria 2369
243 Ga0373932_0003320 3300035112 Bacteria 3884
244 Ga0373960_0013171 3300035121 Bacteria 2070
245 Ga0373942_0017557 3300035207 Bacteria 1765
246 Ga0373962_0005576 3300035242 Bacteria 3042
247 Ga0373935_0173005 3300035692 Bacteria 1478
248 Ga0373947_0118808 3300035725 Bacteria 1678
249 Ga0395900_0285274 3300037418 Bacteria 1642
250 Ga0395905_0025551 3300037471 Bacteria 5569
251 Ga0436364_0643983 3300037853 Bacteria 4566
252 Ga0436364_1157350 3300037853 Bacteria 9824
253 Ga0395901_0034113 3300038443 Bacteria 5255
254 Ga0395901_0193907 3300038443 Bacteria 2130
255 Ga0395901_0391971 3300038443 Bacteria 1428
256 Ga0242420_033376 3300038996 Bacteria 963
257 Ga0436365_1061792 3300039437 Bacteria 46945
258 Ga0436365_1438918 3300039437 Bacteria 4305
259 Ga0451853_0178379 3300041512 Bacteria 1480
260 Ga0439448_0000889 3300042005 Bacteria 7339
261 Ga0439450_001010 3300042008 Bacteria 3948
262 Ga0439454_001182 3300042011 Bacteria 2423
263 Ga0439463_000293 3300042016 Bacteria 13849
264 Ga0450900_002014 3300042136 Bacteria 2092
265 Ga0450905_011419 3300042142 Bacteria 1241
266 Ga0439460_0000291 3300042461 Bacteria 10404
267 Ga0466972_0009127 3300044658 Bacteria 4980
268 Ga0466972_0028248 3300044658 Bacteria 2768
269 Ga0466972_0069835 3300044658 Bacteria 1676
270 Ga0466965_0013824 3300044683 Bacteria 3813
271 Ga0466965_0016644 3300044683 Bacteria 3503
272 Ga0466965_0027061 3300044683 Bacteria 2781
273 Ga0466965_0042547 3300044683 Bacteria 2241
274 Ga0466965_0135139 3300044683 Bacteria 1281
275 Ga0466966_0102475 3300044684 Bacteria 1769
276 Ga0466961_0069199 3300044693 Bacteria 2241
277 Ga0466961_0129830 3300044693 Bacteria 1579
278 Ga0466963_0057028 3300044694 Bacteria 2600
279 Ga0466963_0096486 3300044694 Bacteria 2019
280 Ga0466963_0262202 3300044694 Bacteria 1213
281 Ga0466964_0058019 3300044706 Bacteria 1604
282 Ga0466964_0064857 3300044706 Bacteria 1529
283 Ga0466968_0041156 3300044735 Bacteria 1949
284 Ga0466957_0012077 3300044842 Bacteria 4993
285 Ga0466957_0050374 3300044842 Bacteria 2534
286 Ga0466957_0427912 3300044842 Bacteria 909
287 Ga0466960_0000960 3300044901 Bacteria 10239
288 Ga0466960_0008781 3300044901 Bacteria 4148
289 Ga0466960_0015879 3300044901 Bacteria 3254
290 Ga0466960_0047234 3300044901 Bacteria 2064
291 Ga0466960_0085862 3300044901 Bacteria 1595
292 Ga0466959_0018983 3300045049 Bacteria 5052
293 Ga0466959_0050425 3300045049 Bacteria 3056
294 Ga0466959_0106948 3300045049 Bacteria 2000
295 Ga0466967_0005474 3300045976 Bacteria 8803
296 Ga0466967_0018249 3300045976 Bacteria 5600
297 Ga0466967_0047399 3300045976 Bacteria 3746
298 Ga0466967_0073369 3300045976 Bacteria 3070
299 Ga0466967_0104742 3300045976 Bacteria 2590
300 Ga0466967_0207068 3300045976 Bacteria 1859
301 Ga0466967_0593984 3300045976 Bacteria 1092
302 Ga0495651_0032432 3300046462 Bacteria 4074
303 Ga0495585_0025076 3300046492 Bacteria 3418
304 Ga0495594_0039044 3300046499 Bacteria 2594
305 Ga0495586_0012717 3300046535 Bacteria 4463
306 Ga0495613_0012496 3300046689 Bacteria 6310
307 Ga0495672_0189084 3300047320 Bacteria 1037
308 Ga0496100_0024791 3300048903 Bacteria 3663
309 Ga0496100_0058941 3300048903 Bacteria 2521
310 Ga0496100_0363159 3300048903 Bacteria 1096
311 Ga0496102_0029467 3300048905 Bacteria 4911
312 Ga0496104_0082937 3300048907 Bacteria 3057
313 Ga0496104_0094318 3300048907 Bacteria 2863
314 Ga0496105_0081200 3300048908 Bacteria 2678
315 Ga0496105_0109626 3300048908 Bacteria 2279
316 Ga0496105_0167538 3300048908 Bacteria 1802
317 Ga0496106_0032907 3300048909 Bacteria 3866
318 Ga0496107_0012323 3300048910 Bacteria 5969
319 Ga0496107_0100632 3300048910 Bacteria 2119
320 Ga0496108_0005652 3300048911 Bacteria 10126
321 Ga0496109_0004809 3300048912 Bacteria 11273
322 Ga0496109_0006661 3300048912 Bacteria 9726
323 Ga0496109_0543413 3300048912 Bacteria 1096
324 Ga0496110_0054796 3300048913 Bacteria 3507
325 Ga0496110_0151552 3300048913 Bacteria 2100
326 Ga0496111_0014688 3300048914 Bacteria 5356
327 Ga0496112_0061846 3300048915 Bacteria 3692
328 Ga0496113_0144984 3300048916 Bacteria 1870
329 Ga0496114_0062474 3300048917 Bacteria 3116
330 Ga0496114_0276212 3300048917 Bacteria 1481
331 Ga0496115_0030751 3300048918 Bacteria 4226
332 Ga0496115_0089585 3300048918 Bacteria 2513
333 Ga0496115_0279852 3300048918 Bacteria 1370
334 Ga0501032_0002085 3300049569 Bacteria 15782
335 Ga0501033_0273861 3300049570 Bacteria 1193
336 Ga0501034_0169448 3300049571 Bacteria 2151
337 Ga0501037_0000875 3300049573 Bacteria 22490
338 Ga0501038_0002452 3300049574 Bacteria 17278
339 Ga0501039_0001151 3300049575 Bacteria 19497
340 Ga0501043_0000976 3300049579 Bacteria 25292
341 Ga0501070_0004495 3300049586 Bacteria 11972
342 Ga0501243_027863 3300049675 Bacteria 955
343 Ga0501044_0054595 3300049823 Bacteria 4106
344 nmdc:mga05p37_2068_c1 3300050507 Bacteria 23404
345 nmdc:mga05p37_343412_c1 3300050507 Bacteria 1760
346 nmdc:mga05p37_4546_c1 3300050507 Bacteria 16215
347 nmdc:mga09592_233_c2 3300050508 Bacteria 16321
348 nmdc:mga09592_7277_c1 3300050508 Bacteria 8994
349 nmdc:mga0qj67_275_c1 3300050509 Bacteria 35760
350 nmdc:mga0qj67_35259_c1 3300050509 Bacteria 3911
351 nmdc:mga06r32_14022_c1 3300050510 Bacteria 7268
352 nmdc:mga06r32_169_c1 3300050510 Bacteria 50248
353 nmdc:mga08y16_497685_c1 3300050511 Bacteria 1239
354 nmdc:mga08y16_57303_c1 3300050511 Bacteria 4072
355 nmdc:mga0n895_260516_c1 3300050512 Bacteria 1760
356 nmdc:mga0n895_61893_c1 3300050512 Bacteria 3697
357 nmdc:mga0n895_80427_c1 3300050512 Bacteria 3247
358 nmdc:mga0a205_25552_c1 3300050515 Bacteria 5627
359 nmdc:mga0a205_70009_c1 3300050515 Bacteria 3387
360 Ga0500616_0002672 3300053153 Bacteria 14496
361 Ga0500620_034970 3300053155 Bacteria 1616
362 Ga0500633_0062562 3300053160 Bacteria 1312
363 Ga0587106_015013 3300059605 Bacteria 1076
364 Ga0587111_0048797 3300060346 Bacteria 928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0096486 Ga0466963_0096486_1334_2008 198
2 iso_pu_bacteria 2501939600 2501945729 201
3 3300053160 Ga0500633_0062562 Ga0500633_0062562_34_735 205
4 3300013105 Ga0157369_10325468 Ga0157369_103254682 210
5 3300013307 Ga0157372_10378413 Ga0157372_103784132 210
6 3300044693 Ga0466961_0129830 Ga0466961_0129830_456_1169 212
7 3300045049 Ga0466959_0050425 Ga0466959_0050425_2169_2882 212
8 3300031731 Ga0307405_10113184 Ga0307405_101131842 213
9 3300031852 Ga0307410_10146110 Ga0307410_101461102 213
10 3300031901 Ga0307406_10226815 Ga0307406_102268152 213
11 3300031903 Ga0307407_10295698 Ga0307407_102956982 213
12 3300031911 Ga0307412_10145979 Ga0307412_101459791 213
13 3300031995 Ga0307409_100037569 Ga0307409_1000375693 213
14 3300032002 Ga0307416_100290844 Ga0307416_1002908442 213
15 3300032126 Ga0307415_100073353 Ga0307415_1000733532 213
16 3300049570 Ga0501033_0273861 Ga0501033_0273861_294_1028 214
17 3300025919 Ga0207657_10307562 Ga0207657_103075622 215
18 iso_pu_bacteria 2856858025 2856858697 215
19 iso_pu_bacteria 2858868258 2858870384 215
20 iso_pu_bacteria 2902582711 2902583579 215
21 3300005354 Ga0070675_100144038 Ga0070675_1001440383 217
22 3300005356 Ga0070674_100149152 Ga0070674_1001491522 217
23 3300005435 Ga0070714_100130422 Ga0070714_1001304224 217
24 3300005457 Ga0070662_100016347 Ga0070662_1000163473 217
25 3300005459 Ga0068867_100097597 Ga0068867_1000975972 217
26 3300005564 Ga0070664_100146480 Ga0070664_1001464803 217
27 3300005578 Ga0068854_100096597 Ga0068854_1000965976 217
28 3300006852 Ga0075433_10022816 Ga0075433_100228162 217
29 3300017792 Ga0163161_10003506 Ga0163161_100035062 217
30 3300025933 Ga0207706_10032995 Ga0207706_100329952 217
31 3300025939 Ga0207665_10004569 Ga0207665_1000456915 217
32 3300025942 Ga0207689_10111016 Ga0207689_101110162 217
33 3300026075 Ga0207708_10008274 Ga0207708_100082743 217
34 3300035084 Ga0373928_0084779 Ga0373928_0084779_52_774 217
35 3300005336 Ga0070680_100384637 Ga0070680_1003846372 221
36 3300005530 Ga0070679_100495496 Ga0070679_1004954962 221
37 3300020082 Ga0206353_11747325 Ga0206353_117473253 221
38 3300022467 Ga0224712_10050725 Ga0224712_100507252 221
39 3300025917 Ga0207660_10226934 Ga0207660_102269342 221
40 3300006194 Ga0075427_10002742 Ga0075427_100027422 222
41 3300006844 Ga0075428_100047032 Ga0075428_1000470323 222
42 3300006846 Ga0075430_100002740 Ga0075430_1000027405 222
43 3300006871 Ga0075434_100011710 Ga0075434_1000117103 222
44 3300006880 Ga0075429_100238044 Ga0075429_1002380442 222
45 3300027907 Ga0207428_10002783 Ga0207428_100027837 222
46 3300031901 Ga0307406_10117335 Ga0307406_101173352 222
47 3300032002 Ga0307416_100147943 Ga0307416_1001479432 222
48 3300032004 Ga0307414_10557013 Ga0307414_105570132 222
49 3300032005 Ga0307411_10093525 Ga0307411_100935252 222
50 3300032126 Ga0307415_100091893 Ga0307415_1000918932 222
51 3300037471 Ga0395905_0025551 Ga0395905_0025551_3554_4333 222
52 3300038443 Ga0395901_0193907 Ga0395901_0193907_1112_1891 222
53 3300042005 Ga0439448_0000889 Ga0439448_0000889_891_1670 222
54 3300042008 Ga0439450_001010 Ga0439450_001010_1970_2749 222
55 3300042011 Ga0439454_001182 Ga0439454_001182_67_846 222
56 3300042016 Ga0439463_000293 Ga0439463_000293_217_996 222
57 3300042136 Ga0450900_002014 Ga0450900_002014_392_1171 222
58 3300042142 Ga0450905_011419 Ga0450905_011419_422_1201 222
59 3300042461 Ga0439460_0000291 Ga0439460_0000291_7087_7866 222
60 3300046689 Ga0495613_0012496 Ga0495613_0012496_4351_5163 222
61 3300048907 Ga0496104_0094318 Ga0496104_0094318_223_1035 222
62 3300048908 Ga0496105_0167538 Ga0496105_0167538_570_1382 222
63 3300048912 Ga0496109_0006661 Ga0496109_0006661_3698_4510 222
64 3300048913 Ga0496110_0151552 Ga0496110_0151552_322_1134 222
65 3300048914 Ga0496111_0014688 Ga0496111_0014688_3356_4168 222
66 3300050507 nmdc:mga05p37_343412_c1 nmdc:mga05p37_343412_c1_694_1473 222
67 3300050507 nmdc:mga05p37_4546_c1 nmdc:mga05p37_4546_c1_12531_13310 222
68 3300050508 nmdc:mga09592_7277_c1 nmdc:mga09592_7277_c1_4291_5070 222
69 3300050509 nmdc:mga0qj67_35259_c1 nmdc:mga0qj67_35259_c1_2887_3666 222
70 3300050510 nmdc:mga06r32_14022_c1 nmdc:mga06r32_14022_c1_2446_3225 222
71 3300050511 nmdc:mga08y16_497685_c1 nmdc:mga08y16_497685_c1_133_912 222
72 3300050512 nmdc:mga0n895_260516_c1 nmdc:mga0n895_260516_c1_818_1597 222
73 3300050512 nmdc:mga0n895_80427_c1 nmdc:mga0n895_80427_c1_1257_2036 222
74 3300050515 nmdc:mga0a205_25552_c1 nmdc:mga0a205_25552_c1_726_1505 222
75 3300030521 Ga0307511_10087972 Ga0307511_100879722 223
76 3300033180 Ga0307510_10178091 Ga0307510_101780912 223
77 iso_pu_bacteria 2751185734 2753070249 223
78 iso_pu_bacteria 2870721527 2870729947 223
79 3300046535 Ga0495586_0012717 Ga0495586_0012717_1919_2731 224
80 3300013105 Ga0157369_10436617 Ga0157369_104366171 226
81 3300046462 Ga0495651_0032432 Ga0495651_0032432_3053_3862 226
82 3300005437 Ga0070710_10000470 Ga0070710_100004702 228
83 3300025898 Ga0207692_10004299 Ga0207692_100042992 228
84 3300030731 Ga0316177_1024091 Ga0316177_10240913 228
85 3300030733 Ga0314311_1089512 Ga0314311_10895123 228
86 3300031507 Ga0307509_10091007 Ga0307509_100910073 228
87 3300032002 Ga0307416_100684033 Ga0307416_1006840332 228
88 3300038996 Ga0242420_033376 Ga0242420_033376_41_826 228
89 3300041512 Ga0451853_0178379 Ga0451853_0178379_100_864 228
90 3300044658 Ga0466972_0009127 Ga0466972_0009127_2505_3269 228
91 3300044683 Ga0466965_0027061 Ga0466965_0027061_112_876 228
92 3300044901 Ga0466960_0000960 Ga0466960_0000960_3544_4308 228
93 3300045976 Ga0466967_0593984 Ga0466967_0593984_91_921 228
94 3300060346 Ga0587111_0048797 Ga0587111_0048797_25_789 228
95 3300014325 Ga0163163_10388201 Ga0163163_103882011 231
96 3300014326 Ga0157380_10151971 Ga0157380_101519712 231
97 3300049675 Ga0501243_027863 Ga0501243_027863_10_789 231
98 3300013307 Ga0157372_10915599 Ga0157372_109155992 232
99 3300021388 Ga0213875_10067994 Ga0213875_100679942 232
100 3300037853 Ga0436364_0643983 Ga0436364_0643983_3519_4325 232
101 3300009177 Ga0105248_10099026 Ga0105248_100990262 233
102 3300014325 Ga0163163_10276105 Ga0163163_102761052 233
103 3300048908 Ga0496105_0081200 Ga0496105_0081200_1306_2100 233
104 3300005467 Ga0070706_100110229 Ga0070706_1001102291 235
105 3300005468 Ga0070707_100000096 Ga0070707_10000009663 235
106 3300005471 Ga0070698_100000056 Ga0070698_10000005663 235
107 3300006028 Ga0070717_10111687 Ga0070717_101116872 235
108 3300025922 Ga0207646_10000157 Ga0207646_1000015720 235
109 iso_pu_bacteria 2795385472 2795794211 235
110 iso_pu_bacteria 2855683550 2855686001 235
111 iso_pu_bacteria 2867312974 2867316611 235
112 iso_pu_bacteria 2867319477 2867321805 235
113 iso_pu_bacteria 2996221748 2996223890 235
114 3300013105 Ga0157369_10122456 Ga0157369_101224564 236
115 3300038443 Ga0395901_0034113 Ga0395901_0034113_1782_2615 236
116 3300048918 Ga0496115_0279852 Ga0496115_0279852_528_1316 236
117 iso_pu_bacteria 2791354901 2791912655 236
118 iso_pu_bacteria 2816332119 2816427805 236
119 3300005577 Ga0068857_100673009 Ga0068857_1006730092 237
120 iso_pu_bacteria 2515154155 2515852813 237
121 iso_pu_bacteria 2675903058 2676477799 237
122 iso_pu_bacteria 2738543005 2739203696 237
123 iso_pu_bacteria 2795385470 2795787394 237
124 iso_pu_bacteria 2827628540 2827629123 237
125 iso_pu_bacteria 2928142448 2928146391 237
126 3300028786 Ga0307517_10056726 Ga0307517_100567262 238
127 3300031251 Ga0265327_10000041 Ga0265327_10000041225 238
128 iso_pu_bacteria 8056060235 8056061247 239
129 3300001989 JGI24739J22299_10018386 JGI24739J22299_100183863 240
130 3300001989 JGI24739J22299_10033793 JGI24739J22299_100337932 240
131 3300001990 JGI24737J22298_10025261 JGI24737J22298_100252613 240
132 3300005331 Ga0070670_100370452 Ga0070670_1003704522 240
133 3300005334 Ga0068869_100006481 Ga0068869_1000064812 240
134 3300005337 Ga0070682_100423296 Ga0070682_1004232961 240
135 3300005339 Ga0070660_100165780 Ga0070660_1001657802 240
136 3300005347 Ga0070668_100016013 Ga0070668_1000160134 240
137 3300005354 Ga0070675_100001282 Ga0070675_10000128216 240
138 3300005367 Ga0070667_100183873 Ga0070667_1001838732 240
139 3300005455 Ga0070663_100000292 Ga0070663_10000029214 240
140 3300005455 Ga0070663_100029721 Ga0070663_1000297213 240
141 3300005457 Ga0070662_100070431 Ga0070662_1000704312 240
142 3300005539 Ga0068853_100425711 Ga0068853_1004257112 240
143 3300005544 Ga0070686_100446019 Ga0070686_1004460191 240
144 3300005548 Ga0070665_100183700 Ga0070665_1001837002 240
145 3300005564 Ga0070664_100005336 Ga0070664_1000053367 240
146 3300005577 Ga0068857_100018314 Ga0068857_1000183142 240
147 3300005577 Ga0068857_100024869 Ga0068857_1000248696 240
148 3300005617 Ga0068859_100364822 Ga0068859_1003648222 240
149 3300005618 Ga0068864_100292031 Ga0068864_1002920312 240
150 3300005844 Ga0068862_100112355 Ga0068862_1001123552 240
151 3300005937 Ga0081455_10050249 Ga0081455_100502492 240
152 3300006846 Ga0075430_100008682 Ga0075430_1000086827 240
153 3300006847 Ga0075431_100005471 Ga0075431_1000054716 240
154 3300006880 Ga0075429_100004129 Ga0075429_1000041296 240
155 3300006931 Ga0097620_100364838 Ga0097620_1003648382 240
156 3300009094 Ga0111539_10028090 Ga0111539_100280904 240
157 3300009098 Ga0105245_10021139 Ga0105245_1002113910 240
158 3300009098 Ga0105245_10122022 Ga0105245_101220222 240
159 3300009147 Ga0114129_10000001 Ga0114129_10000001127 240
160 3300009551 Ga0105238_10354018 Ga0105238_103540182 240
161 3300010375 Ga0105239_10177061 Ga0105239_101770612 240
162 3300013296 Ga0157374_10345381 Ga0157374_103453813 240
163 3300013306 Ga0163162_10235336 Ga0163162_102353362 240
164 3300013307 Ga0157372_10306602 Ga0157372_103066021 240
165 3300013308 Ga0157375_10435278 Ga0157375_104352782 240
166 3300014325 Ga0163163_10476979 Ga0163163_104769792 240
167 3300014326 Ga0157380_10276876 Ga0157380_102768762 240
168 3300025904 Ga0207647_10005865 Ga0207647_100058659 240
169 3300025919 Ga0207657_10134261 Ga0207657_101342612 240
170 3300025920 Ga0207649_10178229 Ga0207649_101782292 240
171 3300025926 Ga0207659_10008237 Ga0207659_100082377 240
172 3300025927 Ga0207687_10011612 Ga0207687_100116122 240
173 3300025929 Ga0207664_10251988 Ga0207664_102519882 240
174 3300025932 Ga0207690_10186979 Ga0207690_101869792 240
175 3300025933 Ga0207706_10309516 Ga0207706_103095162 240
176 3300025942 Ga0207689_10002432 Ga0207689_100024325 240
177 3300025944 Ga0207661_10183872 Ga0207661_101838722 240
178 3300025945 Ga0207679_10007303 Ga0207679_100073037 240
179 3300025972 Ga0207668_10239804 Ga0207668_102398042 240
180 3300025981 Ga0207640_10304912 Ga0207640_103049122 240
181 3300026023 Ga0207677_10339561 Ga0207677_103395612 240
182 3300026041 Ga0207639_10122727 Ga0207639_101227272 240
183 3300026067 Ga0207678_10000166 Ga0207678_1000016632 240
184 3300026067 Ga0207678_10007369 Ga0207678_100073697 240
185 3300026067 Ga0207678_10198314 Ga0207678_101983142 240
186 3300026075 Ga0207708_10014691 Ga0207708_100146912 240
187 3300026075 Ga0207708_10142248 Ga0207708_101422482 240
188 3300026116 Ga0207674_10044183 Ga0207674_100441832 240
189 3300026116 Ga0207674_10287728 Ga0207674_102877283 240
190 3300026118 Ga0207675_100110997 Ga0207675_1001109972 240
191 3300026121 Ga0207683_10463804 Ga0207683_104638042 240
192 3300027907 Ga0207428_10084277 Ga0207428_100842772 240
193 3300028379 Ga0268266_10185001 Ga0268266_101850012 240
194 3300031456 Ga0307513_10000001 Ga0307513_10000001636 240
195 3300031456 Ga0307513_10044439 Ga0307513_100444395 240
196 3300031995 Ga0307409_100054450 Ga0307409_1000544502 240
197 3300032126 Ga0307415_100149852 Ga0307415_1001498522 240
198 3300033179 Ga0307507_10010095 Ga0307507_1001009513 240
199 3300033179 Ga0307507_10096600 Ga0307507_100966002 240
200 3300037418 Ga0395900_0285274 Ga0395900_0285274_481_1281 240
201 3300038443 Ga0395901_0391971 Ga0395901_0391971_74_874 240
202 3300044658 Ga0466972_0028248 Ga0466972_0028248_1214_2038 240
203 3300044683 Ga0466965_0042547 Ga0466965_0042547_1149_1955 240
204 3300044684 Ga0466966_0102475 Ga0466966_0102475_340_1140 240
205 3300044706 Ga0466964_0058019 Ga0466964_0058019_587_1387 240
206 3300044901 Ga0466960_0047234 Ga0466960_0047234_1204_2010 240
207 3300045976 Ga0466967_0005474 Ga0466967_0005474_7920_8720 240
208 3300045976 Ga0466967_0073369 Ga0466967_0073369_1920_2720 240
209 3300047320 Ga0495672_0189084 Ga0495672_0189084_138_938 240
210 3300048912 Ga0496109_0543413 Ga0496109_0543413_47_850 240
211 3300048916 Ga0496113_0144984 Ga0496113_0144984_454_1254 240
212 3300048918 Ga0496115_0089585 Ga0496115_0089585_937_1737 240
213 3300050507 nmdc:mga05p37_2068_c1 nmdc:mga05p37_2068_c1_7125_7937 240
214 3300050508 nmdc:mga09592_233_c2 nmdc:mga09592_233_c2_4956_5768 240
215 3300050509 nmdc:mga0qj67_275_c1 nmdc:mga0qj67_275_c1_24202_25014 240
216 3300050510 nmdc:mga06r32_169_c1 nmdc:mga06r32_169_c1_43116_43928 240
217 3300050511 nmdc:mga08y16_57303_c1 nmdc:mga08y16_57303_c1_1324_2136 240
218 3300059605 Ga0587106_015013 Ga0587106_015013_228_1028 240
219 iso_pu_bacteria 8003856774 8003857280 240
220 3300031251 Ga0265327_10000125 Ga0265327_10000125158 241
221 3300035121 Ga0373960_0013171 Ga0373960_0013171_701_1510 241
222 iso_pu_bacteria 2738541308 2738889324 241
223 3300005329 Ga0070683_100065567 Ga0070683_1000655673 242
224 3300005365 Ga0070688_100410088 Ga0070688_1004100881 242
225 3300005618 Ga0068864_100451310 Ga0068864_1004513102 242
226 3300005841 Ga0068863_100608428 Ga0068863_1006084282 242
227 3300006844 Ga0075428_100077762 Ga0075428_1000777623 242
228 3300006880 Ga0075429_100174877 Ga0075429_1001748771 242
229 3300009094 Ga0111539_10248980 Ga0111539_102489802 242
230 3300009147 Ga0114129_10493884 Ga0114129_104938841 242
231 3300025929 Ga0207664_10035393 Ga0207664_100353935 242
232 3300035692 Ga0373935_0173005 Ga0373935_0173005_193_1020 242
233 3300035725 Ga0373947_0118808 Ga0373947_0118808_299_1126 242
234 3300045049 Ga0466959_0106948 Ga0466959_0106948_1006_1836 242
235 3300005328 Ga0070676_10083507 Ga0070676_100835072 243
236 3300005577 Ga0068857_100209202 Ga0068857_1002092022 243
237 3300005841 Ga0068863_100373135 Ga0068863_1003731352 243
238 3300026095 Ga0207676_10206872 Ga0207676_102068722 243
239 3300028379 Ga0268266_10063856 Ga0268266_100638565 243
240 3300046499 Ga0495594_0039044 Ga0495594_0039044_529_1356 243
241 3300048908 Ga0496105_0109626 Ga0496105_0109626_1169_1978 243
242 3300003322 rootL2_10188757 rootL2_101887571 244
243 3300005347 Ga0070668_100025602 Ga0070668_1000256022 244
244 3300044658 Ga0466972_0069835 Ga0466972_0069835_30_860 244
245 3300044683 Ga0466965_0016644 Ga0466965_0016644_1801_2631 244
246 3300044735 Ga0466968_0041156 Ga0466968_0041156_496_1326 244
247 3300044842 Ga0466957_0012077 Ga0466957_0012077_2496_3326 244
248 3300044901 Ga0466960_0008781 Ga0466960_0008781_1020_1850 244
249 3300045049 Ga0466959_0018983 Ga0466959_0018983_1877_2707 244
250 3300045976 Ga0466967_0047399 Ga0466967_0047399_502_1314 244
251 3300045976 Ga0466967_0104742 Ga0466967_0104742_1430_2260 244
252 3300039437 Ga0436365_1438918 Ga0436365_1438918_1584_2414 245
253 3300044694 Ga0466963_0057028 Ga0466963_0057028_1505_2320 245
254 3300048903 Ga0496100_0363159 Ga0496100_0363159_46_861 245
255 3300005455 Ga0070663_100149005 Ga0070663_1001490052 246
256 3300005548 Ga0070665_100707929 Ga0070665_1007079292 246
257 3300021384 Ga0213876_10003250 Ga0213876_100032508 246
258 3300031911 Ga0307412_10294743 Ga0307412_102947432 246
259 3300032126 Ga0307415_100016303 Ga0307415_1000163032 246
260 3300037853 Ga0436364_1157350 Ga0436364_1157350_3971_4843 246
261 3300039437 Ga0436365_1061792 Ga0436365_1061792_22798_23670 246
262 3300044694 Ga0466963_0262202 Ga0466963_0262202_26_859 246
263 3300044842 Ga0466957_0427912 Ga0466957_0427912_56_889 246
264 3300045976 Ga0466967_0018249 Ga0466967_0018249_3840_4673 246
265 3300045976 Ga0466967_0207068 Ga0466967_0207068_946_1764 246
266 3300005347 Ga0070668_100220840 Ga0070668_1002208402 247
267 3300005435 Ga0070714_100298973 Ga0070714_1002989732 247
268 3300044683 Ga0466965_0013824 Ga0466965_0013824_2451_3272 247
269 3300044693 Ga0466961_0069199 Ga0466961_0069199_304_1137 247
270 3300044706 Ga0466964_0064857 Ga0466964_0064857_414_1250 247
271 3300044842 Ga0466957_0050374 Ga0466957_0050374_917_1750 247
272 3300049569 Ga0501032_0002085 Ga0501032_0002085_343_1173 247
273 3300049571 Ga0501034_0169448 Ga0501034_0169448_467_1297 247
274 3300049573 Ga0501037_0000875 Ga0501037_0000875_13906_14736 247
275 3300049574 Ga0501038_0002452 Ga0501038_0002452_16422_17252 247
276 3300049575 Ga0501039_0001151 Ga0501039_0001151_335_1165 247
277 3300049579 Ga0501043_0000976 Ga0501043_0000976_440_1270 247
278 3300049586 Ga0501070_0004495 Ga0501070_0004495_89_919 247
279 3300049823 Ga0501044_0054595 Ga0501044_0054595_1233_2063 247
280 3300053155 Ga0500620_034970 Ga0500620_034970_142_966 247
281 3300005435 Ga0070714_100000013 Ga0070714_100000013156 248
282 3300005842 Ga0068858_100111664 Ga0068858_1001116643 248
283 3300009101 Ga0105247_10301444 Ga0105247_103014441 248
284 3300025900 Ga0207710_10147682 Ga0207710_101476821 248
285 3300025929 Ga0207664_10000001 Ga0207664_10000001662 248
286 3300044683 Ga0466965_0135139 Ga0466965_0135139_255_1085 248
287 3300044901 Ga0466960_0015879 Ga0466960_0015879_2167_2997 248
288 3300048903 Ga0496100_0024791 Ga0496100_0024791_1062_1901 248
289 3300048905 Ga0496102_0029467 Ga0496102_0029467_1104_1943 248
290 3300048910 Ga0496107_0100632 Ga0496107_0100632_965_1804 248
291 3300048917 Ga0496114_0276212 Ga0496114_0276212_131_970 248
292 3300005563 Ga0068855_100634708 Ga0068855_1006347082 249
293 3300009093 Ga0105240_10157686 Ga0105240_101576862 249
294 3300025944 Ga0207661_10543541 Ga0207661_105435412 249
295 3300053153 Ga0500616_0002672 Ga0500616_0002672_5718_6551 249
296 3300044901 Ga0466960_0085862 Ga0466960_0085862_448_1308 250
297 3300046492 Ga0495585_0025076 Ga0495585_0025076_1485_2327 250
298 3300005337 Ga0070682_100036386 Ga0070682_1000363862 251
299 3300005339 Ga0070660_100087472 Ga0070660_1000874722 251
300 3300005343 Ga0070687_100014039 Ga0070687_1000140392 251
301 3300005364 Ga0070673_100076513 Ga0070673_1000765136 251
302 3300005437 Ga0070710_10207460 Ga0070710_102074602 251
303 3300005438 Ga0070701_10043739 Ga0070701_100437391 251
304 3300005439 Ga0070711_100021500 Ga0070711_1000215002 251
305 3300005440 Ga0070705_100072342 Ga0070705_1000723425 251
306 3300005444 Ga0070694_100008942 Ga0070694_1000089423 251
307 3300005455 Ga0070663_100021522 Ga0070663_1000215222 251
308 3300005544 Ga0070686_100056157 Ga0070686_1000561574 251
309 3300005545 Ga0070695_100002879 Ga0070695_10000287917 251
310 3300005548 Ga0070665_100051535 Ga0070665_1000515353 251
311 3300005549 Ga0070704_100015944 Ga0070704_1000159442 251
312 3300005563 Ga0068855_100039145 Ga0068855_1000391453 251
313 3300005616 Ga0068852_100020128 Ga0068852_1000201283 251
314 3300005617 Ga0068859_100338634 Ga0068859_1003386343 251
315 3300005840 Ga0068870_10153449 Ga0068870_101534491 251
316 3300005841 Ga0068863_100090427 Ga0068863_1000904272 251
317 3300005842 Ga0068858_100126946 Ga0068858_1001269462 251
318 3300005983 Ga0081540_1012338 Ga0081540_10123384 251
319 3300006163 Ga0070715_10031166 Ga0070715_100311665 251
320 3300006871 Ga0075434_100077091 Ga0075434_1000770918 251
321 3300006881 Ga0068865_100116280 Ga0068865_1001162803 251
322 3300006914 Ga0075436_100048777 Ga0075436_1000487775 251
323 3300006931 Ga0097620_100338636 Ga0097620_1003386362 251
324 3300009094 Ga0111539_10382543 Ga0111539_103825433 251
325 3300009101 Ga0105247_10007755 Ga0105247_100077555 251
326 3300009148 Ga0105243_10115929 Ga0105243_101159295 251
327 3300009176 Ga0105242_10033344 Ga0105242_100333442 251
328 3300009553 Ga0105249_10020700 Ga0105249_100207005 251
329 3300010375 Ga0105239_10064777 Ga0105239_100647773 251
330 3300011119 Ga0105246_10018858 Ga0105246_100188582 251
331 3300013100 Ga0157373_10159638 Ga0157373_101596382 251
332 3300013104 Ga0157370_10143916 Ga0157370_101439162 251
333 3300013306 Ga0163162_10015732 Ga0163162_1001573213 251
334 3300013308 Ga0157375_10156267 Ga0157375_101562672 251
335 3300014745 Ga0157377_10123487 Ga0157377_101234872 251
336 3300014968 Ga0157379_10034122 Ga0157379_100341226 251
337 3300014969 Ga0157376_10044605 Ga0157376_100446052 251
338 3300020081 Ga0206354_10367004 Ga0206354_103670041 251
339 3300025898 Ga0207692_10153500 Ga0207692_101535002 251
340 3300025905 Ga0207685_10039370 Ga0207685_100393702 251
341 3300025908 Ga0207643_10031171 Ga0207643_100311712 251
342 3300025914 Ga0207671_10217000 Ga0207671_102170002 251
343 3300025918 Ga0207662_10061077 Ga0207662_100610773 251
344 3300025919 Ga0207657_10005909 Ga0207657_1000590910 251
345 3300025926 Ga0207659_10293083 Ga0207659_102930832 251
346 3300025928 Ga0207700_10085171 Ga0207700_100851712 251
347 3300025929 Ga0207664_10027180 Ga0207664_100271808 251
348 3300025935 Ga0207709_10015782 Ga0207709_100157822 251
349 3300025941 Ga0207711_10142354 Ga0207711_101423546 251
350 3300025949 Ga0207667_10013390 Ga0207667_100133905 251
351 3300025961 Ga0207712_10005635 Ga0207712_100056359 251
352 3300025972 Ga0207668_10078512 Ga0207668_100785122 251
353 3300026023 Ga0207677_10051348 Ga0207677_100513485 251
354 3300026035 Ga0207703_10193733 Ga0207703_101937332 251
355 3300026067 Ga0207678_10011366 Ga0207678_100113664 251
356 3300026088 Ga0207641_10017172 Ga0207641_100171729 251
357 3300026089 Ga0207648_10149494 Ga0207648_101494942 251
358 3300026118 Ga0207675_100017948 Ga0207675_1000179489 251
359 3300026121 Ga0207683_10016445 Ga0207683_100164456 251
360 3300026142 Ga0207698_10068690 Ga0207698_100686902 251
361 3300028379 Ga0268266_10177337 Ga0268266_101773373 251
362 3300028381 Ga0268264_10548932 Ga0268264_105489321 251
363 3300035090 Ga0373949_0007635 Ga0373949_0007635_1289_2116 251
364 3300035112 Ga0373932_0003320 Ga0373932_0003320_914_1741 251
365 3300035207 Ga0373942_0017557 Ga0373942_0017557_550_1377 251
366 3300035242 Ga0373962_0005576 Ga0373962_0005576_792_1619 251
367 3300048903 Ga0496100_0058941 Ga0496100_0058941_406_1233 251
368 3300048907 Ga0496104_0082937 Ga0496104_0082937_1285_2112 251
369 3300048909 Ga0496106_0032907 Ga0496106_0032907_1222_2049 251
370 3300048910 Ga0496107_0012323 Ga0496107_0012323_4168_4995 251
371 3300048911 Ga0496108_0005652 Ga0496108_0005652_4386_5213 251
372 3300048912 Ga0496109_0004809 Ga0496109_0004809_4374_5201 251
373 3300048913 Ga0496110_0054796 Ga0496110_0054796_2200_3027 251
374 3300048915 Ga0496112_0061846 Ga0496112_0061846_2779_3606 251
375 3300048917 Ga0496114_0062474 Ga0496114_0062474_1598_2425 251
376 3300048918 Ga0496115_0030751 Ga0496115_0030751_2355_3182 251
377 3300050512 nmdc:mga0n895_61893_c1 nmdc:mga0n895_61893_c1_1684_2511 251
378 3300050515 nmdc:mga0a205_70009_c1 nmdc:mga0a205_70009_c1_1956_2783 251
379 3300031731 Ga0307405_10138119 Ga0307405_101381192 252
380 3300031903 Ga0307407_10086450 Ga0307407_100864502 252
381 3300032002 Ga0307416_100104183 Ga0307416_1001041832 252
382 3300000549 LJQas_1006643 LJQas_10066432 253
383 3300006051 Ga0075364_10291508 Ga0075364_102915082 253
384 3300031824 Ga0307413_10505508 Ga0307413_105055081 253
385 3300031903 Ga0307407_10064268 Ga0307407_100642682 253
386 3300031995 Ga0307409_100073356 Ga0307409_1000733562 253

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d6x-assembly1.cif.gz_C mycobacterium smegmatis sdh1 complex in the apo form 0.5537 14 253
7d6x-assembly1.cif.gz_C mycobacterium smegmatis sdh1 complex in the apo form 0.5298 14 253
5m8k-assembly1.cif.gz_A crystal structure of eremococcus coleocola manganese transporter mutant e129q 0.5127 138 223
5m8j-assembly1.cif.gz_A crystal structure of eremococcus coleocola manganese transporter mutant h236a 0.508 138 223
5m8a-assembly1.cif.gz_A crystal structure of eremococcus coleocola manganese transporter mutant e129a 0.508 138 223
ID Description Score Start End Superfamily
af_Q6YUB6_1_109_1.20.85.10 Mainly Alpha;Up-down Bundle;Photosynthetic Reaction Center, subunit M; domain 1;Photosystem II protein D1-like 0.5211 91 197 1.20.85.10
af_I1JTC6_1_533_2.60.40.3590 Mainly Beta;Sandwich;Immunoglobulin-like; 0.4857 135 211 2.60.40.3590
af_Q6YUB6_1_109_1.20.85.10 Mainly Alpha;Up-down Bundle;Photosynthetic Reaction Center, subunit M; domain 1;Photosystem II protein D1-like 0.4513 91 197 1.20.85.10
6nbxE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4273 151 249 1.10.287.3510
af_Q1MTA6_1_104_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.4131 148 247 1.20.120.350
ID Description Score Start End GO Terms
AF-A0A6J4K809-F1-model_v4 Putative succinate dehydrogenase [membrane anchor subunit] (Succinic dehydrogenase) 0.6125 51 253 GO:0016020
AF-A0A7I9X158-F1-model_v4 deleted 0.5989 47 253
AF-A0A7K0SY00-F1-model_v4 Succinate dehydrogenase 0.5948 14 204 GO:0016020
AF-A0A511MFC2-F1-model_v4 Succinate dehydrogenase membrane anchor subunit 0.5945 43 252 GO:0016020
AF-A0A1R3UFD0-F1-model_v4 Putative succinate dehydrogenase [membrane anchor subunit] (Succinic dehydrogenase) 0.5931 45 252 GO:0016020

Feature Viewer

pLDDT pTM Quality
72.89 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map