F430516

General Info

Members Datasets Scaffolds Average Seq Length
386 231 772 131

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10215580|Ga0163161_102155802
Length 143
Sequence VPRSSVEDMTNIALRYCPITVDDVDAALAFYRDALGLEPHGDFANDGFRWVTLGFPGHPGLEVVLSEPGAGRGPDDADALHRLLAKGSLPGPLVFTTDDLDATFERVRASGAEVLQEPIDQDWGPRDCAFRDPAGNHIRINQV

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
96 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
125 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
126 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
127 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
128 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
129 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
130 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
131 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
220 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
228 2643221613 Oerskovia sp. Root22 Isolate Unclassified
229 2643221721 Oerskovia sp. Root918 Isolate Unclassified
230 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
231 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.63
Metatranscriptomes 2.33
Isolates 1.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.54
Nodule 0
Rhizoplane 2.59
Rhizosphere 76.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_10215580 3300017792 Bacteria 1484
2 LJQas_1035761 3300000549 Bacteria 584
3 JGI25405J52794_10011453 3300003911 Bacteria 1698
4 Ga0070658_10173959 3300005327 Bacteria 1810
5 Ga0070690_100829756 3300005330 Bacteria 719
6 Ga0070670_100335380 3300005331 Bacteria 1327
7 Ga0070680_100082804 3300005336 Bacteria 2649
8 Ga0070680_100322072 3300005336 Bacteria 1312
9 Ga0070660_100231062 3300005339 Bacteria 1505
10 Ga0070668_100550448 3300005347 Bacteria 1004
11 Ga0070668_100833400 3300005347 Bacteria 821
12 Ga0070669_100100794 3300005353 Bacteria 2178
13 Ga0070675_100184902 3300005354 Bacteria 1803
14 Ga0070671_100004214 3300005355 Bacteria 11376
15 Ga0070673_100714709 3300005364 Bacteria 921
16 Ga0070673_101651707 3300005364 Bacteria 606
17 Ga0070714_101166864 3300005435 Bacteria 751
18 Ga0070701_10208652 3300005438 Bacteria 1159
19 Ga0070711_100169476 3300005439 Bacteria 1663
20 Ga0070681_10113913 3300005458 Bacteria 2643
21 Ga0070685_10252817 3300005466 Bacteria 1168
22 Ga0070679_100033413 3300005530 Bacteria 5093
23 Ga0070679_100077376 3300005530 Bacteria 3316
24 Ga0070679_100144621 3300005530 Bacteria 2356
25 Ga0070679_100708876 3300005530 Bacteria 949
26 Ga0070704_101544037 3300005549 Bacteria 611
27 Ga0068855_100058488 3300005563 Bacteria 4514
28 Ga0068855_100114844 3300005563 Bacteria 3087
29 Ga0068855_101268211 3300005563 Bacteria 764
30 Ga0068854_100530033 3300005578 Bacteria 996
31 Ga0070702_100596852 3300005615 Bacteria 827
32 Ga0068852_100065913 3300005616 Bacteria 3161
33 Ga0068852_100884147 3300005616 Bacteria 910
34 Ga0068870_10349652 3300005840 Bacteria 948
35 Ga0068858_100033468 3300005842 Bacteria 4769
36 Ga0068860_100036205 3300005843 Bacteria 4731
37 Ga0068862_100364831 3300005844 Bacteria 1343
38 Ga0081455_10012736 3300005937 Bacteria 8367
39 Ga0081538_10232049 3300005981 Bacteria 720
40 Ga0075365_10000790 3300006038 Bacteria 12946
41 Ga0075365_10001160 3300006038 Bacteria 11561
42 Ga0075365_10089160 3300006038 Bacteria 2099
43 Ga0075365_10163735 3300006038 Bacteria 1551
44 Ga0075368_10002718 3300006042 Bacteria 5832
45 Ga0075368_10091695 3300006042 Bacteria 1243
46 Ga0075368_10268769 3300006042 Bacteria 731
47 Ga0075363_100024806 3300006048 Bacteria 3052
48 Ga0075363_100035567 3300006048 Bacteria 2607
49 Ga0075363_100047782 3300006048 Bacteria 2274
50 Ga0075363_100072246 3300006048 Bacteria 1876
51 Ga0075363_100125135 3300006048 Bacteria 1438
52 Ga0075364_10001960 3300006051 Bacteria 11469
53 Ga0075364_10008838 3300006051 Bacteria 6030
54 Ga0070712_100399472 3300006175 Bacteria 1135
55 Ga0075362_10052240 3300006177 Bacteria 1831
56 Ga0075362_10071673 3300006177 Bacteria 1583
57 Ga0075362_10185204 3300006177 Bacteria 1010
58 Ga0075362_10530188 3300006177 Bacteria 604
59 Ga0075367_10015077 3300006178 Bacteria 4192
60 Ga0075367_10046636 3300006178 Bacteria 2546
61 Ga0075367_10054893 3300006178 Bacteria 2363
62 Ga0075366_10298960 3300006195 Bacteria 985
63 Ga0075370_10245324 3300006353 Bacteria 1061
64 Ga0068871_100635033 3300006358 Bacteria 974
65 Ga0075434_100979741 3300006871 Bacteria 860
66 Ga0105244_10459864 3300009036 Bacteria 585
67 Ga0105240_10035555 3300009093 Bacteria 6418
68 Ga0111539_13256381 3300009094 Bacteria 523
69 Ga0105245_10012017 3300009098 Bacteria 7528
70 Ga0105245_11320990 3300009098 Bacteria 770
71 Ga0105247_10944524 3300009101 Bacteria 669
72 Ga0105243_11779483 3300009148 Bacteria 647
73 Ga0105243_12324613 3300009148 Bacteria 574
74 Ga0105242_11667443 3300009176 Bacteria 673
75 Ga0105248_11509140 3300009177 Bacteria 761
76 Ga0105238_10499457 3300009551 Bacteria 1217
77 Ga0105249_11265502 3300009553 Bacteria 809
78 Ga0105239_10371018 3300010375 Bacteria 1617
79 Ga0105239_10543051 3300010375 Bacteria 1323
80 Ga0157371_10876295 3300013102 Bacteria 680
81 Ga0157370_10004354 3300013104 Bacteria 16258
82 Ga0157370_10055095 3300013104 Bacteria 3790
83 Ga0157370_11756640 3300013104 Bacteria 557
84 Ga0157369_10055990 3300013105 Bacteria 4256
85 Ga0157369_11361554 3300013105 Bacteria 723
86 Ga0157374_10849381 3300013296 Bacteria 930
87 Ga0163162_12654929 3300013306 Bacteria 576
88 Ga0157375_10239796 3300013308 Bacteria 1973
89 Ga0157375_10673038 3300013308 Bacteria 1190
90 Ga0163163_10832381 3300014325 Bacteria 986
91 Ga0163163_11618839 3300014325 Bacteria 708
92 Ga0157380_10323545 3300014326 Bacteria 1431
93 Ga0157380_10458571 3300014326 Bacteria 1226
94 Ga0157380_10771137 3300014326 Bacteria 975
95 Ga0157380_12105518 3300014326 Bacteria 627
96 Ga0157380_13325437 3300014326 Bacteria 514
97 Ga0163161_10936245 3300017792 Bacteria 736
98 Ga0163161_11206344 3300017792 Bacteria 654
99 Ga0197907_10609553 3300020069 Bacteria 966
100 Ga0197907_11452837 3300020069 Bacteria 739
101 Ga0206356_11204060 3300020070 Bacteria 2525
102 Ga0206354_11085755 3300020081 Bacteria 916
103 Ga0206353_10282471 3300020082 Bacteria 2790
104 Ga0206353_10552832 3300020082 Bacteria 613
105 Ga0213876_10005314 3300021384 Bacteria 7088
106 Ga0213876_10039674 3300021384 Bacteria 2488
107 Ga0213876_10050837 3300021384 Bacteria 2190
108 Ga0224712_10244350 3300022467 Bacteria 828
109 Ga0224712_10277687 3300022467 Bacteria 779
110 Ga0207705_10002755 3300025909 Bacteria 13470
111 Ga0207705_10096344 3300025909 Bacteria 2172
112 Ga0207707_11553242 3300025912 Bacteria 523
113 Ga0207695_10052105 3300025913 Bacteria 4290
114 Ga0207693_10447169 3300025915 Bacteria 1010
115 Ga0207660_10282423 3300025917 Bacteria 1318
116 Ga0207657_10327038 3300025919 Bacteria 1211
117 Ga0207652_10090624 3300025921 Bacteria 2687
118 Ga0207652_10121554 3300025921 Bacteria 2323
119 Ga0207652_10266215 3300025921 Bacteria 1546
120 Ga0207694_10348571 3300025924 Bacteria 1225
121 Ga0207650_10333347 3300025925 Bacteria 1245
122 Ga0207650_10399190 3300025925 Bacteria 1138
123 Ga0207659_10404754 3300025926 Bacteria 1142
124 Ga0207687_10243343 3300025927 Bacteria 1427
125 Ga0207644_10004173 3300025931 Bacteria 9370
126 Ga0207669_11223648 3300025937 Bacteria 637
127 Ga0207704_11022479 3300025938 Bacteria 700
128 Ga0207691_10065906 3300025940 Bacteria 3277
129 Ga0207667_10036976 3300025949 Bacteria 5224
130 Ga0207667_10052302 3300025949 Bacteria 4302
131 Ga0207651_10841148 3300025960 Bacteria 815
132 Ga0207703_10015539 3300026035 Bacteria 5936
133 Ga0207639_10944135 3300026041 Bacteria 807
134 Ga0207678_10516493 3300026067 Bacteria 1042
135 Ga0207708_10283769 3300026075 Bacteria 1342
136 Ga0207648_12247474 3300026089 Bacteria 506
137 Ga0207674_11364337 3300026116 Bacteria 678
138 Ga0207675_100040848 3300026118 Bacteria 4332
139 Ga0207698_10801427 3300026142 Bacteria 944
140 Ga0209813_10030082 3300027866 Bacteria 1594
141 Ga0209813_10051181 3300027866 Bacteria 1291
142 Ga0268265_10653330 3300028380 Bacteria 1011
143 Ga0268264_10025891 3300028381 Bacteria 4790
144 Ga0265326_10088307 3300028558 Bacteria 878
145 Ga0265334_10036445 3300028573 Bacteria 1942
146 Ga0307515_10459160 3300028794 Bacteria 888
147 Ga0307515_10530518 3300028794 Bacteria 787
148 Ga0265338_10000984 3300028800 Bacteria 48011
149 Ga0265338_10160651 3300028800 Bacteria 1735
150 Ga0265338_10504476 3300028800 Bacteria 851
151 Ga0265760_10154468 3300031090 Bacteria 754
152 Ga0265325_10000543 3300031241 Bacteria 27333
153 Ga0265339_10000663 3300031249 Bacteria 26614
154 Ga0265339_10267869 3300031249 Bacteria 822
155 Ga0265327_10020407 3300031251 Bacteria 4038
156 Ga0265316_10130404 3300031344 Bacteria 1894
157 Ga0307513_10421337 3300031456 Bacteria 1065
158 Ga0265313_10001881 3300031595 Bacteria 19081
159 Ga0265342_10144062 3300031712 Bacteria 1327
160 Ga0307413_11295903 3300031824 Bacteria 637
161 Ga0307415_100791559 3300032126 Bacteria 865
162 Ga0307415_101126912 3300032126 Bacteria 736
163 Ga0373950_0005284 3300034818 Bacteria 1924
164 Ga0373953_0372788 3300035117 Bacteria 627
165 Ga0373955_0039260 3300035172 Bacteria 2526
166 Ga0373955_0613362 3300035172 Bacteria 667
167 Ga0373933_0515066 3300035724 Bacteria 784
168 Ga0373937_0096857 3300036401 Bacteria 2736
169 Ga0373925_1168401 3300037068 Bacteria 633
170 Ga0395899_0002682 3300037312 Bacteria 14350
171 Ga0395899_0162505 3300037312 Bacteria 1577
172 Ga0395900_0137142 3300037418 Bacteria 2507
173 Ga0395905_0366689 3300037471 Bacteria 1333
174 Ga0395905_0661429 3300037471 Bacteria 947
175 Ga0395901_0176048 3300038443 Bacteria 2244
176 Ga0436365_0552502 3300039437 Bacteria 595
177 Ga0436365_0776714 3300039437 Bacteria 1029
178 Ga0436365_0793180 3300039437 Bacteria 2485
179 Ga0436365_1291702 3300039437 Bacteria 4855
180 Ga0436365_1646100 3300039437 Bacteria 7328
181 Ga0436365_1913100 3300039437 Bacteria 2040
182 Ga0436360_0983908 3300039438 Bacteria 7593
183 Ga0436361_0997597 3300039447 Bacteria 1100
184 Ga0436363_0566741 3300039450 Bacteria 530
185 Ga0436362_0473543 3300039453 Bacteria 1170
186 Ga0439465_0070097 3300041413 Bacteria 1174
187 Ga0451797_1489161 3300041453 Bacteria 585
188 Ga0451800_0249727 3300041459 Bacteria 599
189 Ga0451802_0195491 3300041460 Bacteria 1540
190 Ga0451833_0995964 3300041491 Bacteria 13060
191 Ga0451835_0183040 3300041492 Bacteria 682
192 Ga0451837_0123199 3300041494 Bacteria 694
193 Ga0451845_0514092 3300041501 Bacteria 1164
194 Ga0451853_2735977 3300041512 Bacteria 537
195 Ga0451853_3989260 3300041512 Bacteria 2538
196 Ga0466966_0017347 3300044684 Bacteria 4757
197 Ga0466966_0044501 3300044684 Bacteria 2842
198 Ga0466961_0008719 3300044693 Bacteria 6464
199 Ga0466961_0349608 3300044693 Bacteria 900
200 Ga0466963_1020277 3300044694 Bacteria 582
201 Ga0466963_1342869 3300044694 Bacteria 501
202 Ga0466964_0009046 3300044706 Bacteria 3746
203 Ga0466964_0043394 3300044706 Bacteria 1824
204 Ga0466964_0076725 3300044706 Bacteria 1426
205 Ga0466971_0086790 3300044719 Bacteria 1430
206 Ga0466957_0110441 3300044842 Bacteria 1743
207 Ga0466960_0725193 3300044901 Bacteria 598
208 Ga0466959_0422496 3300045049 Bacteria 905
209 Ga0466958_0016488 3300045836 Bacteria 4254
210 Ga0466958_0138973 3300045836 Bacteria 1529
211 Ga0466958_0379099 3300045836 Bacteria 912
212 Ga0466958_0677133 3300045836 Bacteria 672
213 Ga0466967_0094485 3300045976 Bacteria 2723
214 Ga0466967_0396482 3300045976 Bacteria 1342
215 Ga0466967_1033309 3300045976 Bacteria 818
216 Ga0466967_2370872 3300045976 Bacteria 526
217 Ga0495603_0311020 3300046455 Bacteria 905
218 Ga0495590_0000075 3300046457 Bacteria 68919
219 Ga0495651_0029190 3300046462 Bacteria 4301
220 Ga0495653_0546187 3300046463 Bacteria 717
221 Ga0495662_0120999 3300046476 Bacteria 1285
222 Ga0495664_0274997 3300046477 Bacteria 1018
223 Ga0495608_0038427 3300046511 Bacteria 3214
224 Ga0495618_0092143 3300046514 Bacteria 1938
225 Ga0495630_0394977 3300046517 Bacteria 1059
226 Ga0495630_0854628 3300046517 Bacteria 694
227 Ga0495640_0119554 3300046533 Bacteria 1714
228 Ga0495645_0087182 3300046543 Bacteria 2233
229 Ga0495645_0094387 3300046543 Bacteria 2134
230 Ga0495667_0028060 3300046559 Bacteria 3790
231 Ga0495667_0499822 3300046559 Bacteria 762
232 Ga0495634_0382566 3300046642 Bacteria 838
233 Ga0495635_0127780 3300046663 Bacteria 1733
234 Ga0495635_0171721 3300046663 Bacteria 1474
235 Ga0495657_0049968 3300046675 Bacteria 2814
236 Ga0495623_0026004 3300046679 Bacteria 3770
237 Ga0495623_0463991 3300046679 Bacteria 673
238 Ga0495658_0718000 3300046683 Bacteria 640
239 Ga0495613_0003384 3300046689 Bacteria 11919
240 Ga0495649_0236920 3300046694 Bacteria 940
241 Ga0495600_0024582 3300046809 Bacteria 3879
242 Ga0495600_0838119 3300046809 Bacteria 546
243 Ga0495672_0021575 3300047320 Bacteria 4199
244 Ga0495680_0040099 3300047322 Bacteria 3731
245 Ga0495680_0116577 3300047322 Bacteria 1975
246 Ga0495680_1030201 3300047322 Bacteria 524
247 Ga0495675_0197612 3300047444 Bacteria 1225
248 Ga0495602_0969605 3300048088 Bacteria 562
249 Ga0496104_0221795 3300048907 Bacteria 1803
250 Ga0496105_1245211 3300048908 Bacteria 546
251 Ga0496110_0256190 3300048913 Bacteria 1593
252 Ga0496111_0405263 3300048914 Bacteria 1008
253 Ga0496112_0110334 3300048915 Bacteria 2721
254 Ga0496114_0218256 3300048917 Bacteria 1674
255 Ga0496114_0569482 3300048917 Bacteria 1000
256 Ga0501031_0467068 3300049568 Bacteria 815
257 Ga0501031_0580789 3300049568 Bacteria 721
258 Ga0501031_1115847 3300049568 Bacteria 503
259 Ga0501032_0036729 3300049569 Bacteria 3343
260 Ga0501033_0099974 3300049570 Bacteria 2117
261 Ga0501034_0056657 3300049571 Bacteria 3943
262 Ga0501034_0080975 3300049571 Bacteria 3250
263 Ga0501034_0207658 3300049571 Bacteria 1914
264 Ga0501036_0055683 3300049572 Bacteria 3351
265 Ga0501036_0156898 3300049572 Bacteria 1919
266 Ga0501036_1608924 3300049572 Bacteria 524
267 Ga0501037_0086633 3300049573 Bacteria 2267
268 Ga0501037_0094826 3300049573 Bacteria 2157
269 Ga0501037_0341897 3300049573 Bacteria 1033
270 Ga0501038_0040579 3300049574 Bacteria 4063
271 Ga0501038_0219107 3300049574 Bacteria 1519
272 Ga0501038_1174493 3300049574 Bacteria 558
273 Ga0501039_0041031 3300049575 Bacteria 3573
274 Ga0501039_0121873 3300049575 Bacteria 2044
275 Ga0501040_0017657 3300049576 Bacteria 4736
276 Ga0501040_0066217 3300049576 Bacteria 2489
277 Ga0501041_0048338 3300049577 Bacteria 2591
278 Ga0501041_0049842 3300049577 Bacteria 2551
279 Ga0501042_0281925 3300049578 Bacteria 1200
280 Ga0501042_0302241 3300049578 Bacteria 1156
281 Ga0501043_0394256 3300049579 Bacteria 1047
282 Ga0501043_0827200 3300049579 Bacteria 668
283 Ga0501046_0082853 3300049580 Bacteria 2477
284 Ga0501046_0086837 3300049580 Bacteria 2411
285 Ga0501047_0851812 3300049581 Bacteria 725
286 Ga0501047_1245984 3300049581 Bacteria 558
287 Ga0501048_0044483 3300049582 Bacteria 3175
288 Ga0501067_0013156 3300049583 Bacteria 4581
289 Ga0501068_0070204 3300049584 Bacteria 2137
290 Ga0501068_0141197 3300049584 Bacteria 1510
291 Ga0501068_0458619 3300049584 Bacteria 825
292 Ga0501069_0010405 3300049585 Bacteria 4923
293 Ga0501069_0533779 3300049585 Bacteria 701
294 Ga0501070_0004328 3300049586 Bacteria 12205
295 Ga0501070_0057713 3300049586 Bacteria 3218
296 Ga0501070_0075280 3300049586 Bacteria 2795
297 Ga0501070_0389244 3300049586 Bacteria 1129
298 Ga0501071_0015578 3300049587 Bacteria 5221
299 Ga0501071_0141390 3300049587 Bacteria 1792
300 Ga0501072_0002288 3300049588 Bacteria 14332
301 Ga0501072_0347064 3300049588 Bacteria 1178
302 Ga0501072_0499046 3300049588 Bacteria 963
303 Ga0501072_0701353 3300049588 Bacteria 795
304 Ga0501073_0386300 3300049589 Bacteria 967
305 Ga0501074_0219118 3300049590 Bacteria 1355
306 Ga0501074_0230549 3300049590 Bacteria 1318
307 Ga0501074_0251935 3300049590 Bacteria 1256
308 Ga0501074_0596471 3300049590 Bacteria 781
309 Ga0501074_1093086 3300049590 Bacteria 560
310 Ga0501075_0037503 3300049591 Bacteria 3621
311 Ga0501076_0003525 3300049592 Bacteria 10992
312 Ga0501076_0038142 3300049592 Bacteria 3772
313 Ga0501077_0019038 3300049593 Bacteria 4341
314 Ga0501077_0029855 3300049593 Bacteria 3467
315 Ga0501079_0014518 3300049741 Bacteria 6008
316 Ga0501079_0044404 3300049741 Bacteria 3430
317 Ga0501079_1226141 3300049741 Bacteria 591
318 Ga0501080_0036787 3300049742 Bacteria 4570
319 Ga0501080_0164058 3300049742 Bacteria 2051
320 Ga0501080_0208229 3300049742 Bacteria 1793
321 Ga0501080_0289122 3300049742 Bacteria 1488
322 Ga0501080_0590689 3300049742 Bacteria 986
323 Ga0501081_0010985 3300049743 Bacteria 5919
324 Ga0501081_0233168 3300049743 Bacteria 1341
325 Ga0501081_0414435 3300049743 Bacteria 998
326 Ga0501083_0504714 3300049744 Bacteria 787
327 Ga0501035_0261928 3300049822 Bacteria 1465
328 Ga0501044_0229469 3300049823 Bacteria 1805
329 Ga0501044_0473335 3300049823 Bacteria 1156
330 Ga0501045_0066108 3300049824 Bacteria 2655
331 Ga0501045_0140846 3300049824 Bacteria 1793
332 nmdc:mga03683_102375_c1 3300050489 Bacteria 1260
333 nmdc:mga03683_198551_c1 3300050489 Bacteria 920
334 nmdc:mga03683_399104_c1 3300050489 Bacteria 656
335 nmdc:mga03683_473451_c1 3300050489 Bacteria 604
336 nmdc:mga03683_79632_c1 3300050489 Bacteria 1412
337 nmdc:mga03n38_231444_c1 3300050490 Bacteria 969
338 nmdc:mga03n38_236153_c1 3300050490 Bacteria 960
339 nmdc:mga03n38_446759_c1 3300050490 Bacteria 719
340 nmdc:mga03n38_66070_c1 3300050490 Bacteria 1660
341 nmdc:mga03n38_66379_c1 3300050490 Bacteria 1657
342 nmdc:mga00v17_2515_c1 3300050491 Bacteria 9380
343 nmdc:mga00v17_44795_c1 3300050491 Bacteria 2670
344 nmdc:mga00v17_44861_c1 3300050491 Bacteria 2668
345 nmdc:mga00v17_477219_c1 3300050491 Bacteria 809
346 nmdc:mga00v17_76800_c1 3300050491 Bacteria 2079
347 nmdc:mga0yw44_1132610_c1 3300050492 Bacteria 528
348 nmdc:mga0yw44_21151_c1 3300050492 Bacteria 3625
349 nmdc:mga0yw44_481923_c1 3300050492 Bacteria 841
350 nmdc:mga0yw44_543166_c1 3300050492 Bacteria 789
351 nmdc:mga0yw44_61921_c1 3300050492 Bacteria 2297
352 nmdc:mga0yw44_80630_c1 3300050492 Bacteria 2039
353 nmdc:mga06z11_196500_c1 3300050494 Bacteria 1170
354 nmdc:mga06z11_233874_c1 3300050494 Bacteria 1077
355 nmdc:mga06z11_241889_c1 3300050494 Bacteria 1060
356 nmdc:mga06z11_25030_c1 3300050494 Bacteria 2823
357 nmdc:mga04h51_12175_c1 3300050495 Bacteria 2408
358 nmdc:mga04h51_16466_c1 3300050495 Bacteria 2146
359 nmdc:mga07m45_152980_c2 3300050496 Bacteria 674
360 nmdc:mga07m45_505827_c1 3300050496 Bacteria 699
361 nmdc:mga0n895_1396433_c1 3300050512 Bacteria 669
362 nmdc:mga0rr50_964972_c1 3300050513 Bacteria 726
363 nmdc:mga0a205_1490758_c1 3300050515 Bacteria 524
364 nmdc:mga0a205_745173_c1 3300050515 Bacteria 828
365 nmdc:mga0sz30_331581_c1 3300050516 Bacteria 680
366 Ga0495595_0035821 3300053084 Bacteria 2249
367 Ga0495619_0023723 3300053085 Bacteria 3933
368 Ga0495619_0483059 3300053085 Bacteria 853
369 Ga0495619_1186865 3300053085 Bacteria 506
370 Ga0500566_0000590 3300053094 Bacteria 20315
371 Ga0500628_060669 3300053129 Bacteria 923
372 Ga0500568_0006473 3300053139 Bacteria 5872
373 Ga0500577_0090199 3300053142 Bacteria 1237
374 Ga0500616_0000149 3300053153 Bacteria 118968
375 Ga0501084_0012087 3300054114 Bacteria 7149
376 Ga0501084_0235997 3300054114 Bacteria 1544
377 Ga0501084_0970831 3300054114 Bacteria 714
378 Ga0501082_0255585 3300060353 Bacteria 1524
379 Ga0466962_0005014 3300061719 Bacteria 6367
380 Ga0530510_0022632 3300061734 Bacteria 4477
381 Ga0530510_0063112 3300061734 Bacteria 2682
382 Ga0530510_1028549 3300061734 Bacteria 631
383 2644083136 2643221613 Bacteria 4622396
384 2644666150 2643221721 Bacteria 4486924
385 2870631015 2870628048 Bacteria 3696012
386 2935894604 2935890801 Bacteria 4593001
387 Ga0163161_10215580
388 LJQas_1035761
389 JGI25405J52794_10011453
390 Ga0070658_10173959
391 Ga0070690_100829756
392 Ga0070670_100335380
393 Ga0070680_100082804
394 Ga0070680_100322072
395 Ga0070660_100231062
396 Ga0070668_100550448
397 Ga0070668_100833400
398 Ga0070669_100100794
399 Ga0070675_100184902
400 Ga0070671_100004214
401 Ga0070673_100714709
402 Ga0070673_101651707
403 Ga0070714_101166864
404 Ga0070701_10208652
405 Ga0070711_100169476
406 Ga0070681_10113913
407 Ga0070685_10252817
408 Ga0070679_100033413
409 Ga0070679_100077376
410 Ga0070679_100144621
411 Ga0070679_100708876
412 Ga0070704_101544037
413 Ga0068855_100058488
414 Ga0068855_100114844
415 Ga0068855_101268211
416 Ga0068854_100530033
417 Ga0070702_100596852
418 Ga0068852_100065913
419 Ga0068852_100884147
420 Ga0068870_10349652
421 Ga0068858_100033468
422 Ga0068860_100036205
423 Ga0068862_100364831
424 Ga0081455_10012736
425 Ga0081538_10232049
426 Ga0075365_10000790
427 Ga0075365_10001160
428 Ga0075365_10089160
429 Ga0075365_10163735
430 Ga0075368_10002718
431 Ga0075368_10091695
432 Ga0075368_10268769
433 Ga0075363_100024806
434 Ga0075363_100035567
435 Ga0075363_100047782
436 Ga0075363_100072246
437 Ga0075363_100125135
438 Ga0075364_10001960
439 Ga0075364_10008838
440 Ga0070712_100399472
441 Ga0075362_10052240
442 Ga0075362_10071673
443 Ga0075362_10185204
444 Ga0075362_10530188
445 Ga0075367_10015077
446 Ga0075367_10046636
447 Ga0075367_10054893
448 Ga0075366_10298960
449 Ga0075370_10245324
450 Ga0068871_100635033
451 Ga0075434_100979741
452 Ga0105244_10459864
453 Ga0105240_10035555
454 Ga0111539_13256381
455 Ga0105245_10012017
456 Ga0105245_11320990
457 Ga0105247_10944524
458 Ga0105243_11779483
459 Ga0105243_12324613
460 Ga0105242_11667443
461 Ga0105248_11509140
462 Ga0105238_10499457
463 Ga0105249_11265502
464 Ga0105239_10371018
465 Ga0105239_10543051
466 Ga0157371_10876295
467 Ga0157370_10004354
468 Ga0157370_10055095
469 Ga0157370_11756640
470 Ga0157369_10055990
471 Ga0157369_11361554
472 Ga0157374_10849381
473 Ga0163162_12654929
474 Ga0157375_10239796
475 Ga0157375_10673038
476 Ga0163163_10832381
477 Ga0163163_11618839
478 Ga0157380_10323545
479 Ga0157380_10458571
480 Ga0157380_10771137
481 Ga0157380_12105518
482 Ga0157380_13325437
483 Ga0163161_10936245
484 Ga0163161_11206344
485 Ga0197907_10609553
486 Ga0197907_11452837
487 Ga0206356_11204060
488 Ga0206354_11085755
489 Ga0206353_10282471
490 Ga0206353_10552832
491 Ga0213876_10005314
492 Ga0213876_10039674
493 Ga0213876_10050837
494 Ga0224712_10244350
495 Ga0224712_10277687
496 Ga0207705_10002755
497 Ga0207705_10096344
498 Ga0207707_11553242
499 Ga0207695_10052105
500 Ga0207693_10447169
501 Ga0207660_10282423
502 Ga0207657_10327038
503 Ga0207652_10090624
504 Ga0207652_10121554
505 Ga0207652_10266215
506 Ga0207694_10348571
507 Ga0207650_10333347
508 Ga0207650_10399190
509 Ga0207659_10404754
510 Ga0207687_10243343
511 Ga0207644_10004173
512 Ga0207669_11223648
513 Ga0207704_11022479
514 Ga0207691_10065906
515 Ga0207667_10036976
516 Ga0207667_10052302
517 Ga0207651_10841148
518 Ga0207703_10015539
519 Ga0207639_10944135
520 Ga0207678_10516493
521 Ga0207708_10283769
522 Ga0207648_12247474
523 Ga0207674_11364337
524 Ga0207675_100040848
525 Ga0207698_10801427
526 Ga0209813_10030082
527 Ga0209813_10051181
528 Ga0268265_10653330
529 Ga0268264_10025891
530 Ga0265326_10088307
531 Ga0265334_10036445
532 Ga0307515_10459160
533 Ga0307515_10530518
534 Ga0265338_10000984
535 Ga0265338_10160651
536 Ga0265338_10504476
537 Ga0265760_10154468
538 Ga0265325_10000543
539 Ga0265339_10000663
540 Ga0265339_10267869
541 Ga0265327_10020407
542 Ga0265316_10130404
543 Ga0307513_10421337
544 Ga0265313_10001881
545 Ga0265342_10144062
546 Ga0307413_11295903
547 Ga0307415_100791559
548 Ga0307415_101126912
549 Ga0373950_0005284
550 Ga0373953_0372788
551 Ga0373955_0039260
552 Ga0373955_0613362
553 Ga0373933_0515066
554 Ga0373937_0096857
555 Ga0373925_1168401
556 Ga0395899_0002682
557 Ga0395899_0162505
558 Ga0395900_0137142
559 Ga0395905_0366689
560 Ga0395905_0661429
561 Ga0395901_0176048
562 Ga0436365_0552502
563 Ga0436365_0776714
564 Ga0436365_0793180
565 Ga0436365_1291702
566 Ga0436365_1646100
567 Ga0436365_1913100
568 Ga0436360_0983908
569 Ga0436361_0997597
570 Ga0436363_0566741
571 Ga0436362_0473543
572 Ga0439465_0070097
573 Ga0451797_1489161
574 Ga0451800_0249727
575 Ga0451802_0195491
576 Ga0451833_0995964
577 Ga0451835_0183040
578 Ga0451837_0123199
579 Ga0451845_0514092
580 Ga0451853_2735977
581 Ga0451853_3989260
582 Ga0466966_0017347
583 Ga0466966_0044501
584 Ga0466961_0008719
585 Ga0466961_0349608
586 Ga0466963_1020277
587 Ga0466963_1342869
588 Ga0466964_0009046
589 Ga0466964_0043394
590 Ga0466964_0076725
591 Ga0466971_0086790
592 Ga0466957_0110441
593 Ga0466960_0725193
594 Ga0466959_0422496
595 Ga0466958_0016488
596 Ga0466958_0138973
597 Ga0466958_0379099
598 Ga0466958_0677133
599 Ga0466967_0094485
600 Ga0466967_0396482
601 Ga0466967_1033309
602 Ga0466967_2370872
603 Ga0495603_0311020
604 Ga0495590_0000075
605 Ga0495651_0029190
606 Ga0495653_0546187
607 Ga0495662_0120999
608 Ga0495664_0274997
609 Ga0495608_0038427
610 Ga0495618_0092143
611 Ga0495630_0394977
612 Ga0495630_0854628
613 Ga0495640_0119554
614 Ga0495645_0087182
615 Ga0495645_0094387
616 Ga0495667_0028060
617 Ga0495667_0499822
618 Ga0495634_0382566
619 Ga0495635_0127780
620 Ga0495635_0171721
621 Ga0495657_0049968
622 Ga0495623_0026004
623 Ga0495623_0463991
624 Ga0495658_0718000
625 Ga0495613_0003384
626 Ga0495649_0236920
627 Ga0495600_0024582
628 Ga0495600_0838119
629 Ga0495672_0021575
630 Ga0495680_0040099
631 Ga0495680_0116577
632 Ga0495680_1030201
633 Ga0495675_0197612
634 Ga0495602_0969605
635 Ga0496104_0221795
636 Ga0496105_1245211
637 Ga0496110_0256190
638 Ga0496111_0405263
639 Ga0496112_0110334
640 Ga0496114_0218256
641 Ga0496114_0569482
642 Ga0501031_0467068
643 Ga0501031_0580789
644 Ga0501031_1115847
645 Ga0501032_0036729
646 Ga0501033_0099974
647 Ga0501034_0056657
648 Ga0501034_0080975
649 Ga0501034_0207658
650 Ga0501036_0055683
651 Ga0501036_0156898
652 Ga0501036_1608924
653 Ga0501037_0086633
654 Ga0501037_0094826
655 Ga0501037_0341897
656 Ga0501038_0040579
657 Ga0501038_0219107
658 Ga0501038_1174493
659 Ga0501039_0041031
660 Ga0501039_0121873
661 Ga0501040_0017657
662 Ga0501040_0066217
663 Ga0501041_0048338
664 Ga0501041_0049842
665 Ga0501042_0281925
666 Ga0501042_0302241
667 Ga0501043_0394256
668 Ga0501043_0827200
669 Ga0501046_0082853
670 Ga0501046_0086837
671 Ga0501047_0851812
672 Ga0501047_1245984
673 Ga0501048_0044483
674 Ga0501067_0013156
675 Ga0501068_0070204
676 Ga0501068_0141197
677 Ga0501068_0458619
678 Ga0501069_0010405
679 Ga0501069_0533779
680 Ga0501070_0004328
681 Ga0501070_0057713
682 Ga0501070_0075280
683 Ga0501070_0389244
684 Ga0501071_0015578
685 Ga0501071_0141390
686 Ga0501072_0002288
687 Ga0501072_0347064
688 Ga0501072_0499046
689 Ga0501072_0701353
690 Ga0501073_0386300
691 Ga0501074_0219118
692 Ga0501074_0230549
693 Ga0501074_0251935
694 Ga0501074_0596471
695 Ga0501074_1093086
696 Ga0501075_0037503
697 Ga0501076_0003525
698 Ga0501076_0038142
699 Ga0501077_0019038
700 Ga0501077_0029855
701 Ga0501079_0014518
702 Ga0501079_0044404
703 Ga0501079_1226141
704 Ga0501080_0036787
705 Ga0501080_0164058
706 Ga0501080_0208229
707 Ga0501080_0289122
708 Ga0501080_0590689
709 Ga0501081_0010985
710 Ga0501081_0233168
711 Ga0501081_0414435
712 Ga0501083_0504714
713 Ga0501035_0261928
714 Ga0501044_0229469
715 Ga0501044_0473335
716 Ga0501045_0066108
717 Ga0501045_0140846
718 nmdc:mga03683_102375_c1
719 nmdc:mga03683_198551_c1
720 nmdc:mga03683_399104_c1
721 nmdc:mga03683_473451_c1
722 nmdc:mga03683_79632_c1
723 nmdc:mga03n38_231444_c1
724 nmdc:mga03n38_236153_c1
725 nmdc:mga03n38_446759_c1
726 nmdc:mga03n38_66070_c1
727 nmdc:mga03n38_66379_c1
728 nmdc:mga00v17_2515_c1
729 nmdc:mga00v17_44795_c1
730 nmdc:mga00v17_44861_c1
731 nmdc:mga00v17_477219_c1
732 nmdc:mga00v17_76800_c1
733 nmdc:mga0yw44_1132610_c1
734 nmdc:mga0yw44_21151_c1
735 nmdc:mga0yw44_481923_c1
736 nmdc:mga0yw44_543166_c1
737 nmdc:mga0yw44_61921_c1
738 nmdc:mga0yw44_80630_c1
739 nmdc:mga06z11_196500_c1
740 nmdc:mga06z11_233874_c1
741 nmdc:mga06z11_241889_c1
742 nmdc:mga06z11_25030_c1
743 nmdc:mga04h51_12175_c1
744 nmdc:mga04h51_16466_c1
745 nmdc:mga07m45_152980_c2
746 nmdc:mga07m45_505827_c1
747 nmdc:mga0n895_1396433_c1
748 nmdc:mga0rr50_964972_c1
749 nmdc:mga0a205_1490758_c1
750 nmdc:mga0a205_745173_c1
751 nmdc:mga0sz30_331581_c1
752 Ga0495595_0035821
753 Ga0495619_0023723
754 Ga0495619_0483059
755 Ga0495619_1186865
756 Ga0500566_0000590
757 Ga0500628_060669
758 Ga0500568_0006473
759 Ga0500577_0090199
760 Ga0500616_0000149
761 Ga0501084_0012087
762 Ga0501084_0235997
763 Ga0501084_0970831
764 Ga0501082_0255585
765 Ga0466962_0005014
766 Ga0530510_0022632
767 Ga0530510_0063112
768 Ga0530510_1028549
769 2644083136
770 2644666150
771 2870631015
772 2935894604

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

18

141

0.83

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

13

140

0.81

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

17

130

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8999 2 132
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8984 1 132
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8921 1 132
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8903 1 130
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8873 2 132
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8849 79 131 3.30.720.110
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8842 1 57 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8734 82 131 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8606 82 132 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8595 80 132 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A849IY85-F1-model_v4 VOC family protein 0.9938 1 132
AF-A0A3D0VG73-F1-model_v4 Lyase 0.9774 19 132 GO:0004493
GO:0016829
GO:0046491
AF-A0A5C2FH74-F1-model_v4 VOC family protein 0.9729 1 132
AF-A0A420BNT7-F1-model_v4 deleted 0.967 1 132
AF-A0A5C2FH74-F1-model_v4 VOC family protein 0.9657 1 132

Map