F430529

General Info

Members Datasets Scaffolds Average Seq Length
386 255 377 177

Family's Representative Sequence

Representative Sequence 3300025917|Ga0207660_10681363|Ga0207660_106813631
Length 193
Sequence MADAVFDGCNVDAVRFASVVAAQAVWRNCKMLNATFADIRGFGFEFASCVLMYADLRGLQWLAAGEMEMKLGAPFELTWRNDELTSPPGERPPGFSEEHRMQSRITEFDPPRKLAITWGNSGDVSFELEPRGKDVLLTVIHRRLPDRNMMLMVGAGWHMHLDILVARVSGNAPEPFWDGWSRLKKEYDRRIPV

Samples

Sample ID Description Type Environment
1 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
2 2773857925 Microvirga vignae BR3299 Isolate Unclassified
3 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
4 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
5 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
6 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
146 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
164 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
165 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
166 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
169 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
170 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
171 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
172 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
240 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
241 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
242 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
243 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
244 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
245 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
247 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
248 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
254 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
255 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.15
Metatranscriptomes 0.52
Isolates 2.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.36
Nodule 1.55
Rhizoplane 9.59
Rhizosphere 71.5
Stem 0
Stem Tuber 0
Unclassified 6.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10003225 3300002075 Bacteria 4160
2 JGI25162J39368_1001151 3300002737 Bacteria 15806
3 JGI25164J39214_1000193 3300002772 Bacteria 52696
4 rootH1_10174197 3300003316 Bacteria 1096
5 rootL2_10236707 3300003322 Bacteria 1300
6 rootH1_10231992 3300003323 Bacteria 1419
7 Ga0058860_12178044 3300004801 Bacteria 988
8 Ga0065707_10421409 3300005295 Bacteria 830
9 Ga0070683_100130317 3300005329 Bacteria 2380
10 Ga0070683_100428442 3300005329 Bacteria 1262
11 Ga0070670_100812727 3300005331 Bacteria 845
12 Ga0068869_100047250 3300005334 Bacteria 3108
13 Ga0068869_100053370 3300005334 Bacteria 2938
14 Ga0068869_100494093 3300005334 Bacteria 1020
15 Ga0070680_101067210 3300005336 Bacteria 698
16 Ga0068868_100063863 3300005338 Bacteria 2921
17 Ga0068868_100274248 3300005338 Bacteria 1426
18 Ga0068868_100832378 3300005338 Bacteria 835
19 Ga0070691_10035037 3300005341 Bacteria 2363
20 Ga0070661_100048258 3300005344 Bacteria 3117
21 Ga0070668_100105051 3300005347 Bacteria 2242
22 Ga0070668_100381051 3300005347 Bacteria 1200
23 Ga0070668_100501797 3300005347 Bacteria 1050
24 Ga0070668_100747492 3300005347 Bacteria 865
25 Ga0070669_100112979 3300005353 Bacteria 2063
26 Ga0070671_101290260 3300005355 Bacteria 644
27 Ga0070674_100769072 3300005356 Bacteria 829
28 Ga0070674_100880089 3300005356 Bacteria 779
29 Ga0070688_100435973 3300005365 Bacteria 977
30 Ga0070659_101168309 3300005366 Bacteria 680
31 Ga0070667_100355692 3300005367 Bacteria 1326
32 Ga0070703_10054589 3300005406 Bacteria 1288
33 Ga0070700_100021626 3300005441 Bacteria 3741
34 Ga0070700_100254945 3300005441 Bacteria 1260
35 Ga0070700_101307380 3300005441 Bacteria 609
36 Ga0070694_100031710 3300005444 Bacteria 3466
37 Ga0070663_100051996 3300005455 Bacteria 2921
38 Ga0070663_100254872 3300005455 Bacteria 1390
39 Ga0070678_100125128 3300005456 Bacteria 2034
40 Ga0070678_100416165 3300005456 Bacteria 1171
41 Ga0070678_100528562 3300005456 Bacteria 1044
42 Ga0070678_100626595 3300005456 Bacteria 963
43 Ga0070662_100222845 3300005457 Bacteria 1505
44 Ga0070662_100876818 3300005457 Bacteria 765
45 Ga0068867_100906400 3300005459 Bacteria 794
46 Ga0070706_100455894 3300005467 Bacteria 1190
47 Ga0070698_100293861 3300005471 Bacteria 1556
48 Ga0070699_100487709 3300005518 Bacteria 1119
49 Ga0068853_100608909 3300005539 Bacteria 1038
50 Ga0070672_100595062 3300005543 Bacteria 963
51 Ga0070695_100078798 3300005545 Bacteria 2173
52 Ga0070695_100094243 3300005545 Bacteria 2005
53 Ga0070695_101029943 3300005545 Bacteria 671
54 Ga0070665_100046153 3300005548 Bacteria 4377
55 Ga0070665_100073593 3300005548 Bacteria 3422
56 Ga0070665_100328621 3300005548 Bacteria 1533
57 Ga0070665_100960152 3300005548 Bacteria 867
58 Ga0070704_100295305 3300005549 Bacteria 1348
59 Ga0070704_100697201 3300005549 Bacteria 900
60 Ga0068855_100675962 3300005563 Bacteria 1107
61 Ga0068855_100706855 3300005563 Bacteria 1078
62 Ga0068855_101597146 3300005563 Bacteria 667
63 Ga0070664_100206453 3300005564 Bacteria 1755
64 Ga0070664_100663006 3300005564 Bacteria 970
65 Ga0068856_100543864 3300005614 Bacteria 1182
66 Ga0068856_100634928 3300005614 Bacteria 1089
67 Ga0070702_100754085 3300005615 Bacteria 748
68 Ga0068852_100467065 3300005616 Bacteria 1252
69 Ga0068864_100652737 3300005618 Bacteria 1025
70 Ga0068861_100433019 3300005719 Bacteria 1174
71 Ga0068851_10097064 3300005834 Bacteria 1559
72 Ga0068863_100807268 3300005841 Bacteria 936
73 Ga0068858_100382915 3300005842 Bacteria 1350
74 Ga0068858_100865987 3300005842 Bacteria 883
75 Ga0068860_100058307 3300005843 Bacteria 3670
76 Ga0068862_100099473 3300005844 Bacteria 2542
77 Ga0068862_100310415 3300005844 Bacteria 1453
78 Ga0068862_101078336 3300005844 Bacteria 797
79 Ga0068862_101430720 3300005844 Bacteria 695
80 Ga0081455_10017797 3300005937 Bacteria 6795
81 Ga0081455_10022968 3300005937 Bacteria 5815
82 Ga0081455_10135688 3300005937 Bacteria 1918
83 Ga0081540_1000148 3300005983 Bacteria 72453
84 Ga0081540_1000979 3300005983 Bacteria 25757
85 Ga0081540_1012271 3300005983 Bacteria 5659
86 Ga0081540_1025686 3300005983 Bacteria 3382
87 Ga0081540_1063002 3300005983 Bacteria 1757
88 Ga0081539_10001260 3300005985 Bacteria 44845
89 Ga0081539_10207548 3300005985 Bacteria 900
90 Ga0075365_10274210 3300006038 Bacteria 1186
91 Ga0075363_100125896 3300006048 Bacteria 1434
92 Ga0070715_10029524 3300006163 Bacteria 2209
93 Ga0075362_10025552 3300006177 Bacteria 2516
94 Ga0075362_10095431 3300006177 Bacteria 1385
95 Ga0075367_10537799 3300006178 Bacteria 742
96 Ga0075366_10011727 3300006195 Bacteria 4954
97 Ga0075366_10383923 3300006195 Bacteria 864
98 Ga0075370_10100349 3300006353 Bacteria 1675
99 Ga0075370_10160957 3300006353 Bacteria 1317
100 Ga0068871_100313747 3300006358 Bacteria 1379
101 Ga0075428_101822908 3300006844 Bacteria 633
102 Ga0068865_100639756 3300006881 Bacteria 903
103 Ga0075436_100347129 3300006914 Bacteria 1069
104 Ga0099794_10029915 3300007265 Bacteria 2539
105 Ga0105250_10066211 3300009092 Bacteria 1457
106 Ga0111539_10640553 3300009094 Bacteria 1238
107 Ga0111539_10935564 3300009094 Bacteria 1008
108 Ga0111539_11435268 3300009094 Bacteria 800
109 Ga0114129_10551328 3300009147 Bacteria 1499
110 Ga0105243_10043670 3300009148 Bacteria 3513
111 Ga0105243_10334288 3300009148 Bacteria 1385
112 Ga0105243_10792284 3300009148 Bacteria 933
113 Ga0105243_11118487 3300009148 Bacteria 797
114 Ga0105243_11768842 3300009148 Bacteria 648
115 Ga0105248_10183949 3300009177 Bacteria 2355
116 Ga0105237_10143553 3300009545 Bacteria 2382
117 Ga0105237_10283307 3300009545 Bacteria 1660
118 Ga0105237_10932727 3300009545 Bacteria 875
119 Ga0105238_10344241 3300009551 Bacteria 1479
120 Ga0105249_10201100 3300009553 Bacteria 1950
121 Ga0105249_10307212 3300009553 Bacteria 1593
122 Ga0105239_10199511 3300010375 Bacteria 2241
123 Ga0105239_10266390 3300010375 Bacteria 1926
124 Ga0105239_11196526 3300010375 Bacteria 876
125 Ga0105246_10045169 3300011119 Bacteria 2998
126 Ga0157374_10027588 3300013296 Bacteria 5125
127 Ga0157378_10851632 3300013297 Bacteria 940
128 Ga0157378_11984127 3300013297 Bacteria 632
129 Ga0163162_10437316 3300013306 Bacteria 1440
130 Ga0163162_10549910 3300013306 Bacteria 1283
131 Ga0163162_12185759 3300013306 Bacteria 635
132 Ga0157375_10030201 3300013308 Bacteria 5107
133 Ga0157375_10955051 3300013308 Bacteria 999
134 Ga0163163_10064285 3300014325 Bacteria 3641
135 Ga0157380_10025926 3300014326 Bacteria 4448
136 Ga0182008_10000810 3300014497 Bacteria 21837
137 Ga0157379_10497993 3300014968 Bacteria 1129
138 Ga0157379_11789337 3300014968 Bacteria 603
139 Ga0157376_10024633 3300014969 Bacteria 4728
140 Ga0157376_10390975 3300014969 Bacteria 1342
141 Ga0182005_1156074 3300015265 Bacteria 667
142 Ga0163161_10120353 3300017792 Bacteria 1972
143 Ga0206350_11660383 3300020080 Bacteria 2533
144 Ga0213872_10089183 3300021361 Bacteria 1381
145 Ga0213872_10132995 3300021361 Bacteria 1095
146 Ga0213876_10212607 3300021384 Unclassified 1028
147 Ga0207427_100117 3300025231 Bacteria 102251
148 Ga0209437_100240 3300025233 Bacteria 89740
149 Ga0209233_1000083 3300025261 Bacteria 336016
150 Ga0207697_10038795 3300025315 Bacteria 1954
151 Ga0207696_1049003 3300025711 Bacteria 1213
152 Ga0207653_10032057 3300025885 Bacteria 1699
153 Ga0207710_10202419 3300025900 Bacteria 981
154 Ga0207688_10047012 3300025901 Bacteria 2410
155 Ga0207688_10061352 3300025901 Bacteria 2119
156 Ga0207671_10587658 3300025914 Bacteria 887
157 Ga0207671_10813631 3300025914 Bacteria 741
158 Ga0207660_10681363 3300025917 Bacteria 838
159 Ga0207646_10011491 3300025922 Bacteria 8570
160 Ga0207650_10263137 3300025925 Bacteria 1399
161 Ga0207650_10485887 3300025925 Bacteria 1031
162 Ga0207644_10329018 3300025931 Bacteria 1237
163 Ga0207706_10305526 3300025933 Bacteria 1385
164 Ga0207686_11056239 3300025934 Bacteria 661
165 Ga0207709_10576534 3300025935 Bacteria 888
166 Ga0207670_10403921 3300025936 Bacteria 1093
167 Ga0207669_10235584 3300025937 Bacteria 1354
168 Ga0207669_10725454 3300025937 Bacteria 819
169 Ga0207704_10278097 3300025938 Bacteria 1271
170 Ga0207704_10587683 3300025938 Bacteria 910
171 Ga0207691_10454849 3300025940 Bacteria 1089
172 Ga0207691_10527894 3300025940 Bacteria 1001
173 Ga0207711_10073640 3300025941 Bacteria 2969
174 Ga0207689_10160397 3300025942 Bacteria 1853
175 Ga0207689_10297983 3300025942 Bacteria 1336
176 Ga0207689_10425449 3300025942 Bacteria 1108
177 Ga0207661_10297149 3300025944 Bacteria 1447
178 Ga0207679_10198387 3300025945 Bacteria 1675
179 Ga0207679_10399379 3300025945 Bacteria 1209
180 Ga0207667_10816125 3300025949 Bacteria 929
181 Ga0207668_10249532 3300025972 Bacteria 1440
182 Ga0207668_10287895 3300025972 Bacteria 1350
183 Ga0207668_10527224 3300025972 Bacteria 1020
184 Ga0207668_11022605 3300025972 Bacteria 739
185 Ga0207668_11127039 3300025972 Bacteria 704
186 Ga0207640_10472158 3300025981 Bacteria 1038
187 Ga0207658_10221913 3300025986 Bacteria 1591
188 Ga0207658_10274157 3300025986 Bacteria 1443
189 Ga0207677_10870309 3300026023 Bacteria 811
190 Ga0207703_10522624 3300026035 Bacteria 1116
191 Ga0207639_10111224 3300026041 Bacteria 2233
192 Ga0207639_10187071 3300026041 Bacteria 1766
193 Ga0207639_10882757 3300026041 Bacteria 835
194 Ga0207678_10102778 3300026067 Bacteria 2439
195 Ga0207678_10290402 3300026067 Bacteria 1404
196 Ga0207708_10065009 3300026075 Bacteria 2788
197 Ga0207708_10185487 3300026075 Bacteria 1653
198 Ga0207708_10530929 3300026075 Bacteria 990
199 Ga0207648_10360956 3300026089 Bacteria 1311
200 Ga0207676_10815319 3300026095 Bacteria 911
201 Ga0207674_10471329 3300026116 Bacteria 1213
202 Ga0207675_100253441 3300026118 Bacteria 1704
203 Ga0207683_10080802 3300026121 Bacteria 2884
204 Ga0207683_10133664 3300026121 Bacteria 2232
205 Ga0207683_10636436 3300026121 Bacteria 988
206 Ga0207698_10406772 3300026142 Bacteria 1302
207 Ga0268266_10087506 3300028379 Bacteria 2725
208 Ga0268265_10220054 3300028380 Bacteria 1660
209 Ga0268265_10229154 3300028380 Bacteria 1631
210 Ga0268265_10435715 3300028380 Bacteria 1220
211 Ga0268264_10159005 3300028381 Bacteria 2033
212 Ga0268264_10401948 3300028381 Bacteria 1317
213 Ga0307513_10107068 3300031456 Bacteria 2800
214 Ga0307508_10059483 3300031616 Bacteria 3380
215 Ga0307516_10119492 3300031730 Bacteria 2428
216 Ga0307405_10235022 3300031731 Bacteria 1354
217 Ga0307407_10668259 3300031903 Bacteria 780
218 Ga0307412_10002906 3300031911 Bacteria 9499
219 Ga0307412_10832179 3300031911 Bacteria 804
220 Ga0307409_100308040 3300031995 Bacteria 1477
221 Ga0307414_11371129 3300032004 Bacteria 657
222 Ga0373940_0191223 3300035088 Bacteria 669
223 Ga0373944_0034898 3300035089 Bacteria 1531
224 Ga0373945_0255504 3300035116 Bacteria 741
225 Ga0373956_0551972 3300035119 Bacteria 550
226 Ga0373946_0263634 3300035171 Bacteria 844
227 Ga0373955_0387105 3300035172 Bacteria 849
228 Ga0373931_0046758 3300035691 Bacteria 2288
229 Ga0373935_0541117 3300035692 Bacteria 848
230 Ga0373927_0094486 3300035695 Bacteria 1943
231 Ga0373927_0199359 3300035695 Bacteria 1314
232 Ga0373947_0039871 3300035725 Bacteria 2796
233 Ga0373925_0158018 3300037068 Bacteria 1784
234 Ga0395905_0163421 3300037471 Bacteria 2092
235 Ga0436364_0527268 3300037853 Bacteria 2616
236 Ga0400487_55644 3300039110 Bacteria 47406
237 Ga0436365_0528080 3300039437 Bacteria 746
238 Ga0436365_0893102 3300039437 Bacteria 2433
239 Ga0436365_1710452 3300039437 Bacteria 1356
240 Ga0436360_0491560 3300039438 Bacteria 2138
241 Ga0436361_0021088 3300039447 Bacteria 903
242 Ga0436361_0319352 3300039447 Bacteria 3090
243 Ga0436363_0732078 3300039450 Bacteria 895
244 Ga0436363_1055151 3300039450 Bacteria 789
245 Ga0436363_1265736 3300039450 Bacteria 814
246 Ga0439461_0036234 3300041410 Bacteria 1050
247 Ga0439465_0057666 3300041413 Bacteria 1282
248 Ga0439465_0091180 3300041413 Bacteria 1043
249 Ga0451789_0820835 3300041443 Bacteria 1026
250 Ga0451800_0416645 3300041459 Bacteria 844
251 Ga0451807_0789280 3300041486 Bacteria 1657
252 Ga0451807_1660569 3300041486 Bacteria 1121
253 Ga0451851_0303893 3300041507 Bacteria 978
254 Ga0451843_0248520 3300041509 Bacteria 793
255 Ga0439455_0067155 3300042012 Bacteria 959
256 Ga0450908_000373 3300042184 Bacteria 8687
257 Ga0450918_030778 3300042531 Bacteria 948
258 Ga0466960_0083538 3300044901 Bacteria 1614
259 Ga0495603_0123284 3300046455 Bacteria 1510
260 Ga0495638_0000281 3300046460 Bacteria 68208
261 Ga0495580_0369674 3300046472 Bacteria 970
262 Ga0495639_0049129 3300046475 Bacteria 1915
263 Ga0495639_0400045 3300046475 Bacteria 694
264 Ga0495584_0329056 3300046491 Bacteria 776
265 Ga0495585_0005835 3300046492 Bacteria 7721
266 Ga0495594_0109004 3300046499 Bacteria 1561
267 Ga0495607_0157832 3300046501 Bacteria 1155
268 Ga0495606_0454236 3300046507 Bacteria 656
269 Ga0495610_0000537 3300046512 Bacteria 38080
270 Ga0495610_0064166 3300046512 Bacteria 1737
271 Ga0495620_0029098 3300046515 Bacteria 2561
272 Ga0495620_0204784 3300046515 Bacteria 758
273 Ga0495628_0397733 3300046516 Bacteria 1007
274 Ga0495630_0136516 3300046517 Bacteria 1864
275 Ga0495631_0000853 3300046518 Bacteria 19290
276 Ga0495632_0029481 3300046519 Bacteria 2857
277 Ga0495632_0094829 3300046519 Bacteria 1411
278 Ga0495632_0209356 3300046519 Bacteria 885
279 Ga0495637_0103705 3300046520 Bacteria 1109
280 Ga0495654_0200255 3300046530 Bacteria 855
281 Ga0495609_0016236 3300046538 Bacteria 3469
282 Ga0495609_0215367 3300046538 Bacteria 799
283 Ga0495668_0005651 3300046616 Bacteria 8387
284 Ga0495611_0036778 3300046648 Bacteria 2174
285 Ga0495625_0002937 3300046660 Bacteria 17782
286 Ga0495625_0025846 3300046660 Bacteria 4445
287 Ga0495625_0194091 3300046660 Bacteria 1343
288 Ga0495625_0685038 3300046660 Bacteria 607
289 Ga0495635_0663725 3300046663 Bacteria 678
290 Ga0495588_0074284 3300046674 Bacteria 1771
291 Ga0495670_0013555 3300046691 Bacteria 4009
292 Ga0495670_0054121 3300046691 Bacteria 2010
293 Ga0495649_0008916 3300046694 Bacteria 6002
294 Ga0495660_0168551 3300046810 Bacteria 1068
295 Ga0495672_0013205 3300047320 Bacteria 5710
296 Ga0495672_0039948 3300047320 Bacteria 2849
297 Ga0495676_0159101 3300047321 Bacteria 1600
298 Ga0495676_0311217 3300047321 Bacteria 1060
299 Ga0495683_0057509 3300047323 Bacteria 1933
300 Ga0495686_0000458 3300047472 Bacteria 61256
301 Ga0495686_0132191 3300047472 Bacteria 1479
302 Ga0495593_0249514 3300047673 Bacteria 889
303 Ga0495614_0238079 3300048089 Bacteria 831
304 Ga0496100_0012436 3300048903 Bacteria 4880
305 Ga0496100_0173032 3300048903 Bacteria 1557
306 Ga0496101_0083035 3300048904 Bacteria 2371
307 Ga0496102_0042363 3300048905 Bacteria 4125
308 Ga0496102_0436959 3300048905 Bacteria 1228
309 Ga0496104_0027961 3300048907 Bacteria 5222
310 Ga0496104_0064733 3300048907 Bacteria 3468
311 Ga0496104_0097988 3300048907 Bacteria 2806
312 Ga0496105_0123698 3300048908 Bacteria 2132
313 Ga0496105_0222989 3300048908 Bacteria 1534
314 Ga0496105_0791150 3300048908 Bacteria 722
315 Ga0496106_0089086 3300048909 Bacteria 2379
316 Ga0496107_0013513 3300048910 Bacteria 5708
317 Ga0496107_0165931 3300048910 Bacteria 1637
318 Ga0496108_0000622 3300048911 Bacteria 27771
319 Ga0496108_0479031 3300048911 Bacteria 1087
320 Ga0496108_0524275 3300048911 Bacteria 1034
321 Ga0496109_0001193 3300048912 Bacteria 21610
322 Ga0496109_0058398 3300048912 Bacteria 3523
323 Ga0496109_0112647 3300048912 Bacteria 2530
324 Ga0496110_0017788 3300048913 Bacteria 5949
325 Ga0496110_0073870 3300048913 Bacteria 3027
326 Ga0496110_0275707 3300048913 Bacteria 1531
327 Ga0496110_0462521 3300048913 Bacteria 1156
328 Ga0496111_0079953 3300048914 Bacteria 2385
329 Ga0496111_0117449 3300048914 Bacteria 1962
330 Ga0496112_0084455 3300048915 Bacteria 3140
331 Ga0496112_0169256 3300048915 Bacteria 2150
332 Ga0496113_0007933 3300048916 Bacteria 6874
333 Ga0496113_0181933 3300048916 Bacteria 1666
334 Ga0496114_0192549 3300048917 Bacteria 1784
335 Ga0496115_0001987 3300048918 Bacteria 14603
336 Ga0496115_0088747 3300048918 Bacteria 2525
337 Ga0496118_0309310 3300048921 Bacteria 863
338 Ga0496119_0264392 3300048922 Bacteria 862
339 Ga0496121_0034530 3300048924 Bacteria 4551
340 Ga0496121_0264657 3300048924 Bacteria 1185
341 Ga0496123_0163677 3300048926 Bacteria 1183
342 Ga0496124_0483603 3300048927 Bacteria 835
343 Ga0495682_0018880 3300049460 Bacteria 2596
344 Ga0501039_0798365 3300049575 Bacteria 736
345 Ga0501071_0232151 3300049587 Bacteria 1390
346 Ga0501076_0301924 3300049592 Bacteria 1313
347 Ga0501079_0229850 3300049741 Bacteria 1449
348 nmdc:mga03683_25844_c2 3300050489 Bacteria 1908
349 nmdc:mga03n38_102687_c1 3300050490 Bacteria 1381
350 nmdc:mga0k408_16850_c1 3300050493 Bacteria 4062
351 nmdc:mga07m45_154131_c1 3300050496 Bacteria 1332
352 nmdc:mga07m45_207633_c1 3300050496 Bacteria 1139
353 nmdc:mga07m45_235693_c1 3300050496 Bacteria 1065
354 nmdc:mga07m45_681654_c1 3300050496 Bacteria 592
355 nmdc:mga08x19_456357_c1 3300050514 Bacteria 900
356 nmdc:mga0sz30_47976_c1 3300050516 Bacteria 1806
357 Ga0500610_0024180 3300053079 Bacteria 3017
358 Ga0500610_0097076 3300053079 Bacteria 1528
359 Ga0500610_0163140 3300053079 Bacteria 1107
360 Ga0495619_0642152 3300053085 Bacteria 724
361 Ga0500578_0207280 3300053086 Bacteria 1197
362 Ga0500557_000496 3300053105 Bacteria 5245
363 Ga0500562_030938 3300053108 Bacteria 1412
364 Ga0500569_001770 3300053109 Bacteria 4139
365 Ga0500594_0001147 3300053118 Bacteria 5697
366 Ga0500652_200462 3300053131 Bacteria 810
367 Ga0500658_0034459 3300053134 Bacteria 1998
368 Ga0500658_0075845 3300053134 Bacteria 1428
369 Ga0500568_0000209 3300053139 Bacteria 51143
370 Ga0500568_0001014 3300053139 Bacteria 19226
371 Ga0500577_0022341 3300053142 Bacteria 2098
372 Ga0500577_0167060 3300053142 Bacteria 940
373 Ga0500588_0243270 3300053146 Bacteria 674
374 Ga0500616_0000485 3300053153 Bacteria 51609
375 Ga0500611_018525 3300053727 Bacteria 1285
376 Ga0501084_0481145 3300054114 Bacteria 1049
377 Ga0501082_0601489 3300060353 Bacteria 962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_101822908 Ga0075428_1018229081 156
2 3300046491 Ga0495584_0329056 Ga0495584_0329056_245_757 156
3 3300035119 Ga0373956_0551972 Ga0373956_0551972_14_493 159
4 3300046507 Ga0495606_0454236 Ga0495606_0454236_149_640 159
5 3300035172 Ga0373955_0387105 Ga0373955_0387105_122_655 162
6 3300046538 Ga0495609_0215367 Ga0495609_0215367_269_766 165
7 3300047321 Ga0495676_0311217 Ga0495676_0311217_529_1026 165
8 3300048927 Ga0496124_0483603 Ga0496124_0483603_311_808 165
9 3300041410 Ga0439461_0036234 Ga0439461_0036234_77_592 171
10 3300046663 Ga0495635_0663725 Ga0495635_0663725_132_647 171
11 iso_pu_bacteria 2922386360 2922391179 171
12 iso_pu_bacteria 2721755755 2723844865 173
13 iso_pu_bacteria 2773857925 2774870944 173
14 iso_pu_bacteria 2842918807 2842921791 173
15 iso_pu_bacteria 2874604998 2874605416 173
16 iso_pu_bacteria 2922361189 2922365560 173
17 iso_pu_bacteria 8006964411 8006967117 173
18 iso_pu_bacteria 8006984368 8006986607 173
19 iso_pu_bacteria 8006994254 8006995812 173
20 3300005329 Ga0070683_100130317 Ga0070683_1001303173 175
21 3300005334 Ga0068869_100047250 Ga0068869_1000472503 175
22 3300005338 Ga0068868_100063863 Ga0068868_1000638635 175
23 3300005365 Ga0070688_100435973 Ga0070688_1004359731 175
24 3300005455 Ga0070663_100051996 Ga0070663_1000519963 175
25 3300005456 Ga0070678_100125128 Ga0070678_1001251282 175
26 3300005543 Ga0070672_100595062 Ga0070672_1005950622 175
27 3300005548 Ga0070665_100046153 Ga0070665_1000461534 175
28 3300005614 Ga0068856_100543864 Ga0068856_1005438642 175
29 3300005616 Ga0068852_100467065 Ga0068852_1004670652 175
30 3300005618 Ga0068864_100652737 Ga0068864_1006527372 175
31 3300005834 Ga0068851_10097064 Ga0068851_100970643 175
32 3300005985 Ga0081539_10207548 Ga0081539_102075482 175
33 3300006881 Ga0068865_100639756 Ga0068865_1006397562 175
34 3300010375 Ga0105239_10266390 Ga0105239_102663903 175
35 3300011119 Ga0105246_10045169 Ga0105246_100451694 175
36 3300013296 Ga0157374_10027588 Ga0157374_100275884 175
37 3300013308 Ga0157375_10030201 Ga0157375_100302011 175
38 3300014325 Ga0163163_10064285 Ga0163163_100642853 175
39 3300014968 Ga0157379_10497993 Ga0157379_104979932 175
40 3300014969 Ga0157376_10024633 Ga0157376_100246338 175
41 3300017792 Ga0163161_10120353 Ga0163161_101203533 175
42 3300025315 Ga0207697_10038795 Ga0207697_100387952 175
43 3300025901 Ga0207688_10047012 Ga0207688_100470124 175
44 3300025925 Ga0207650_10263137 Ga0207650_102631372 175
45 3300025937 Ga0207669_10725454 Ga0207669_107254542 175
46 3300025938 Ga0207704_10587683 Ga0207704_105876832 175
47 3300025940 Ga0207691_10527894 Ga0207691_105278942 175
48 3300025944 Ga0207661_10297149 Ga0207661_102971492 175
49 3300026041 Ga0207639_10187071 Ga0207639_101870713 175
50 3300026067 Ga0207678_10102778 Ga0207678_101027783 175
51 3300026095 Ga0207676_10815319 Ga0207676_108153191 175
52 3300026121 Ga0207683_10133664 Ga0207683_101336643 175
53 3300026142 Ga0207698_10406772 Ga0207698_104067723 175
54 3300041509 Ga0451843_0248520 Ga0451843_0248520_140_703 175
55 3300047673 Ga0495593_0249514 Ga0495593_0249514_133_696 175
56 3300048903 Ga0496100_0012436 Ga0496100_0012436_1533_2111 175
57 3300048905 Ga0496102_0042363 Ga0496102_0042363_776_1339 175
58 3300048907 Ga0496104_0027961 Ga0496104_0027961_1440_2018 175
59 3300048908 Ga0496105_0222989 Ga0496105_0222989_311_889 175
60 3300048909 Ga0496106_0089086 Ga0496106_0089086_1307_1885 175
61 3300048910 Ga0496107_0013513 Ga0496107_0013513_3233_3796 175
62 3300048912 Ga0496109_0058398 Ga0496109_0058398_523_1101 175
63 3300048913 Ga0496110_0017788 Ga0496110_0017788_4232_4810 175
64 3300048915 Ga0496112_0169256 Ga0496112_0169256_311_874 175
65 3300048918 Ga0496115_0001987 Ga0496115_0001987_443_1021 175
66 3300003322 rootL2_10236707 rootL2_102367072 176
67 3300005356 Ga0070674_100880089 Ga0070674_1008800892 176
68 3300005366 Ga0070659_101168309 Ga0070659_1011683091 176
69 3300006177 Ga0075362_10025552 Ga0075362_100255523 176
70 3300006195 Ga0075366_10383923 Ga0075366_103839231 176
71 3300006353 Ga0075370_10100349 Ga0075370_101003492 176
72 3300009148 Ga0105243_11118487 Ga0105243_111184871 176
73 3300010375 Ga0105239_11196526 Ga0105239_111965262 176
74 3300025934 Ga0207686_11056239 Ga0207686_110562391 176
75 3300031730 Ga0307516_10119492 Ga0307516_101194923 176
76 3300031911 Ga0307412_10832179 Ga0307412_108321791 176
77 3300041443 Ga0451789_0820835 Ga0451789_0820835_369_899 176
78 3300041486 Ga0451807_1660569 Ga0451807_1660569_339_869 176
79 3300046512 Ga0495610_0064166 Ga0495610_0064166_173_703 176
80 3300046519 Ga0495632_0209356 Ga0495632_0209356_286_816 176
81 3300046520 Ga0495637_0103705 Ga0495637_0103705_475_1005 176
82 3300046660 Ga0495625_0194091 Ga0495625_0194091_667_1197 176
83 3300046810 Ga0495660_0168551 Ga0495660_0168551_304_834 176
84 3300047472 Ga0495686_0132191 Ga0495686_0132191_800_1330 176
85 3300050489 nmdc:mga03683_25844_c2 nmdc:mga03683_25844_c2_1274_1804 176
86 3300050496 nmdc:mga07m45_207633_c1 nmdc:mga07m45_207633_c1_459_989 176
87 3300053134 Ga0500658_0075845 Ga0500658_0075845_434_964 176
88 3300002075 JGI24738J21930_10003225 JGI24738J21930_100032254 177
89 3300002737 JGI25162J39368_1001151 JGI25162J39368_100115112 177
90 3300002772 JGI25164J39214_1000193 JGI25164J39214_10001937 177
91 3300003316 rootH1_10174197 rootH1_101741971 177
92 3300003323 rootH1_10231992 rootH1_102319921 177
93 3300004801 Ga0058860_12178044 Ga0058860_121780442 177
94 3300005295 Ga0065707_10421409 Ga0065707_104214091 177
95 3300005329 Ga0070683_100428442 Ga0070683_1004284422 177
96 3300005331 Ga0070670_100812727 Ga0070670_1008127272 177
97 3300005334 Ga0068869_100053370 Ga0068869_1000533703 177
98 3300005334 Ga0068869_100494093 Ga0068869_1004940932 177
99 3300005336 Ga0070680_101067210 Ga0070680_1010672101 177
100 3300005338 Ga0068868_100274248 Ga0068868_1002742482 177
101 3300005338 Ga0068868_100832378 Ga0068868_1008323782 177
102 3300005341 Ga0070691_10035037 Ga0070691_100350372 177
103 3300005344 Ga0070661_100048258 Ga0070661_1000482585 177
104 3300005347 Ga0070668_100105051 Ga0070668_1001050513 177
105 3300005347 Ga0070668_100381051 Ga0070668_1003810512 177
106 3300005347 Ga0070668_100501797 Ga0070668_1005017972 177
107 3300005347 Ga0070668_100747492 Ga0070668_1007474922 177
108 3300005353 Ga0070669_100112979 Ga0070669_1001129793 177
109 3300005355 Ga0070671_101290260 Ga0070671_1012902601 177
110 3300005356 Ga0070674_100769072 Ga0070674_1007690721 177
111 3300005367 Ga0070667_100355692 Ga0070667_1003556922 177
112 3300005406 Ga0070703_10054589 Ga0070703_100545892 177
113 3300005441 Ga0070700_100021626 Ga0070700_1000216262 177
114 3300005441 Ga0070700_100254945 Ga0070700_1002549452 177
115 3300005441 Ga0070700_101307380 Ga0070700_1013073801 177
116 3300005444 Ga0070694_100031710 Ga0070694_1000317104 177
117 3300005455 Ga0070663_100254872 Ga0070663_1002548722 177
118 3300005456 Ga0070678_100416165 Ga0070678_1004161651 177
119 3300005456 Ga0070678_100528562 Ga0070678_1005285622 177
120 3300005456 Ga0070678_100626595 Ga0070678_1006265951 177
121 3300005457 Ga0070662_100222845 Ga0070662_1002228451 177
122 3300005457 Ga0070662_100876818 Ga0070662_1008768182 177
123 3300005459 Ga0068867_100906400 Ga0068867_1009064002 177
124 3300005467 Ga0070706_100455894 Ga0070706_1004558941 177
125 3300005471 Ga0070698_100293861 Ga0070698_1002938612 177
126 3300005518 Ga0070699_100487709 Ga0070699_1004877091 177
127 3300005539 Ga0068853_100608909 Ga0068853_1006089092 177
128 3300005545 Ga0070695_100078798 Ga0070695_1000787982 177
129 3300005545 Ga0070695_100094243 Ga0070695_1000942433 177
130 3300005545 Ga0070695_101029943 Ga0070695_1010299431 177
131 3300005548 Ga0070665_100073593 Ga0070665_1000735933 177
132 3300005548 Ga0070665_100328621 Ga0070665_1003286211 177
133 3300005548 Ga0070665_100960152 Ga0070665_1009601522 177
134 3300005549 Ga0070704_100295305 Ga0070704_1002953051 177
135 3300005549 Ga0070704_100697201 Ga0070704_1006972012 177
136 3300005563 Ga0068855_100675962 Ga0068855_1006759622 177
137 3300005563 Ga0068855_100706855 Ga0068855_1007068552 177
138 3300005563 Ga0068855_101597146 Ga0068855_1015971462 177
139 3300005564 Ga0070664_100206453 Ga0070664_1002064533 177
140 3300005564 Ga0070664_100663006 Ga0070664_1006630062 177
141 3300005614 Ga0068856_100634928 Ga0068856_1006349282 177
142 3300005615 Ga0070702_100754085 Ga0070702_1007540851 177
143 3300005719 Ga0068861_100433019 Ga0068861_1004330191 177
144 3300005841 Ga0068863_100807268 Ga0068863_1008072682 177
145 3300005842 Ga0068858_100382915 Ga0068858_1003829153 177
146 3300005842 Ga0068858_100865987 Ga0068858_1008659872 177
147 3300005843 Ga0068860_100058307 Ga0068860_1000583074 177
148 3300005844 Ga0068862_100099473 Ga0068862_1000994734 177
149 3300005844 Ga0068862_100310415 Ga0068862_1003104152 177
150 3300005844 Ga0068862_101078336 Ga0068862_1010783361 177
151 3300005844 Ga0068862_101430720 Ga0068862_1014307201 177
152 3300005937 Ga0081455_10017797 Ga0081455_100177974 177
153 3300005937 Ga0081455_10022968 Ga0081455_100229684 177
154 3300005937 Ga0081455_10135688 Ga0081455_101356882 177
155 3300005983 Ga0081540_1000148 Ga0081540_100014821 177
156 3300005983 Ga0081540_1000979 Ga0081540_100097911 177
157 3300005983 Ga0081540_1012271 Ga0081540_10122714 177
158 3300005983 Ga0081540_1025686 Ga0081540_10256863 177
159 3300005983 Ga0081540_1063002 Ga0081540_10630023 177
160 3300005985 Ga0081539_10001260 Ga0081539_1000126040 177
161 3300006038 Ga0075365_10274210 Ga0075365_102742102 177
162 3300006048 Ga0075363_100125896 Ga0075363_1001258962 177
163 3300006163 Ga0070715_10029524 Ga0070715_100295243 177
164 3300006177 Ga0075362_10095431 Ga0075362_100954312 177
165 3300006178 Ga0075367_10537799 Ga0075367_105377992 177
166 3300006195 Ga0075366_10011727 Ga0075366_100117273 177
167 3300006353 Ga0075370_10160957 Ga0075370_101609571 177
168 3300006358 Ga0068871_100313747 Ga0068871_1003137472 177
169 3300006914 Ga0075436_100347129 Ga0075436_1003471292 177
170 3300007265 Ga0099794_10029915 Ga0099794_100299152 177
171 3300009092 Ga0105250_10066211 Ga0105250_100662113 177
172 3300009094 Ga0111539_10640553 Ga0111539_106405531 177
173 3300009094 Ga0111539_10935564 Ga0111539_109355641 177
174 3300009094 Ga0111539_11435268 Ga0111539_114352682 177
175 3300009147 Ga0114129_10551328 Ga0114129_105513282 177
176 3300009148 Ga0105243_10043670 Ga0105243_100436705 177
177 3300009148 Ga0105243_10334288 Ga0105243_103342882 177
178 3300009148 Ga0105243_10792284 Ga0105243_107922841 177
179 3300009148 Ga0105243_11768842 Ga0105243_117688421 177
180 3300009177 Ga0105248_10183949 Ga0105248_101839492 177
181 3300009545 Ga0105237_10143553 Ga0105237_101435532 177
182 3300009545 Ga0105237_10283307 Ga0105237_102833072 177
183 3300009545 Ga0105237_10932727 Ga0105237_109327271 177
184 3300009551 Ga0105238_10344241 Ga0105238_103442412 177
185 3300009553 Ga0105249_10201100 Ga0105249_102011002 177
186 3300009553 Ga0105249_10307212 Ga0105249_103072122 177
187 3300010375 Ga0105239_10199511 Ga0105239_101995113 177
188 3300013297 Ga0157378_10851632 Ga0157378_108516322 177
189 3300013297 Ga0157378_11984127 Ga0157378_119841271 177
190 3300013306 Ga0163162_10437316 Ga0163162_104373162 177
191 3300013306 Ga0163162_10549910 Ga0163162_105499101 177
192 3300013306 Ga0163162_12185759 Ga0163162_121857591 177
193 3300013308 Ga0157375_10955051 Ga0157375_109550512 177
194 3300014326 Ga0157380_10025926 Ga0157380_100259263 177
195 3300014497 Ga0182008_10000810 Ga0182008_1000081010 177
196 3300014968 Ga0157379_11789337 Ga0157379_117893371 177
197 3300014969 Ga0157376_10390975 Ga0157376_103909752 177
198 3300015265 Ga0182005_1156074 Ga0182005_11560741 177
199 3300020080 Ga0206350_11660383 Ga0206350_116603833 177
200 3300021361 Ga0213872_10089183 Ga0213872_100891832 177
201 3300021361 Ga0213872_10132995 Ga0213872_101329952 177
202 3300021384 Ga0213876_10212607 Ga0213876_102126071 177
203 3300025231 Ga0207427_100117 Ga0207427_10011752 177
204 3300025233 Ga0209437_100240 Ga0209437_10024060 177
205 3300025261 Ga0209233_1000083 Ga0209233_1000083275 177
206 3300025711 Ga0207696_1049003 Ga0207696_10490032 177
207 3300025885 Ga0207653_10032057 Ga0207653_100320573 177
208 3300025900 Ga0207710_10202419 Ga0207710_102024191 177
209 3300025901 Ga0207688_10061352 Ga0207688_100613523 177
210 3300025914 Ga0207671_10587658 Ga0207671_105876581 177
211 3300025914 Ga0207671_10813631 Ga0207671_108136311 177
212 3300025917 Ga0207660_10681363 Ga0207660_106813631 177
213 3300025922 Ga0207646_10011491 Ga0207646_100114918 177
214 3300025925 Ga0207650_10485887 Ga0207650_104858872 177
215 3300025931 Ga0207644_10329018 Ga0207644_103290181 177
216 3300025933 Ga0207706_10305526 Ga0207706_103055262 177
217 3300025935 Ga0207709_10576534 Ga0207709_105765342 177
218 3300025936 Ga0207670_10403921 Ga0207670_104039212 177
219 3300025937 Ga0207669_10235584 Ga0207669_102355842 177
220 3300025938 Ga0207704_10278097 Ga0207704_102780972 177
221 3300025940 Ga0207691_10454849 Ga0207691_104548492 177
222 3300025941 Ga0207711_10073640 Ga0207711_100736403 177
223 3300025942 Ga0207689_10160397 Ga0207689_101603974 177
224 3300025942 Ga0207689_10297983 Ga0207689_102979832 177
225 3300025942 Ga0207689_10425449 Ga0207689_104254492 177
226 3300025945 Ga0207679_10198387 Ga0207679_101983873 177
227 3300025945 Ga0207679_10399379 Ga0207679_103993792 177
228 3300025949 Ga0207667_10816125 Ga0207667_108161251 177
229 3300025972 Ga0207668_10249532 Ga0207668_102495322 177
230 3300025972 Ga0207668_10287895 Ga0207668_102878953 177
231 3300025972 Ga0207668_10527224 Ga0207668_105272241 177
232 3300025972 Ga0207668_11022605 Ga0207668_110226052 177
233 3300025972 Ga0207668_11127039 Ga0207668_111270391 177
234 3300025981 Ga0207640_10472158 Ga0207640_104721582 177
235 3300025986 Ga0207658_10221913 Ga0207658_102219132 177
236 3300025986 Ga0207658_10274157 Ga0207658_102741572 177
237 3300026023 Ga0207677_10870309 Ga0207677_108703091 177
238 3300026035 Ga0207703_10522624 Ga0207703_105226242 177
239 3300026041 Ga0207639_10111224 Ga0207639_101112244 177
240 3300026041 Ga0207639_10882757 Ga0207639_108827572 177
241 3300026067 Ga0207678_10290402 Ga0207678_102904022 177
242 3300026075 Ga0207708_10065009 Ga0207708_100650092 177
243 3300026075 Ga0207708_10185487 Ga0207708_101854871 177
244 3300026075 Ga0207708_10530929 Ga0207708_105309291 177
245 3300026089 Ga0207648_10360956 Ga0207648_103609562 177
246 3300026116 Ga0207674_10471329 Ga0207674_104713292 177
247 3300026118 Ga0207675_100253441 Ga0207675_1002534411 177
248 3300026121 Ga0207683_10080802 Ga0207683_100808022 177
249 3300026121 Ga0207683_10636436 Ga0207683_106364362 177
250 3300028379 Ga0268266_10087506 Ga0268266_100875064 177
251 3300028380 Ga0268265_10220054 Ga0268265_102200542 177
252 3300028380 Ga0268265_10229154 Ga0268265_102291541 177
253 3300028380 Ga0268265_10435715 Ga0268265_104357152 177
254 3300028381 Ga0268264_10159005 Ga0268264_101590053 177
255 3300028381 Ga0268264_10401948 Ga0268264_104019482 177
256 3300031456 Ga0307513_10107068 Ga0307513_101070683 177
257 3300031616 Ga0307508_10059483 Ga0307508_100594833 177
258 3300031731 Ga0307405_10235022 Ga0307405_102350221 177
259 3300031903 Ga0307407_10668259 Ga0307407_106682592 177
260 3300031911 Ga0307412_10002906 Ga0307412_100029065 177
261 3300031995 Ga0307409_100308040 Ga0307409_1003080402 177
262 3300032004 Ga0307414_11371129 Ga0307414_113711291 177
263 3300035088 Ga0373940_0191223 Ga0373940_0191223_21_554 177
264 3300035089 Ga0373944_0034898 Ga0373944_0034898_120_653 177
265 3300035116 Ga0373945_0255504 Ga0373945_0255504_183_716 177
266 3300035171 Ga0373946_0263634 Ga0373946_0263634_237_770 177
267 3300035691 Ga0373931_0046758 Ga0373931_0046758_1506_2039 177
268 3300035692 Ga0373935_0541117 Ga0373935_0541117_270_803 177
269 3300035695 Ga0373927_0094486 Ga0373927_0094486_792_1325 177
270 3300035695 Ga0373927_0199359 Ga0373927_0199359_682_1215 177
271 3300035725 Ga0373947_0039871 Ga0373947_0039871_1983_2516 177
272 3300037068 Ga0373925_0158018 Ga0373925_0158018_257_790 177
273 3300037471 Ga0395905_0163421 Ga0395905_0163421_100_633 177
274 3300037853 Ga0436364_0527268 Ga0436364_0527268_1783_2316 177
275 3300039110 Ga0400487_55644 Ga0400487_55644_11441_11974 177
276 3300039437 Ga0436365_0528080 Ga0436365_0528080_16_549 177
277 3300039437 Ga0436365_0893102 Ga0436365_0893102_1205_1738 177
278 3300039437 Ga0436365_1710452 Ga0436365_1710452_780_1313 177
279 3300039438 Ga0436360_0491560 Ga0436360_0491560_607_1140 177
280 3300039447 Ga0436361_0021088 Ga0436361_0021088_251_784 177
281 3300039447 Ga0436361_0319352 Ga0436361_0319352_2168_2701 177
282 3300039450 Ga0436363_0732078 Ga0436363_0732078_344_877 177
283 3300039450 Ga0436363_1055151 Ga0436363_1055151_13_546 177
284 3300039450 Ga0436363_1265736 Ga0436363_1265736_241_774 177
285 3300041413 Ga0439465_0057666 Ga0439465_0057666_569_1102 177
286 3300041413 Ga0439465_0091180 Ga0439465_0091180_159_692 177
287 3300041459 Ga0451800_0416645 Ga0451800_0416645_225_758 177
288 3300041486 Ga0451807_0789280 Ga0451807_0789280_918_1451 177
289 3300041507 Ga0451851_0303893 Ga0451851_0303893_174_707 177
290 3300042012 Ga0439455_0067155 Ga0439455_0067155_118_651 177
291 3300042184 Ga0450908_000373 Ga0450908_000373_7771_8304 177
292 3300042531 Ga0450918_030778 Ga0450918_030778_236_769 177
293 3300044901 Ga0466960_0083538 Ga0466960_0083538_258_791 177
294 3300046455 Ga0495603_0123284 Ga0495603_0123284_67_600 177
295 3300046460 Ga0495638_0000281 Ga0495638_0000281_49908_50453 177
296 3300046472 Ga0495580_0369674 Ga0495580_0369674_380_913 177
297 3300046475 Ga0495639_0049129 Ga0495639_0049129_1105_1638 177
298 3300046475 Ga0495639_0400045 Ga0495639_0400045_59_595 177
299 3300046492 Ga0495585_0005835 Ga0495585_0005835_4844_5389 177
300 3300046499 Ga0495594_0109004 Ga0495594_0109004_440_973 177
301 3300046501 Ga0495607_0157832 Ga0495607_0157832_590_1135 177
302 3300046512 Ga0495610_0000537 Ga0495610_0000537_8048_8581 177
303 3300046515 Ga0495620_0029098 Ga0495620_0029098_1326_1871 177
304 3300046515 Ga0495620_0204784 Ga0495620_0204784_99_644 177
305 3300046516 Ga0495628_0397733 Ga0495628_0397733_459_992 177
306 3300046517 Ga0495630_0136516 Ga0495630_0136516_767_1300 177
307 3300046518 Ga0495631_0000853 Ga0495631_0000853_18343_18888 177
308 3300046519 Ga0495632_0029481 Ga0495632_0029481_447_992 177
309 3300046519 Ga0495632_0094829 Ga0495632_0094829_38_571 177
310 3300046530 Ga0495654_0200255 Ga0495654_0200255_47_592 177
311 3300046538 Ga0495609_0016236 Ga0495609_0016236_1976_2521 177
312 3300046616 Ga0495668_0005651 Ga0495668_0005651_6249_6794 177
313 3300046648 Ga0495611_0036778 Ga0495611_0036778_1460_2005 177
314 3300046660 Ga0495625_0002937 Ga0495625_0002937_15188_15733 177
315 3300046660 Ga0495625_0025846 Ga0495625_0025846_3349_3882 177
316 3300046660 Ga0495625_0685038 Ga0495625_0685038_17_550 177
317 3300046674 Ga0495588_0074284 Ga0495588_0074284_334_867 177
318 3300046691 Ga0495670_0013555 Ga0495670_0013555_853_1386 177
319 3300046691 Ga0495670_0054121 Ga0495670_0054121_204_749 177
320 3300046694 Ga0495649_0008916 Ga0495649_0008916_5451_5984 177
321 3300047320 Ga0495672_0013205 Ga0495672_0013205_136_681 177
322 3300047320 Ga0495672_0039948 Ga0495672_0039948_105_638 177
323 3300047321 Ga0495676_0159101 Ga0495676_0159101_316_849 177
324 3300047323 Ga0495683_0057509 Ga0495683_0057509_255_800 177
325 3300047472 Ga0495686_0000458 Ga0495686_0000458_56176_56709 177
326 3300048089 Ga0495614_0238079 Ga0495614_0238079_56_589 177
327 3300048903 Ga0496100_0173032 Ga0496100_0173032_305_838 177
328 3300048904 Ga0496101_0083035 Ga0496101_0083035_1643_2176 177
329 3300048905 Ga0496102_0436959 Ga0496102_0436959_467_1000 177
330 3300048907 Ga0496104_0064733 Ga0496104_0064733_1255_1797 177
331 3300048907 Ga0496104_0097988 Ga0496104_0097988_1637_2170 177
332 3300048908 Ga0496105_0123698 Ga0496105_0123698_1008_1541 177
333 3300048908 Ga0496105_0791150 Ga0496105_0791150_178_711 177
334 3300048910 Ga0496107_0165931 Ga0496107_0165931_615_1148 177
335 3300048911 Ga0496108_0000622 Ga0496108_0000622_14048_14590 177
336 3300048911 Ga0496108_0479031 Ga0496108_0479031_116_649 177
337 3300048911 Ga0496108_0524275 Ga0496108_0524275_291_824 177
338 3300048912 Ga0496109_0001193 Ga0496109_0001193_14905_15447 177
339 3300048912 Ga0496109_0112647 Ga0496109_0112647_1548_2081 177
340 3300048913 Ga0496110_0073870 Ga0496110_0073870_2454_2996 177
341 3300048913 Ga0496110_0275707 Ga0496110_0275707_317_850 177
342 3300048913 Ga0496110_0462521 Ga0496110_0462521_378_911 177
343 3300048914 Ga0496111_0079953 Ga0496111_0079953_857_1390 177
344 3300048914 Ga0496111_0117449 Ga0496111_0117449_938_1480 177
345 3300048915 Ga0496112_0084455 Ga0496112_0084455_1211_1744 177
346 3300048916 Ga0496113_0007933 Ga0496113_0007933_490_1032 177
347 3300048916 Ga0496113_0181933 Ga0496113_0181933_1113_1646 177
348 3300048917 Ga0496114_0192549 Ga0496114_0192549_29_562 177
349 3300048918 Ga0496115_0088747 Ga0496115_0088747_586_1119 177
350 3300048921 Ga0496118_0309310 Ga0496118_0309310_106_639 177
351 3300048922 Ga0496119_0264392 Ga0496119_0264392_96_629 177
352 3300048924 Ga0496121_0034530 Ga0496121_0034530_3052_3585 177
353 3300048924 Ga0496121_0264657 Ga0496121_0264657_474_1007 177
354 3300048926 Ga0496123_0163677 Ga0496123_0163677_35_574 177
355 3300049460 Ga0495682_0018880 Ga0495682_0018880_761_1306 177
356 3300049575 Ga0501039_0798365 Ga0501039_0798365_190_723 177
357 3300049587 Ga0501071_0232151 Ga0501071_0232151_405_938 177
358 3300049592 Ga0501076_0301924 Ga0501076_0301924_355_888 177
359 3300049741 Ga0501079_0229850 Ga0501079_0229850_863_1396 177
360 3300050490 nmdc:mga03n38_102687_c1 nmdc:mga03n38_102687_c1_811_1344 177
361 3300050493 nmdc:mga0k408_16850_c1 nmdc:mga0k408_16850_c1_2417_2950 177
362 3300050496 nmdc:mga07m45_154131_c1 nmdc:mga07m45_154131_c1_25_558 177
363 3300050496 nmdc:mga07m45_235693_c1 nmdc:mga07m45_235693_c1_267_800 177
364 3300050496 nmdc:mga07m45_681654_c1 nmdc:mga07m45_681654_c1_35_568 177
365 3300050514 nmdc:mga08x19_456357_c1 nmdc:mga08x19_456357_c1_298_831 177
366 3300050516 nmdc:mga0sz30_47976_c1 nmdc:mga0sz30_47976_c1_1080_1613 177
367 3300053079 Ga0500610_0024180 Ga0500610_0024180_1939_2484 177
368 3300053079 Ga0500610_0097076 Ga0500610_0097076_62_595 177
369 3300053079 Ga0500610_0163140 Ga0500610_0163140_363_896 177
370 3300053085 Ga0495619_0642152 Ga0495619_0642152_145_678 177
371 3300053086 Ga0500578_0207280 Ga0500578_0207280_339_884 177
372 3300053105 Ga0500557_000496 Ga0500557_000496_2040_2585 177
373 3300053108 Ga0500562_030938 Ga0500562_030938_512_1057 177
374 3300053109 Ga0500569_001770 Ga0500569_001770_1459_2004 177
375 3300053118 Ga0500594_0001147 Ga0500594_0001147_4907_5452 177
376 3300053131 Ga0500652_200462 Ga0500652_200462_92_637 177
377 3300053134 Ga0500658_0034459 Ga0500658_0034459_387_932 177
378 3300053139 Ga0500568_0000209 Ga0500568_0000209_11410_11943 177
379 3300053139 Ga0500568_0001014 Ga0500568_0001014_2367_2912 177
380 3300053142 Ga0500577_0022341 Ga0500577_0022341_895_1428 177
381 3300053142 Ga0500577_0167060 Ga0500577_0167060_353_886 177
382 3300053146 Ga0500588_0243270 Ga0500588_0243270_17_562 177
383 3300053153 Ga0500616_0000485 Ga0500616_0000485_38202_38747 177
384 3300053727 Ga0500611_018525 Ga0500611_018525_52_585 177
385 3300054114 Ga0501084_0481145 Ga0501084_0481145_262_795 177
386 3300060353 Ga0501082_0601489 Ga0501082_0601489_277_810 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

57

169

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8511 18 157
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.812 18 153
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8066 18 173
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8038 18 157
2lcg-assembly1.cif.gz_A solution nmr structure of protein rmet_5065 from ralstonia metallidurans, northeast structural genomics consortium target crr115 0.8028 18 154
ID Description Score Start End Superfamily
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.812 18 153 3.30.530.20
2k5gA01 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8041 10 177 3.30.530.20
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.793 17 154 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7923 20 159 3.30.530.20
3q6aA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7811 20 157 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A285TMY1-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9776 1 176
AF-A0A1M2YLM8-F1-model_v4 deleted 0.9746 1 175
AF-A0A434M5F4-F1-model_v4 ATPase 0.973 64 177
AF-A0A1Q3LSD3-F1-model_v4 ATPase 0.9722 1 166
AF-A0A285TMY1-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9722 1 176

Feature Viewer

pLDDT pTM Quality
92.82 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map