F430364

General Info

Members Datasets Scaffolds Average Seq Length
385 261 770 411

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2945941187|2945941640
Length 446
Sequence PTQALSAADLARIDGQLAETDRQLELRYPGDDGSRQPVHTVYVPADRFTPSLAADWGEQAVRTAEAHGGLERLGWLLGQSLALGAAVASRVANKLANEPIEDLRLDFEDGYGNRGDDAEDADAVAAAGMVADAVAAGTAPPYIGIRFKCFEAATRTRGLRTLDLFVSALASAGELPRGLVLTMPKVTTVAQVQAMDYAVARLEEVHGLPHGRLRFEVQVETPQLILGPDGTSPVAKLAHVVPGRISALHYGTYDYSASLQISAEYQSMEHPVADFAKETMQLAVAGTGIRLSDGSTNIIPAGDNVEDAWRLHGRLVQRSLERGFYQGWDLHPAQLPSRFAATYGFYRQGLPAATARLRNYVEQTEGGVMDEPATARALAAFVLRGVQCGAVGADEVQALAGVGLSRLTGLAHPGLAAKSSPQTSTTQTSTAQPSPAQGSSTQGADS

Samples

Sample ID Description Type Environment
1 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
122 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
136 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
137 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
143 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
144 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
145 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
146 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
147 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
148 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
149 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
150 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
151 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
152 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
153 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
154 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
155 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
156 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
157 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
158 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
159 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
221 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
222 2643221549 Agromyces sp. Root1464 Isolate Unclassified
223 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
224 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
225 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
226 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
227 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
228 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
229 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
230 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
231 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
232 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
233 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
234 2867369537 Streptomyces sp. Z26 Isolate Unclassified
235 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
236 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
237 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
238 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
239 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
240 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
241 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
242 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
243 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
244 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
245 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
246 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
247 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
248 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
249 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
250 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
251 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
252 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
253 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
254 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
255 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
256 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
257 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
258 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
259 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
260 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
261 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.09
Metatranscriptomes 0
Isolates 10.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 8.05
Rhizosphere 85.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000086 3300002773 Bacteria 64446
2 JGI25406J46586_10013629 3300003203 Bacteria 3483
3 rootL2_10167554 3300003322 Bacteria 1746
4 JGI25407J50210_10010162 3300003373 Bacteria 2391
5 Ga0065714_10078692 3300005288 Bacteria 2577
6 Ga0070658_10030109 3300005327 Bacteria 4362
7 Ga0070676_10007829 3300005328 Bacteria 5744
8 Ga0070683_100000230 3300005329 Bacteria 38094
9 Ga0070666_10006026 3300005335 Bacteria 7449
10 Ga0070666_10081657 3300005335 Bacteria 2210
11 Ga0070682_100042153 3300005337 Bacteria 2816
12 Ga0070682_100050871 3300005337 Bacteria 2588
13 Ga0070660_100023022 3300005339 Bacteria 4612
14 Ga0070660_100144583 3300005339 Bacteria 1909
15 Ga0070687_100085197 3300005343 Bacteria 1734
16 Ga0070668_100035030 3300005347 Bacteria 3826
17 Ga0070668_100035863 3300005347 Bacteria 3784
18 Ga0070669_100041548 3300005353 Bacteria 3344
19 Ga0070675_100024945 3300005354 Bacteria 4792
20 Ga0070671_100068948 3300005355 Bacteria 2949
21 Ga0070674_100026199 3300005356 Bacteria 3805
22 Ga0070659_100007527 3300005366 Bacteria 7912
23 Ga0070659_100026416 3300005366 Bacteria 4468
24 Ga0070709_10017170 3300005434 Bacteria 4144
25 Ga0070709_10131705 3300005434 Bacteria 1708
26 Ga0070714_100004667 3300005435 Bacteria 10348
27 Ga0070714_100025802 3300005435 Bacteria 4854
28 Ga0070713_100083088 3300005436 Bacteria 2737
29 Ga0070710_10010090 3300005437 Bacteria 4633
30 Ga0070701_10021487 3300005438 Bacteria 3081
31 Ga0070711_100006955 3300005439 Bacteria 6860
32 Ga0070711_100169472 3300005439 Bacteria 1663
33 Ga0070705_100010182 3300005440 Bacteria 4698
34 Ga0070694_100005458 3300005444 Bacteria 7700
35 Ga0070708_100158306 3300005445 Bacteria 2109
36 Ga0070678_100030949 3300005456 Bacteria 3685
37 Ga0070678_100077288 3300005456 Bacteria 2511
38 Ga0070698_100095501 3300005471 Bacteria 2950
39 Ga0070684_100004373 3300005535 Bacteria 10739
40 Ga0068853_100136702 3300005539 Bacteria 2198
41 Ga0070672_100028112 3300005543 Bacteria 4203
42 Ga0070672_100253839 3300005543 Bacteria 1481
43 Ga0070686_100064576 3300005544 Bacteria 2375
44 Ga0070693_100007318 3300005547 Bacteria 5390
45 Ga0070665_100022903 3300005548 Bacteria 6289
46 Ga0070665_100133239 3300005548 Bacteria 2487
47 Ga0068855_100040848 3300005563 Bacteria 5501
48 Ga0068857_100003813 3300005577 Bacteria 12689
49 Ga0068854_100097920 3300005578 Bacteria 2194
50 Ga0068856_100018878 3300005614 Bacteria 6687
51 Ga0068852_100052785 3300005616 Bacteria 3496
52 Ga0068852_100065962 3300005616 Bacteria 3160
53 Ga0068864_100099815 3300005618 Bacteria 2572
54 Ga0068866_10019118 3300005718 Bacteria 3112
55 Ga0068861_100024674 3300005719 Bacteria 4352
56 Ga0068863_100156032 3300005841 Bacteria 2185
57 Ga0068858_100057922 3300005842 Bacteria 3581
58 Ga0068858_100095714 3300005842 Bacteria 2767
59 Ga0068860_100011934 3300005843 Bacteria 8564
60 Ga0081455_10000310 3300005937 Bacteria 64261
61 Ga0081455_10017146 3300005937 Bacteria 6955
62 Ga0081538_10001192 3300005981 Bacteria 27391
63 Ga0081538_10002788 3300005981 Bacteria 16740
64 Ga0081538_10006110 3300005981 Bacteria 10697
65 Ga0081538_10013347 3300005981 Bacteria 6511
66 Ga0081538_10015299 3300005981 Bacteria 5948
67 Ga0081540_1026238 3300005983 Bacteria 3331
68 Ga0081539_10000680 3300005985 Bacteria 68157
69 Ga0081539_10001247 3300005985 Bacteria 45247
70 Ga0081539_10003468 3300005985 Bacteria 19303
71 Ga0081539_10048184 3300005985 Bacteria 2426
72 Ga0070717_10059789 3300006028 Bacteria 3154
73 Ga0075432_10001029 3300006058 Bacteria 8863
74 Ga0070712_100133462 3300006175 Bacteria 1885
75 Ga0068871_100042166 3300006358 Bacteria 3662
76 Ga0075428_100001346 3300006844 Bacteria 26074
77 Ga0075430_100000905 3300006846 Bacteria 23229
78 Ga0075431_100037483 3300006847 Bacteria 4994
79 Ga0075433_10049719 3300006852 Bacteria 3647
80 Ga0075433_10049728 3300006852 Bacteria 3647
81 Ga0075429_100002928 3300006880 Bacteria 14475
82 Ga0075435_100059854 3300007076 Bacteria 3087
83 Ga0105251_10012920 3300009011 Bacteria 4697
84 Ga0105244_10010795 3300009036 Bacteria 5515
85 Ga0105244_10046971 3300009036 Bacteria 2216
86 Ga0105244_10053971 3300009036 Bacteria 2040
87 Ga0111539_10019608 3300009094 Bacteria 8344
88 Ga0105245_10023302 3300009098 Bacteria 5433
89 Ga0114129_10004039 3300009147 Bacteria 20723
90 Ga0114129_10536742 3300009147 Bacteria 1523
91 Ga0105243_10010102 3300009148 Bacteria 7180
92 Ga0105243_10036137 3300009148 Bacteria 3832
93 Ga0105243_10051546 3300009148 Bacteria 3255
94 Ga0105243_10089858 3300009148 Bacteria 2527
95 Ga0105242_10128124 3300009176 Bacteria 2187
96 Ga0105248_10044830 3300009177 Bacteria 4960
97 Ga0105248_10188294 3300009177 Bacteria 2325
98 Ga0105249_10011597 3300009553 Bacteria 7746
99 Ga0105246_10000798 3300011119 Bacteria 17873
100 Ga0105246_10166281 3300011119 Bacteria 1685
101 Ga0157371_10014973 3300013102 Bacteria 5833
102 Ga0157371_10067823 3300013102 Bacteria 2525
103 Ga0157370_10006769 3300013104 Bacteria 12572
104 Ga0157370_10158863 3300013104 Bacteria 2104
105 Ga0157369_10074096 3300013105 Bacteria 3651
106 Ga0157369_10099452 3300013105 Bacteria 3101
107 Ga0157378_10105322 3300013297 Bacteria 2579
108 Ga0163162_10020655 3300013306 Bacteria 6473
109 Ga0163162_10021371 3300013306 Bacteria 6372
110 Ga0163162_10080921 3300013306 Bacteria 3317
111 Ga0157372_10001996 3300013307 Bacteria 22167
112 Ga0157372_10353860 3300013307 Bacteria 1711
113 Ga0157375_10018885 3300013308 Bacteria 6259
114 Ga0157375_10086095 3300013308 Bacteria 3193
115 Ga0163163_10015691 3300014325 Bacteria 7013
116 Ga0163163_10030167 3300014325 Bacteria 5221
117 Ga0157379_10010789 3300014968 Bacteria 7964
118 Ga0157376_10083539 3300014969 Bacteria 2747
119 Ga0163161_10002715 3300017792 Bacteria 12576
120 Ga0209129_1000100 3300025258 Bacteria 162353
121 Ga0209025_1002143 3300025294 Bacteria 22104
122 Ga0207697_10007501 3300025315 Bacteria 4860
123 Ga0207656_10015778 3300025321 Bacteria 2930
124 Ga0207655_1014734 3300025728 Bacteria 4396
125 Ga0207682_10006877 3300025893 Bacteria 4565
126 Ga0207692_10011727 3300025898 Bacteria 3742
127 Ga0207642_10019540 3300025899 Bacteria 2625
128 Ga0207688_10017611 3300025901 Bacteria 3885
129 Ga0207680_10012376 3300025903 Bacteria 4343
130 Ga0207647_10032188 3300025904 Bacteria 3372
131 Ga0207699_10048191 3300025906 Bacteria 2502
132 Ga0207645_10000494 3300025907 Bacteria 32513
133 Ga0207693_10009011 3300025915 Bacteria 8143
134 Ga0207693_10140105 3300025915 Bacteria 1902
135 Ga0207657_10024691 3300025919 Bacteria 5558
136 Ga0207681_10017303 3300025923 Bacteria 4525
137 Ga0207650_10048188 3300025925 Bacteria 3142
138 Ga0207659_10064404 3300025926 Bacteria 2653
139 Ga0207664_10027827 3300025929 Bacteria 4291
140 Ga0207664_10111453 3300025929 Bacteria 2277
141 Ga0207664_10295253 3300025929 Bacteria 1425
142 Ga0207706_10006477 3300025933 Bacteria 10870
143 Ga0207706_10021283 3300025933 Bacteria 5826
144 Ga0207686_10016403 3300025934 Bacteria 4158
145 Ga0207686_10093495 3300025934 Bacteria 1991
146 Ga0207709_10027534 3300025935 Bacteria 3276
147 Ga0207709_10057955 3300025935 Bacteria 2404
148 Ga0207709_10063359 3300025935 Bacteria 2317
149 Ga0207709_10135035 3300025935 Bacteria 1687
150 Ga0207691_10002730 3300025940 Bacteria 17235
151 Ga0207661_10002423 3300025944 Bacteria 12856
152 Ga0207668_10148939 3300025972 Bacteria 1809
153 Ga0207658_10136756 3300025986 Bacteria 1977
154 Ga0207703_10043635 3300026035 Bacteria 3600
155 Ga0207639_10085065 3300026041 Bacteria 2514
156 Ga0207678_10007828 3300026067 Bacteria 9432
157 Ga0207702_10105434 3300026078 Bacteria 2497
158 Ga0207702_10227186 3300026078 Bacteria 1742
159 Ga0207641_10027531 3300026088 Bacteria 4696
160 Ga0207676_10078539 3300026095 Bacteria 2673
161 Ga0207674_10004941 3300026116 Bacteria 15927
162 Ga0207675_100026514 3300026118 Bacteria 5395
163 Ga0207675_100130823 3300026118 Bacteria 2380
164 Ga0207683_10002316 3300026121 Bacteria 16706
165 Ga0207683_10004822 3300026121 Bacteria 11614
166 Ga0207683_10043950 3300026121 Bacteria 3904
167 Ga0207698_10149519 3300026142 Bacteria 2025
168 Ga0207428_10001624 3300027907 Bacteria 23341
169 Ga0268266_10153798 3300028379 Bacteria 2076
170 Ga0307515_10083043 3300028794 Bacteria 4134
171 Ga0307512_10008732 3300030522 Bacteria 9845
172 Ga0316181_1106309 3300030744 Bacteria 1820
173 Ga0307408_100016052 3300031548 Bacteria 4992
174 Ga0307408_100032758 3300031548 Bacteria 3625
175 Ga0307408_100104960 3300031548 Bacteria 2159
176 Ga0307408_100168039 3300031548 Bacteria 1749
177 Ga0307408_100178394 3300031548 Bacteria 1701
178 Ga0307405_10036029 3300031731 Bacteria 2961
179 Ga0307413_10038279 3300031824 Bacteria 2778
180 Ga0307413_10182398 3300031824 Bacteria 1498
181 Ga0307410_10004710 3300031852 Bacteria 7099
182 Ga0307410_10029707 3300031852 Bacteria 3484
183 Ga0307410_10055553 3300031852 Bacteria 2688
184 Ga0307410_10084115 3300031852 Bacteria 2242
185 Ga0307406_10000081 3300031901 Bacteria 53682
186 Ga0307406_10000107 3300031901 Bacteria 48696
187 Ga0307407_10002638 3300031903 Bacteria 7089
188 Ga0307407_10020559 3300031903 Bacteria 3386
189 Ga0307412_10011122 3300031911 Bacteria 5204
190 Ga0307409_100000155 3300031995 Bacteria 26095
191 Ga0307409_100007182 3300031995 Bacteria 6638
192 Ga0307409_100017840 3300031995 Bacteria 4746
193 Ga0307409_100125886 3300031995 Bacteria 2179
194 Ga0307409_100197604 3300031995 Bacteria 1796
195 Ga0307416_100000244 3300032002 Bacteria 28782
196 Ga0307416_100001634 3300032002 Bacteria 12351
197 Ga0307416_100024404 3300032002 Bacteria 4413
198 Ga0307416_100035434 3300032002 Bacteria 3811
199 Ga0307416_100078850 3300032002 Bacteria 2773
200 Ga0307416_100097507 3300032002 Bacteria 2546
201 Ga0307416_100137198 3300032002 Bacteria 2215
202 Ga0307416_100346985 3300032002 Bacteria 1500
203 Ga0307414_10038828 3300032004 Bacteria 3201
204 Ga0307414_10044145 3300032004 Bacteria 3041
205 Ga0307414_10052246 3300032004 Bacteria 2843
206 Ga0307411_10005941 3300032005 Bacteria 6065
207 Ga0307411_10015533 3300032005 Bacteria 4280
208 Ga0307411_10229207 3300032005 Bacteria 1447
209 Ga0307415_100002229 3300032126 Bacteria 9601
210 Ga0307415_100012856 3300032126 Bacteria 4859
211 Ga0307415_100099599 3300032126 Bacteria 2128
212 Ga0307415_100302519 3300032126 Bacteria 1325
213 Ga0373952_0003736 3300035092 Bacteria 2751
214 Ga0373960_0011782 3300035121 Bacteria 2161
215 Ga0373942_0007477 3300035207 Bacteria 2534
216 Ga0395899_0012641 3300037312 Bacteria 6470
217 Ga0395899_0072739 3300037312 Bacteria 2515
218 Ga0395900_0002060 3300037418 Bacteria 22555
219 Ga0395900_0133912 3300037418 Bacteria 2539
220 Ga0395900_0190042 3300037418 Bacteria 2083
221 Ga0395898_0019641 3300037466 Bacteria 6872
222 Ga0395898_0077212 3300037466 Bacteria 3215
223 Ga0395901_0039649 3300038443 Bacteria 4875
224 Ga0395901_0070642 3300038443 Bacteria 3638
225 Ga0439461_0005777 3300041410 Bacteria 2127
226 Ga0439433_0003564 3300041999 Bacteria 3347
227 Ga0439433_0015518 3300041999 Bacteria 1682
228 Ga0439442_000093 3300042002 Bacteria 21417
229 Ga0439442_000260 3300042002 Bacteria 12884
230 Ga0439442_001647 3300042002 Bacteria 4380
231 Ga0439448_0007536 3300042005 Bacteria 3157
232 Ga0439449_0004875 3300042007 Bacteria 5169
233 Ga0439449_0043999 3300042007 Bacteria 1656
234 Ga0439450_000281 3300042008 Bacteria 6252
235 Ga0439455_0002423 3300042012 Bacteria 3388
236 Ga0439463_001117 3300042016 Bacteria 7193
237 Ga0439463_002964 3300042016 Bacteria 4308
238 Ga0439463_017465 3300042016 Bacteria 1779
239 Ga0450919_001228 3300042121 Bacteria 3349
240 Ga0450920_000863 3300042122 Bacteria 4919
241 Ga0450920_003907 3300042122 Bacteria 2599
242 Ga0450920_010742 3300042122 Bacteria 1700
243 Ga0450905_001806 3300042142 Bacteria 2732
244 Ga0450907_000188 3300042146 Bacteria 22583
245 Ga0439458_0021592 3300042157 Bacteria 1492
246 Ga0450909_004486 3300042185 Bacteria 1993
247 Ga0439434_0000495 3300042435 Bacteria 11202
248 Ga0439434_0002515 3300042435 Bacteria 5335
249 Ga0439464_0000258 3300042439 Bacteria 9834
250 Ga0450916_000302 3300042530 Bacteria 3952
251 Ga0450918_000588 3300042531 Bacteria 7772
252 Ga0466966_0063511 3300044684 Bacteria 2327
253 Ga0466961_0005474 3300044693 Bacteria 8007
254 Ga0466963_0083822 3300044694 Bacteria 2162
255 Ga0466970_0000022 3300044765 Bacteria 59505
256 Ga0466959_0006764 3300045049 Bacteria 7986
257 Ga0466959_0193562 3300045049 Bacteria 1418
258 Ga0451576_0032393 3300045051 Bacteria 5566
259 Ga0466958_0097735 3300045836 Bacteria 1822
260 Ga0495586_0046296 3300046535 Bacteria 2345
261 Ga0495645_0048508 3300046543 Bacteria 3093
262 Ga0495668_0043166 3300046616 Bacteria 2509
263 Ga0495588_0009131 3300046674 Bacteria 4572
264 Ga0495588_0012148 3300046674 Bacteria 4060
265 Ga0495581_0085262 3300047315 Bacteria 1830
266 Ga0495675_0003278 3300047444 Bacteria 9733
267 Ga0495677_0026403 3300047445 Bacteria 2107
268 Ga0496100_0015642 3300048903 Bacteria 4433
269 Ga0496100_0074510 3300048903 Bacteria 2274
270 Ga0496101_0108011 3300048904 Bacteria 2091
271 Ga0496102_0005395 3300048905 Bacteria 10859
272 Ga0496102_0017725 3300048905 Bacteria 6242
273 Ga0496102_0021598 3300048905 Bacteria 5693
274 Ga0496102_0263588 3300048905 Bacteria 1624
275 Ga0496103_0015209 3300048906 Bacteria 4574
276 Ga0496104_0010894 3300048907 Bacteria 8133
277 Ga0496105_0066618 3300048908 Bacteria 2973
278 Ga0496105_0133373 3300048908 Bacteria 2046
279 Ga0496106_0031879 3300048909 Bacteria 3927
280 Ga0496106_0083564 3300048909 Bacteria 2456
281 Ga0496108_0006512 3300048911 Bacteria 9469
282 Ga0496108_0031848 3300048911 Bacteria 4377
283 Ga0496108_0099778 3300048911 Bacteria 2475
284 Ga0496109_0034088 3300048912 Bacteria 4582
285 Ga0496109_0131226 3300048912 Bacteria 2338
286 Ga0496110_0016093 3300048913 Bacteria 6237
287 Ga0496110_0018230 3300048913 Bacteria 5882
288 Ga0496110_0075836 3300048913 Bacteria 2988
289 Ga0496111_0076137 3300048914 Bacteria 2445
290 Ga0496111_0107654 3300048914 Bacteria 2052
291 Ga0496112_0003689 3300048915 Bacteria 12768
292 Ga0496112_0016808 3300048915 Bacteria 6862
293 Ga0496112_0121080 3300048915 Bacteria 2586
294 Ga0496112_0206818 3300048915 Bacteria 1920
295 Ga0496113_0075158 3300048916 Bacteria 2578
296 Ga0496113_0123128 3300048916 Bacteria 2029
297 Ga0496114_0019292 3300048917 Bacteria 5524
298 Ga0496115_0066255 3300048918 Bacteria 2918
299 Ga0496117_0079269 3300048920 Bacteria 2165
300 Ga0496119_0063428 3300048922 Bacteria 2198
301 Ga0501032_0009371 3300049569 Bacteria 7092
302 Ga0501034_0000066 3300049571 Bacteria 184727
303 Ga0501034_0000590 3300049571 Bacteria 57381
304 Ga0501034_0005234 3300049571 Bacteria 14235
305 Ga0501034_0116933 3300049571 Bacteria 2654
306 Ga0501036_0025558 3300049572 Bacteria 4982
307 Ga0501036_0043175 3300049572 Bacteria 3817
308 Ga0501037_0063299 3300049573 Bacteria 2696
309 Ga0501037_0067536 3300049573 Bacteria 2603
310 Ga0501038_0002940 3300049574 Bacteria 15892
311 Ga0501038_0006926 3300049574 Bacteria 10465
312 Ga0501039_0016177 3300049575 Bacteria 5714
313 Ga0501041_0006920 3300049577 Bacteria 6652
314 Ga0501042_0014623 3300049578 Bacteria 5360
315 Ga0501042_0149904 3300049578 Bacteria 1681
316 Ga0501043_0003252 3300049579 Bacteria 13392
317 Ga0501043_0048690 3300049579 Bacteria 3332
318 Ga0501047_0042142 3300049581 Bacteria 4412
319 Ga0501048_0035252 3300049582 Bacteria 3602
320 Ga0501068_0033952 3300049584 Bacteria 3041
321 Ga0501070_0002018 3300049586 Bacteria 17837
322 Ga0501072_0018232 3300049588 Bacteria 5400
323 Ga0501074_0010934 3300049590 Bacteria 6588
324 Ga0501075_0123893 3300049591 Bacteria 1967
325 Ga0501076_0038374 3300049592 Bacteria 3760
326 Ga0501077_0005629 3300049593 Bacteria 7635
327 Ga0501035_0042490 3300049822 Bacteria 4100
328 Ga0501044_0009131 3300049823 Bacteria 10828
329 Ga0501044_0239654 3300049823 Bacteria 1758
330 Ga0501045_0029345 3300049824 Bacteria 3975
331 nmdc:mga05p37_2485_c1 3300050507 Bacteria 21434
332 nmdc:mga05p37_51899_c1 3300050507 Bacteria 5043
333 nmdc:mga09592_423_c1 3300050508 Bacteria 31122
334 nmdc:mga0qj67_1954_c1 3300050509 Bacteria 14677
335 nmdc:mga08y16_10916_c1 3300050511 Bacteria 9541
336 nmdc:mga08y16_15093_c1 3300050511 Bacteria 8123
337 nmdc:mga0a205_15739_c1 3300050515 Bacteria 7070
338 nmdc:mga0a205_26767_c1 3300050515 Bacteria 5503
339 nmdc:mga0a205_29842_c1 3300050515 Bacteria 5219
340 Ga0501084_0018008 3300054114 Bacteria 5882
341 Ga0501082_0008799 3300060353 Bacteria 8705
342 Ga0466962_0002015 3300061719 Bacteria 9582
343 Ga0530510_0001746 3300061734 Bacteria 14819
344 2945941640 2945941187 Bacteria 4682474
345 2643768407 2643221549 Bacteria 4042819
346 2691515335 2690315906 Bacteria 4517044
347 2691515979 2690315906 Bacteria 4517044
348 2775658173 2775506735 Bacteria 4556596
349 2808828530 2808606357 Bacteria 4466944
350 2808849775 2808606360 Bacteria 4404006
351 2808877634 2808606366 Bacteria 4415912
352 2808892742 2808606370 Bacteria 4942454
353 2808899090 2808606371 Bacteria 4251511
354 2812319764 2811994871 Bacteria 4497550
355 2844850153 2844849076 Bacteria 4091819
356 2857743669 2857740372 Bacteria 4782044
357 2867352358 2867346516 Bacteria 7608576
358 2867375156 2867369537 Bacteria 6501581
359 2904500755 2904497146 Bacteria 4731781
360 2904779610 2904776348 Bacteria 4658726
361 2910809796 2910809715 Bacteria 4982797
362 2919037461 2919034639 Bacteria 4763403
363 2919061266 2919059106 Bacteria 4991624
364 2919394239 2919391150 Bacteria 4884741
365 2919443716 2919443155 Bacteria 4072969
366 2919542655 2919538618 Bacteria 4677069
367 2932429732 2932426870 Bacteria 4547726
368 2933419238 2933418574 Bacteria 4476724
369 2939601503 2939598168 Bacteria 4687164
370 2939650607 2939647034 Bacteria 4681660
371 2939675960 2939674588 Bacteria 4844420
372 2945917510 2945916053 Bacteria 4555517
373 2945922198 2945920336 Bacteria 4501603
374 2945960655 2945956166 Bacteria 5110334
375 2946027016 2946024296 Bacteria 3508095
376 2946037542 2946037020 Bacteria 4900426
377 2946041749 2946041624 Bacteria 4191385
378 2946061335 2946059875 Bacteria 4386623
379 2946083575 2946080515 Bacteria 4310960
380 2953998810 2953998280 Bacteria 4812144
381 2974305574 2974302888 Bacteria 4369871
382 8004024358 8004021418 Bacteria 4313954
383 8004028052 8004025490 Bacteria 4327753
384 8053947292 8053945823 Bacteria 8962862
385 8054109580 8054107350 Bacteria 5022511
386 JGI25152J39213_1000086
387 JGI25406J46586_10013629
388 rootL2_10167554
389 JGI25407J50210_10010162
390 Ga0065714_10078692
391 Ga0070658_10030109
392 Ga0070676_10007829
393 Ga0070683_100000230
394 Ga0070666_10006026
395 Ga0070666_10081657
396 Ga0070682_100042153
397 Ga0070682_100050871
398 Ga0070660_100023022
399 Ga0070660_100144583
400 Ga0070687_100085197
401 Ga0070668_100035030
402 Ga0070668_100035863
403 Ga0070669_100041548
404 Ga0070675_100024945
405 Ga0070671_100068948
406 Ga0070674_100026199
407 Ga0070659_100007527
408 Ga0070659_100026416
409 Ga0070709_10017170
410 Ga0070709_10131705
411 Ga0070714_100004667
412 Ga0070714_100025802
413 Ga0070713_100083088
414 Ga0070710_10010090
415 Ga0070701_10021487
416 Ga0070711_100006955
417 Ga0070711_100169472
418 Ga0070705_100010182
419 Ga0070694_100005458
420 Ga0070708_100158306
421 Ga0070678_100030949
422 Ga0070678_100077288
423 Ga0070698_100095501
424 Ga0070684_100004373
425 Ga0068853_100136702
426 Ga0070672_100028112
427 Ga0070672_100253839
428 Ga0070686_100064576
429 Ga0070693_100007318
430 Ga0070665_100022903
431 Ga0070665_100133239
432 Ga0068855_100040848
433 Ga0068857_100003813
434 Ga0068854_100097920
435 Ga0068856_100018878
436 Ga0068852_100052785
437 Ga0068852_100065962
438 Ga0068864_100099815
439 Ga0068866_10019118
440 Ga0068861_100024674
441 Ga0068863_100156032
442 Ga0068858_100057922
443 Ga0068858_100095714
444 Ga0068860_100011934
445 Ga0081455_10000310
446 Ga0081455_10017146
447 Ga0081538_10001192
448 Ga0081538_10002788
449 Ga0081538_10006110
450 Ga0081538_10013347
451 Ga0081538_10015299
452 Ga0081540_1026238
453 Ga0081539_10000680
454 Ga0081539_10001247
455 Ga0081539_10003468
456 Ga0081539_10048184
457 Ga0070717_10059789
458 Ga0075432_10001029
459 Ga0070712_100133462
460 Ga0068871_100042166
461 Ga0075428_100001346
462 Ga0075430_100000905
463 Ga0075431_100037483
464 Ga0075433_10049719
465 Ga0075433_10049728
466 Ga0075429_100002928
467 Ga0075435_100059854
468 Ga0105251_10012920
469 Ga0105244_10010795
470 Ga0105244_10046971
471 Ga0105244_10053971
472 Ga0111539_10019608
473 Ga0105245_10023302
474 Ga0114129_10004039
475 Ga0114129_10536742
476 Ga0105243_10010102
477 Ga0105243_10036137
478 Ga0105243_10051546
479 Ga0105243_10089858
480 Ga0105242_10128124
481 Ga0105248_10044830
482 Ga0105248_10188294
483 Ga0105249_10011597
484 Ga0105246_10000798
485 Ga0105246_10166281
486 Ga0157371_10014973
487 Ga0157371_10067823
488 Ga0157370_10006769
489 Ga0157370_10158863
490 Ga0157369_10074096
491 Ga0157369_10099452
492 Ga0157378_10105322
493 Ga0163162_10020655
494 Ga0163162_10021371
495 Ga0163162_10080921
496 Ga0157372_10001996
497 Ga0157372_10353860
498 Ga0157375_10018885
499 Ga0157375_10086095
500 Ga0163163_10015691
501 Ga0163163_10030167
502 Ga0157379_10010789
503 Ga0157376_10083539
504 Ga0163161_10002715
505 Ga0209129_1000100
506 Ga0209025_1002143
507 Ga0207697_10007501
508 Ga0207656_10015778
509 Ga0207655_1014734
510 Ga0207682_10006877
511 Ga0207692_10011727
512 Ga0207642_10019540
513 Ga0207688_10017611
514 Ga0207680_10012376
515 Ga0207647_10032188
516 Ga0207699_10048191
517 Ga0207645_10000494
518 Ga0207693_10009011
519 Ga0207693_10140105
520 Ga0207657_10024691
521 Ga0207681_10017303
522 Ga0207650_10048188
523 Ga0207659_10064404
524 Ga0207664_10027827
525 Ga0207664_10111453
526 Ga0207664_10295253
527 Ga0207706_10006477
528 Ga0207706_10021283
529 Ga0207686_10016403
530 Ga0207686_10093495
531 Ga0207709_10027534
532 Ga0207709_10057955
533 Ga0207709_10063359
534 Ga0207709_10135035
535 Ga0207691_10002730
536 Ga0207661_10002423
537 Ga0207668_10148939
538 Ga0207658_10136756
539 Ga0207703_10043635
540 Ga0207639_10085065
541 Ga0207678_10007828
542 Ga0207702_10105434
543 Ga0207702_10227186
544 Ga0207641_10027531
545 Ga0207676_10078539
546 Ga0207674_10004941
547 Ga0207675_100026514
548 Ga0207675_100130823
549 Ga0207683_10002316
550 Ga0207683_10004822
551 Ga0207683_10043950
552 Ga0207698_10149519
553 Ga0207428_10001624
554 Ga0268266_10153798
555 Ga0307515_10083043
556 Ga0307512_10008732
557 Ga0316181_1106309
558 Ga0307408_100016052
559 Ga0307408_100032758
560 Ga0307408_100104960
561 Ga0307408_100168039
562 Ga0307408_100178394
563 Ga0307405_10036029
564 Ga0307413_10038279
565 Ga0307413_10182398
566 Ga0307410_10004710
567 Ga0307410_10029707
568 Ga0307410_10055553
569 Ga0307410_10084115
570 Ga0307406_10000081
571 Ga0307406_10000107
572 Ga0307407_10002638
573 Ga0307407_10020559
574 Ga0307412_10011122
575 Ga0307409_100000155
576 Ga0307409_100007182
577 Ga0307409_100017840
578 Ga0307409_100125886
579 Ga0307409_100197604
580 Ga0307416_100000244
581 Ga0307416_100001634
582 Ga0307416_100024404
583 Ga0307416_100035434
584 Ga0307416_100078850
585 Ga0307416_100097507
586 Ga0307416_100137198
587 Ga0307416_100346985
588 Ga0307414_10038828
589 Ga0307414_10044145
590 Ga0307414_10052246
591 Ga0307411_10005941
592 Ga0307411_10015533
593 Ga0307411_10229207
594 Ga0307415_100002229
595 Ga0307415_100012856
596 Ga0307415_100099599
597 Ga0307415_100302519
598 Ga0373952_0003736
599 Ga0373960_0011782
600 Ga0373942_0007477
601 Ga0395899_0012641
602 Ga0395899_0072739
603 Ga0395900_0002060
604 Ga0395900_0133912
605 Ga0395900_0190042
606 Ga0395898_0019641
607 Ga0395898_0077212
608 Ga0395901_0039649
609 Ga0395901_0070642
610 Ga0439461_0005777
611 Ga0439433_0003564
612 Ga0439433_0015518
613 Ga0439442_000093
614 Ga0439442_000260
615 Ga0439442_001647
616 Ga0439448_0007536
617 Ga0439449_0004875
618 Ga0439449_0043999
619 Ga0439450_000281
620 Ga0439455_0002423
621 Ga0439463_001117
622 Ga0439463_002964
623 Ga0439463_017465
624 Ga0450919_001228
625 Ga0450920_000863
626 Ga0450920_003907
627 Ga0450920_010742
628 Ga0450905_001806
629 Ga0450907_000188
630 Ga0439458_0021592
631 Ga0450909_004486
632 Ga0439434_0000495
633 Ga0439434_0002515
634 Ga0439464_0000258
635 Ga0450916_000302
636 Ga0450918_000588
637 Ga0466966_0063511
638 Ga0466961_0005474
639 Ga0466963_0083822
640 Ga0466970_0000022
641 Ga0466959_0006764
642 Ga0466959_0193562
643 Ga0451576_0032393
644 Ga0466958_0097735
645 Ga0495586_0046296
646 Ga0495645_0048508
647 Ga0495668_0043166
648 Ga0495588_0009131
649 Ga0495588_0012148
650 Ga0495581_0085262
651 Ga0495675_0003278
652 Ga0495677_0026403
653 Ga0496100_0015642
654 Ga0496100_0074510
655 Ga0496101_0108011
656 Ga0496102_0005395
657 Ga0496102_0017725
658 Ga0496102_0021598
659 Ga0496102_0263588
660 Ga0496103_0015209
661 Ga0496104_0010894
662 Ga0496105_0066618
663 Ga0496105_0133373
664 Ga0496106_0031879
665 Ga0496106_0083564
666 Ga0496108_0006512
667 Ga0496108_0031848
668 Ga0496108_0099778
669 Ga0496109_0034088
670 Ga0496109_0131226
671 Ga0496110_0016093
672 Ga0496110_0018230
673 Ga0496110_0075836
674 Ga0496111_0076137
675 Ga0496111_0107654
676 Ga0496112_0003689
677 Ga0496112_0016808
678 Ga0496112_0121080
679 Ga0496112_0206818
680 Ga0496113_0075158
681 Ga0496113_0123128
682 Ga0496114_0019292
683 Ga0496115_0066255
684 Ga0496117_0079269
685 Ga0496119_0063428
686 Ga0501032_0009371
687 Ga0501034_0000066
688 Ga0501034_0000590
689 Ga0501034_0005234
690 Ga0501034_0116933
691 Ga0501036_0025558
692 Ga0501036_0043175
693 Ga0501037_0063299
694 Ga0501037_0067536
695 Ga0501038_0002940
696 Ga0501038_0006926
697 Ga0501039_0016177
698 Ga0501041_0006920
699 Ga0501042_0014623
700 Ga0501042_0149904
701 Ga0501043_0003252
702 Ga0501043_0048690
703 Ga0501047_0042142
704 Ga0501048_0035252
705 Ga0501068_0033952
706 Ga0501070_0002018
707 Ga0501072_0018232
708 Ga0501074_0010934
709 Ga0501075_0123893
710 Ga0501076_0038374
711 Ga0501077_0005629
712 Ga0501035_0042490
713 Ga0501044_0009131
714 Ga0501044_0239654
715 Ga0501045_0029345
716 nmdc:mga05p37_2485_c1
717 nmdc:mga05p37_51899_c1
718 nmdc:mga09592_423_c1
719 nmdc:mga0qj67_1954_c1
720 nmdc:mga08y16_10916_c1
721 nmdc:mga08y16_15093_c1
722 nmdc:mga0a205_15739_c1
723 nmdc:mga0a205_26767_c1
724 nmdc:mga0a205_29842_c1
725 Ga0501084_0018008
726 Ga0501082_0008799
727 Ga0466962_0002015
728 Ga0530510_0001746
729 2945941640
730 2643768407
731 2691515335
732 2691515979
733 2775658173
734 2808828530
735 2808849775
736 2808877634
737 2808892742
738 2808899090
739 2812319764
740 2844850153
741 2857743669
742 2867352358
743 2867375156
744 2904500755
745 2904779610
746 2910809796
747 2919037461
748 2919061266
749 2919394239
750 2919443716
751 2919542655
752 2932429732
753 2933419238
754 2939601503
755 2939650607
756 2939675960
757 2945917510
758 2945922198
759 2945960655
760 2946027016
761 2946037542
762 2946041749
763 2946061335
764 2946083575
765 2953998810
766 2974305574
767 8004024358
768 8004028052
769 8053947292
770 8054109580

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22484

DUF6986

Domain of unknown function (DUF6986)

17

415

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qll-assembly1.cif.gz_A crystal structure of ripc from yersinia pestis 0.7776 98 324
1u5v-assembly1.cif.gz_A structure of cite complexed with triphosphate group of atp form mycobacterium tuberculosis 0.7469 34 324
6chu-assembly1.cif.gz_A crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium and acetate 0.7445 34 366
1u5h-assembly1.cif.gz_A structure of citrate lyase beta subunit from mycobacterium tuberculosis 0.7429 34 324
3oyz-assembly1.cif.gz_A haloferax volcanii malate synthase pyruvate/acetyl-coa ternary complex 0.7414 89 323
ID Description Score Start End Superfamily
3qllC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.773 32 324 3.20.20.60
af_P0A9I1_3_299_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.7566 34 373 3.20.20.60
3qllC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.7444 32 324 3.20.20.60
af_P0A9I1_3_299_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.7382 34 373 3.20.20.60
1z6kA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.7357 34 324 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A2S8MGU9-F1-model_v4 deleted 0.99 137 327
AF-A0A7W0KKP9-F1-model_v4 Aldolase 0.9804 221 393 GO:0000287
GO:0003824
GO:0006107
AF-A0A3D3KYZ2-F1-model_v4 Aldolase 0.9803 242 402
AF-A0A6G2URF6-F1-model_v4 Aldolase 0.976 171 371 GO:0000287
GO:0003824
GO:0006107
AF-A0A2S8MGU9-F1-model_v4 deleted 0.9748 137 327

Map