F430341

General Info

Members Datasets Scaffolds Average Seq Length
385 246 770 272

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0245206|Ga0501084_0245206_462_1445
Length 316
Sequence MARRTRLDTELVRRGLARSREQAAALVAAGRVQVRGVVAGKAAAMVDPADPVRVVGGDPAREYVSRGGYKLAGALAAFAPSGLAVAGRRCLDAGASTGGFTDVLLRAGAAEVVAVDVGYGQLAWSLRTDARVRVLERTNVRTLTPAGIGGPVELTVADLSFISLRLVLPALAGCTVDGGDLALMVKPQFEVGRELVGAGGVVRDPQLRADAVLAVAATAADLGLGVAGVATSPLPGPSGNVEFFVWFRDDAPPVNPDRVRSVIATGTADVPHPGPPTGRPTGTDPAANSLDGSDPGVDRRSVQSAGPGPTGREEPR

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
82 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
98 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
99 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
109 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
183 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
184 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
185 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
186 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
187 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
190 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
192 2501939600 Micromonospora sp. L5 Isolate Unclassified
193 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
194 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
195 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
196 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
197 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
198 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
199 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
200 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
201 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
202 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
203 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
204 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
205 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
206 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
207 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
208 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
209 2855683550 Micromonospora sp. RP3T Isolate Unclassified
210 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
211 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
212 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
213 2858868258 Micromonospora sp. MH33 Isolate Unclassified
214 2858882152 Micromonospora noduli MED15 Isolate Nodule
215 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
216 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
217 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
218 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
219 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
220 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
221 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
222 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
223 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
224 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
225 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
226 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
227 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
228 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
229 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
230 2902582711 Micromonospora sp. AP08 Isolate Unclassified
231 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
232 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
233 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
234 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
235 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
236 649633069 Micromonospora sp. L5 Isolate Unclassified
237 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
238 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
239 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
240 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
241 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
242 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
243 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
244 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
245 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
246 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.71
Metatranscriptomes 0
Isolates 14.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 1.3
Rhizoplane 8.31
Rhizosphere 66.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0245206 3300054114 Bacteria 1512
2 JGI24737J22298_10064982 3300001990 Bacteria 1094
3 JGI24034J26672_10018637 3300002239 Bacteria 1079
4 Ga0055540_1000147 3300003792 Bacteria 70743
5 Ga0055540_1002003 3300003792 Bacteria 11371
6 Ga0070668_100074610 3300005347 Bacteria 2646
7 Ga0070669_100026082 3300005353 Bacteria 4203
8 Ga0070671_100003200 3300005355 Bacteria 12768
9 Ga0070674_100438469 3300005356 Bacteria 1076
10 Ga0070667_100000905 3300005367 Bacteria 27397
11 Ga0070667_100006714 3300005367 Bacteria 9561
12 Ga0070714_100616079 3300005435 Bacteria 1043
13 Ga0070663_100170937 3300005455 Bacteria 1680
14 Ga0070706_100009249 3300005467 Bacteria 9177
15 Ga0070698_100004194 3300005471 Bacteria 15831
16 Ga0070679_100044718 3300005530 Bacteria 4412
17 Ga0070679_100310723 3300005530 Bacteria 1526
18 Ga0070684_100139610 3300005535 Bacteria 2191
19 Ga0068853_100037455 3300005539 Bacteria 4127
20 Ga0070665_100018502 3300005548 Bacteria 6983
21 Ga0070665_100076521 3300005548 Bacteria 3353
22 Ga0068855_100055988 3300005563 Bacteria 4628
23 Ga0068857_100025454 3300005577 Bacteria 5211
24 Ga0068854_100023965 3300005578 Bacteria 4173
25 Ga0068856_100023657 3300005614 Bacteria 5974
26 Ga0068852_100019076 3300005616 Bacteria 5419
27 Ga0068859_100154278 3300005617 Bacteria 2373
28 Ga0068864_100006462 3300005618 Bacteria 9603
29 Ga0068863_100005279 3300005841 Bacteria 12755
30 Ga0068863_100703032 3300005841 Bacteria 1005
31 Ga0068858_100044029 3300005842 Bacteria 4138
32 Ga0068858_100074891 3300005842 Bacteria 3144
33 Ga0068858_100899745 3300005842 Bacteria 865
34 Ga0068860_100001313 3300005843 Bacteria 27011
35 Ga0068860_100024908 3300005843 Bacteria 5776
36 Ga0068862_100000600 3300005844 Bacteria 37473
37 Ga0068862_100037449 3300005844 Bacteria 4112
38 Ga0068862_100462720 3300005844 Bacteria 1197
39 Ga0068862_100468622 3300005844 Bacteria 1190
40 Ga0081539_10003182 3300005985 Bacteria 20788
41 Ga0081539_10003862 3300005985 Bacteria 17560
42 Ga0081539_10012319 3300005985 Bacteria 6611
43 Ga0081539_10017366 3300005985 Bacteria 5057
44 Ga0081539_10023190 3300005985 Bacteria 4073
45 Ga0070717_10398545 3300006028 Bacteria 1236
46 Ga0075365_10027342 3300006038 Bacteria 3629
47 Ga0075428_100000105 3300006844 Bacteria 70978
48 Ga0075428_100028356 3300006844 Bacteria 6193
49 Ga0075428_100068310 3300006844 Bacteria 3888
50 Ga0075431_100033273 3300006847 Bacteria 5313
51 Ga0075431_100094051 3300006847 Bacteria 3093
52 Ga0075431_100100432 3300006847 Bacteria 2985
53 Ga0075431_100187856 3300006847 Bacteria 2118
54 Ga0075431_100553044 3300006847 Bacteria 1138
55 Ga0075429_100001059 3300006880 Bacteria 21989
56 Ga0075429_100002370 3300006880 Bacteria 15860
57 Ga0075429_100201628 3300006880 Bacteria 1743
58 Ga0097620_100154277 3300006931 Bacteria 2373
59 Ga0105240_10039914 3300009093 Bacteria 6008
60 Ga0105247_10000363 3300009101 Bacteria 38715
61 Ga0114129_10000017 3300009147 Bacteria 126216
62 Ga0114129_10002051 3300009147 Bacteria 27655
63 Ga0114129_10024110 3300009147 Bacteria 8621
64 Ga0114129_11068279 3300009147 Bacteria 1012
65 Ga0105241_10024005 3300009174 Bacteria 4527
66 Ga0105248_10022603 3300009177 Bacteria 6978
67 Ga0105237_10005561 3300009545 Bacteria 14215
68 Ga0105237_10014969 3300009545 Bacteria 8085
69 Ga0105237_10039089 3300009545 Bacteria 4790
70 Ga0105237_10209700 3300009545 Bacteria 1948
71 Ga0105238_10021420 3300009551 Bacteria 6584
72 Ga0105238_10206419 3300009551 Bacteria 1941
73 Ga0105249_10000563 3300009553 Bacteria 34180
74 Ga0105239_10020343 3300010375 Bacteria 7321
75 Ga0105239_10027838 3300010375 Bacteria 6218
76 Ga0157373_10413293 3300013100 Bacteria 968
77 Ga0157369_10096086 3300013105 Bacteria 3162
78 Ga0157369_10159149 3300013105 Bacteria 2384
79 Ga0157374_10096967 3300013296 Bacteria 2820
80 Ga0157374_10533751 3300013296 Bacteria 1180
81 Ga0157372_10500704 3300013307 Bacteria 1417
82 Ga0163163_10015394 3300014325 Bacteria 7071
83 Ga0163163_10042945 3300014325 Bacteria 4430
84 Ga0163163_10136039 3300014325 Bacteria 2499
85 Ga0157379_10306731 3300014968 Bacteria 1447
86 Ga0209051_1000333 3300025303 Bacteria 70796
87 Ga0209051_1000789 3300025303 Bacteria 33294
88 Ga0209051_1004449 3300025303 Bacteria 8625
89 Ga0207710_10000309 3300025900 Bacteria 38647
90 Ga0207684_10005343 3300025910 Bacteria 11872
91 Ga0207654_10020301 3300025911 Bacteria 3520
92 Ga0207707_10022708 3300025912 Bacteria 5486
93 Ga0207695_10007387 3300025913 Bacteria 14019
94 Ga0207671_10002012 3300025914 Bacteria 22351
95 Ga0207671_10006218 3300025914 Bacteria 10712
96 Ga0207671_10026588 3300025914 Bacteria 4334
97 Ga0207652_10151906 3300025921 Bacteria 2074
98 Ga0207652_10262230 3300025921 Bacteria 1559
99 Ga0207681_10003160 3300025923 Bacteria 10344
100 Ga0207694_10002891 3300025924 Bacteria 13807
101 Ga0207700_10205986 3300025928 Bacteria 1660
102 Ga0207664_10355651 3300025929 Bacteria 1297
103 Ga0207711_10005648 3300025941 Bacteria 10568
104 Ga0207711_10172923 3300025941 Bacteria 1961
105 Ga0207689_10018015 3300025942 Bacteria 5964
106 Ga0207689_10196739 3300025942 Bacteria 1664
107 Ga0207712_10000016 3300025961 Bacteria 343014
108 Ga0207668_10001826 3300025972 Bacteria 12428
109 Ga0207668_10066006 3300025972 Bacteria 2563
110 Ga0207640_10032305 3300025981 Bacteria 3244
111 Ga0207658_10002895 3300025986 Bacteria 12300
112 Ga0207658_10004486 3300025986 Bacteria 9703
113 Ga0207703_10188670 3300026035 Bacteria 1824
114 Ga0207639_10047034 3300026041 Bacteria 3259
115 Ga0207678_10042759 3300026067 Bacteria 3923
116 Ga0207641_10003179 3300026088 Bacteria 14698
117 Ga0207641_10074032 3300026088 Bacteria 2937
118 Ga0207641_10160066 3300026088 Bacteria 2046
119 Ga0207676_10580267 3300026095 Bacteria 1075
120 Ga0207674_10507873 3300026116 Bacteria 1165
121 Ga0207683_10008673 3300026121 Bacteria 8692
122 Ga0268266_10009508 3300028379 Bacteria 8555
123 Ga0268266_10314270 3300028379 Bacteria 1464
124 Ga0268265_10000572 3300028380 Bacteria 37490
125 Ga0268265_10029082 3300028380 Bacteria 3963
126 Ga0268265_10341328 3300028380 Bacteria 1364
127 Ga0268264_10000053 3300028381 Bacteria 320368
128 Ga0268264_10215857 3300028381 Bacteria 1763
129 Ga0307517_10189102 3300028786 Bacteria 1311
130 Ga0307517_10250940 3300028786 Bacteria 1038
131 Ga0307515_10000924 3300028794 Bacteria 67427
132 Ga0307515_10022061 3300028794 Bacteria 11247
133 Ga0307515_10037553 3300028794 Bacteria 7786
134 Ga0307515_10113933 3300028794 Bacteria 3130
135 Ga0307512_10018708 3300030522 Bacteria 6323
136 Ga0265328_10018235 3300031239 Bacteria 2709
137 Ga0265327_10002859 3300031251 Bacteria 17383
138 Ga0307513_10012858 3300031456 Bacteria 10303
139 Ga0307513_10021263 3300031456 Bacteria 7663
140 Ga0307509_10151060 3300031507 Bacteria 2238
141 Ga0307408_100047368 3300031548 Bacteria 3078
142 Ga0307508_10024420 3300031616 Bacteria 5485
143 Ga0307508_10143454 3300031616 Bacteria 1992
144 Ga0307516_10002219 3300031730 Bacteria 26301
145 Ga0307516_10016179 3300031730 Bacteria 7815
146 Ga0307516_10088921 3300031730 Bacteria 2920
147 Ga0307410_10002615 3300031852 Bacteria 8762
148 Ga0307410_10027263 3300031852 Bacteria 3609
149 Ga0307406_10011429 3300031901 Bacteria 5039
150 Ga0307406_10067774 3300031901 Bacteria 2328
151 Ga0307406_10078247 3300031901 Bacteria 2190
152 Ga0307406_10331077 3300031901 Bacteria 1182
153 Ga0307406_10364752 3300031901 Bacteria 1134
154 Ga0307407_10078301 3300031903 Bacteria 1991
155 Ga0307409_100006656 3300031995 Bacteria 6822
156 Ga0307409_100008028 3300031995 Bacteria 6365
157 Ga0307409_100052267 3300031995 Bacteria 3131
158 Ga0307409_100103589 3300031995 Bacteria 2367
159 Ga0307409_100308766 3300031995 Bacteria 1475
160 Ga0307416_100181335 3300032002 Bacteria 1974
161 Ga0307416_100197090 3300032002 Bacteria 1906
162 Ga0307416_100362520 3300032002 Bacteria 1472
163 Ga0307416_100548246 3300032002 Bacteria 1229
164 Ga0307411_10197344 3300032005 Bacteria 1542
165 Ga0307415_100004315 3300032126 Bacteria 7362
166 Ga0307415_100023739 3300032126 Bacteria 3814
167 Ga0307415_100056981 3300032126 Bacteria 2683
168 Ga0307415_100087685 3300032126 Bacteria 2243
169 Ga0307415_100311238 3300032126 Bacteria 1309
170 Ga0307510_10053744 3300033180 Bacteria 4229
171 Ga0373951_0000478 3300035091 Bacteria 11465
172 Ga0373942_0001934 3300035207 Bacteria 5185
173 Ga0373962_0000410 3300035242 Bacteria 9392
174 Ga0316584_0233611 3300036712 Bacteria 1347
175 Ga0395899_0057160 3300037312 Bacteria 2881
176 Ga0395900_0060262 3300037418 Bacteria 3906
177 Ga0395898_0048133 3300037466 Bacteria 4182
178 Ga0395898_0251837 3300037466 Bacteria 1684
179 Ga0395898_0709901 3300037466 Bacteria 947
180 Ga0395905_0033797 3300037471 Bacteria 4803
181 Ga0395905_0106023 3300037471 Bacteria 2639
182 Ga0395901_0003926 3300038443 Bacteria 14954
183 Ga0395901_0133251 3300038443 Bacteria 2611
184 Ga0400483_035435 3300039062 Bacteria 1248
185 Ga0400483_120469 3300039062 Bacteria 1314
186 Ga0400483_203034 3300039062 Bacteria 3617
187 Ga0400483_262266 3300039062 Bacteria 1528
188 Ga0436362_0961432 3300039453 Bacteria 1069
189 Ga0439448_0002485 3300042005 Bacteria 5025
190 Ga0466972_0048293 3300044658 Bacteria 2056
191 Ga0466965_0016322 3300044683 Bacteria 3531
192 Ga0466965_0165729 3300044683 Bacteria 1160
193 Ga0466966_0075104 3300044684 Bacteria 2112
194 Ga0466966_0262742 3300044684 Bacteria 1039
195 Ga0466961_0019662 3300044693 Bacteria 4345
196 Ga0466961_0028392 3300044693 Bacteria 3597
197 Ga0466961_0202312 3300044693 Bacteria 1228
198 Ga0466963_0045973 3300044694 Bacteria 2877
199 Ga0466964_0037534 3300044706 Bacteria 1946
200 Ga0466964_0202339 3300044706 Bacteria 954
201 Ga0466968_0141563 3300044735 Bacteria 1100
202 Ga0466970_0011842 3300044765 Bacteria 4449
203 Ga0466970_0018242 3300044765 Bacteria 3630
204 Ga0466970_0056551 3300044765 Bacteria 2096
205 Ga0466970_0115104 3300044765 Bacteria 1470
206 Ga0466970_0127564 3300044765 Bacteria 1396
207 Ga0466957_0110567 3300044842 Bacteria 1742
208 Ga0466957_0173385 3300044842 Bacteria 1406
209 Ga0466957_0206388 3300044842 Bacteria 1292
210 Ga0466957_0251417 3300044842 Bacteria 1175
211 Ga0466960_0139006 3300044901 Bacteria 1289
212 Ga0466959_0009679 3300045049 Bacteria 6861
213 Ga0466959_0041986 3300045049 Bacteria 3375
214 Ga0466959_0046506 3300045049 Bacteria 3193
215 Ga0466958_0019186 3300045836 Bacteria 3978
216 Ga0466958_0160563 3300045836 Bacteria 1420
217 Ga0466967_0015345 3300045976 Bacteria 6000
218 Ga0466967_0079465 3300045976 Bacteria 2957
219 Ga0466967_0191633 3300045976 Bacteria 1932
220 Ga0466967_0206612 3300045976 Bacteria 1861
221 Ga0466967_0266604 3300045976 Bacteria 1640
222 Ga0466967_0309786 3300045976 Bacteria 1521
223 Ga0495651_0003282 3300046462 Bacteria 12418
224 Ga0495651_0006883 3300046462 Bacteria 8688
225 Ga0495583_0023377 3300046506 Bacteria 3128
226 Ga0495606_0002262 3300046507 Bacteria 22840
227 Ga0495606_0012663 3300046507 Bacteria 6734
228 Ga0495608_0006974 3300046511 Bacteria 7997
229 Ga0495628_0046021 3300046516 Bacteria 3467
230 Ga0495630_0279978 3300046517 Bacteria 1274
231 Ga0495632_0095125 3300046519 Bacteria 1408
232 Ga0495663_0082578 3300046525 Bacteria 1037
233 Ga0495652_0016008 3300046529 Bacteria 6709
234 Ga0495586_0067667 3300046535 Bacteria 1948
235 Ga0495587_0038807 3300046536 Bacteria 2853
236 Ga0495668_0000386 3300046616 Bacteria 58109
237 Ga0495611_0020008 3300046648 Bacteria 2879
238 Ga0495625_0001172 3300046660 Bacteria 33689
239 Ga0495623_0027246 3300046679 Bacteria 3675
240 Ga0495671_0052789 3300046692 Bacteria 2020
241 Ga0495581_0033264 3300047315 Bacteria 2985
242 Ga0495604_0074656 3300047317 Bacteria 2555
243 Ga0495672_0017282 3300047320 Bacteria 4828
244 Ga0495680_0032264 3300047322 Bacteria 4253
245 Ga0495673_0001212 3300047469 Bacteria 21466
246 Ga0495686_0167285 3300047472 Bacteria 1281
247 Ga0495602_0014039 3300048088 Bacteria 8152
248 Ga0495626_0004546 3300048091 Bacteria 8469
249 Ga0496100_0000157 3300048903 Bacteria 38109
250 Ga0496100_0007716 3300048903 Bacteria 5957
251 Ga0496101_0000295 3300048904 Bacteria 34847
252 Ga0496101_0000353 3300048904 Bacteria 31006
253 Ga0496101_0016417 3300048904 Bacteria 5002
254 Ga0496102_0000239 3300048905 Bacteria 72112
255 Ga0496102_0000989 3300048905 Bacteria 26703
256 Ga0496103_0000148 3300048906 Bacteria 72710
257 Ga0496103_0000679 3300048906 Bacteria 25570
258 Ga0496103_0007820 3300048906 Bacteria 6353
259 Ga0496104_0110422 3300048907 Bacteria 2636
260 Ga0496105_0006100 3300048908 Bacteria 9225
261 Ga0496106_0006883 3300048909 Bacteria 8412
262 Ga0496106_0207195 3300048909 Bacteria 1561
263 Ga0496107_0013997 3300048910 Bacteria 5614
264 Ga0496107_0043148 3300048910 Bacteria 3240
265 Ga0496108_0000555 3300048911 Bacteria 29286
266 Ga0496108_0052814 3300048911 Bacteria 3407
267 Ga0496108_0278393 3300048911 Bacteria 1456
268 Ga0496109_0000200 3300048912 Bacteria 59537
269 Ga0496109_0003154 3300048912 Bacteria 13740
270 Ga0496109_0016898 3300048912 Bacteria 6385
271 Ga0496109_0399788 3300048912 Bacteria 1298
272 Ga0496110_0012672 3300048913 Bacteria 6938
273 Ga0496110_0012907 3300048913 Bacteria 6888
274 Ga0496111_0001525 3300048914 Bacteria 13297
275 Ga0496111_0011061 3300048914 Bacteria 6074
276 Ga0496112_0104042 3300048915 Bacteria 2809
277 Ga0496112_0404511 3300048915 Bacteria 1305
278 Ga0496113_0045165 3300048916 Bacteria 3266
279 Ga0496114_0000560 3300048917 Bacteria 27551
280 Ga0496115_0013981 3300048918 Bacteria 6075
281 Ga0496116_0000355 3300048919 Bacteria 72106
282 Ga0496117_0000051 3300048920 Bacteria 285716
283 Ga0496117_0001798 3300048920 Bacteria 29146
284 Ga0496117_0138785 3300048920 Bacteria 1459
285 Ga0496118_0000043 3300048921 Bacteria 285716
286 Ga0496118_0006591 3300048921 Bacteria 12680
287 Ga0496119_0000990 3300048922 Bacteria 36498
288 Ga0496119_0039525 3300048922 Bacteria 3030
289 Ga0496120_0001994 3300048923 Bacteria 22232
290 Ga0496120_0015253 3300048923 Bacteria 5080
291 Ga0496120_0032564 3300048923 Bacteria 3141
292 Ga0496121_0000134 3300048924 Bacteria 165728
293 Ga0496121_0005390 3300048924 Bacteria 16432
294 Ga0496121_0165927 3300048924 Bacteria 1609
295 Ga0496122_0001041 3300048925 Bacteria 48644
296 Ga0496123_0026903 3300048926 Bacteria 4297
297 Ga0496124_0000113 3300048927 Bacteria 165710
298 Ga0496124_0318585 3300048927 Bacteria 1114
299 Ga0496125_0000127 3300048928 Bacteria 165710
300 Ga0496125_0045997 3300048928 Bacteria 3666
301 Ga0496126_0000140 3300048929 Bacteria 165728
302 Ga0496126_0005587 3300048929 Bacteria 14302
303 Ga0496126_0100683 3300048929 Bacteria 2528
304 Ga0496126_0136985 3300048929 Bacteria 2111
305 Ga0501034_0122784 3300049571 Bacteria 2583
306 Ga0501070_0199293 3300049586 Bacteria 1644
307 Ga0501044_0009877 3300049823 Bacteria 10372
308 nmdc:mga05p37_6457_c1 3300050507 Bacteria 13829
309 nmdc:mga05p37_709_c1 3300050507 Bacteria 37005
310 nmdc:mga05p37_810439_c1 3300050507 Bacteria 1023
311 nmdc:mga09592_49239_c1 3300050508 Bacteria 3553
312 nmdc:mga09592_669_c1 3300050508 Bacteria 26222
313 nmdc:mga0qj67_1073_c1 3300050509 Bacteria 18940
314 nmdc:mga0qj67_45403_c1 3300050509 Bacteria 3467
315 nmdc:mga0qj67_802_c1 3300050509 Bacteria 18629
316 nmdc:mga06r32_32821_c1 3300050510 Bacteria 4888
317 nmdc:mga06r32_90076_c1 3300050510 Bacteria 2996
318 Ga0495601_0040990 3300053077 Bacteria 2901
319 Ga0495619_0049645 3300053085 Bacteria 2768
320 Ga0500643_006939 3300053087 Bacteria 4651
321 Ga0500644_0084181 3300053088 Bacteria 1176
322 Ga0500646_0079618 3300053090 Bacteria 998
323 Ga0500650_0019710 3300053098 Bacteria 2948
324 Ga0500660_072106 3300053100 Bacteria 1615
325 Ga0500652_009363 3300053131 Bacteria 3311
326 Ga0500568_0003039 3300053139 Bacteria 9594
327 Ga0500600_0060140 3300053149 Bacteria 2121
328 Ga0500633_0118263 3300053160 Bacteria 985
329 Ga0466962_0020046 3300061719 Bacteria 3215
330 Ga0466962_0135182 3300061719 Bacteria 1193
331 2501941024 2501939600 Bacteria 6907073
332 2515497725 2515154088 Bacteria 5526283
333 2515722766 2515154129 Bacteria 5584369
334 2515757611 2515154137 Bacteria 5711575
335 2516086966 2515154202 Bacteria 5471270
336 2516092461 2515154203 Bacteria 5458536
337 2623498638 2622736605 Bacteria 4992138
338 2623588053 2622736626 Bacteria 7181580
339 2676484542 2675903059 Bacteria 8644972
340 2738667802 2738541264 Bacteria 5935393
341 2739146872 2738541356 Bacteria 5935017
342 2753270145 2751185782 Bacteria 11227053
343 2772643191 2772190715 Bacteria 6959372
344 2795797939 2795385472 Bacteria 6627535
345 2831939286 2831935698 Bacteria 5963223
346 2832008769 2832004796 Bacteria 6538017
347 2855672914 2855670206 Bacteria 7120389
348 2855687183 2855683550 Bacteria 7134265
349 2856862081 2856858025 Bacteria 7255264
350 2857290480 2857288857 Bacteria 7189066
351 2858853621 2858848962 Bacteria 6963058
352 2858873782 2858868258 Bacteria 7683772
353 2858885727 2858882152 Bacteria 7230291
354 2858893898 2858888857 Bacteria 7060307
355 2858897750 2858895516 Bacteria 7378898
356 2858908588 2858902515 Bacteria 7086037
357 2866070776 2866065130 Bacteria 6518152
358 2866614238 2866612099 Bacteria 7543886
359 2867317944 2867312974 Bacteria 7058875
360 2867324138 2867319477 Bacteria 7069771
361 2867510422 2867507094 Bacteria 6506033
362 2869051842 2869048445 Bacteria 6875584
363 2869064593 2869061728 Bacteria 7112407
364 2869075078 2869068681 Bacteria 7205615
365 2880492004 2880489317 Bacteria 7096270
366 2880500291 2880495981 Bacteria 7340502
367 2887486349 2887478801 Bacteria 8972725
368 2891328334 2891326441 Bacteria 6439512
369 2902586047 2902582711 Bacteria 6187705
370 2902793636 2902792274 Bacteria 7270173
371 2917741136 2917736166 Bacteria 9690793
372 2929222185 2929219909 Bacteria 6984360
373 2929228851 2929226422 Bacteria 7248583
374 2996226293 2996221748 Bacteria 6799777
375 649816170 649633069 Bacteria 6962533
376 8001785997 8001781756 Bacteria 9586736
377 8003834194 8003830390 Bacteria 6541657
378 8003860983 8003856774 Bacteria 7675274
379 8054709040 8054704163 Bacteria 7247792
380 8054730583 8054727385 Bacteria 7558670
381 8054739451 8054734606 Bacteria 6947278
382 8055066514 8055066027 Bacteria 9479577
383 8055179808 8055172936 Bacteria 9305943
384 8056212932 8056207758 Bacteria 8639239
385 8057572609 8057568493 Bacteria 7221719
386 Ga0501084_0245206
387 JGI24737J22298_10064982
388 JGI24034J26672_10018637
389 Ga0055540_1000147
390 Ga0055540_1002003
391 Ga0070668_100074610
392 Ga0070669_100026082
393 Ga0070671_100003200
394 Ga0070674_100438469
395 Ga0070667_100000905
396 Ga0070667_100006714
397 Ga0070714_100616079
398 Ga0070663_100170937
399 Ga0070706_100009249
400 Ga0070698_100004194
401 Ga0070679_100044718
402 Ga0070679_100310723
403 Ga0070684_100139610
404 Ga0068853_100037455
405 Ga0070665_100018502
406 Ga0070665_100076521
407 Ga0068855_100055988
408 Ga0068857_100025454
409 Ga0068854_100023965
410 Ga0068856_100023657
411 Ga0068852_100019076
412 Ga0068859_100154278
413 Ga0068864_100006462
414 Ga0068863_100005279
415 Ga0068863_100703032
416 Ga0068858_100044029
417 Ga0068858_100074891
418 Ga0068858_100899745
419 Ga0068860_100001313
420 Ga0068860_100024908
421 Ga0068862_100000600
422 Ga0068862_100037449
423 Ga0068862_100462720
424 Ga0068862_100468622
425 Ga0081539_10003182
426 Ga0081539_10003862
427 Ga0081539_10012319
428 Ga0081539_10017366
429 Ga0081539_10023190
430 Ga0070717_10398545
431 Ga0075365_10027342
432 Ga0075428_100000105
433 Ga0075428_100028356
434 Ga0075428_100068310
435 Ga0075431_100033273
436 Ga0075431_100094051
437 Ga0075431_100100432
438 Ga0075431_100187856
439 Ga0075431_100553044
440 Ga0075429_100001059
441 Ga0075429_100002370
442 Ga0075429_100201628
443 Ga0097620_100154277
444 Ga0105240_10039914
445 Ga0105247_10000363
446 Ga0114129_10000017
447 Ga0114129_10002051
448 Ga0114129_10024110
449 Ga0114129_11068279
450 Ga0105241_10024005
451 Ga0105248_10022603
452 Ga0105237_10005561
453 Ga0105237_10014969
454 Ga0105237_10039089
455 Ga0105237_10209700
456 Ga0105238_10021420
457 Ga0105238_10206419
458 Ga0105249_10000563
459 Ga0105239_10020343
460 Ga0105239_10027838
461 Ga0157373_10413293
462 Ga0157369_10096086
463 Ga0157369_10159149
464 Ga0157374_10096967
465 Ga0157374_10533751
466 Ga0157372_10500704
467 Ga0163163_10015394
468 Ga0163163_10042945
469 Ga0163163_10136039
470 Ga0157379_10306731
471 Ga0209051_1000333
472 Ga0209051_1000789
473 Ga0209051_1004449
474 Ga0207710_10000309
475 Ga0207684_10005343
476 Ga0207654_10020301
477 Ga0207707_10022708
478 Ga0207695_10007387
479 Ga0207671_10002012
480 Ga0207671_10006218
481 Ga0207671_10026588
482 Ga0207652_10151906
483 Ga0207652_10262230
484 Ga0207681_10003160
485 Ga0207694_10002891
486 Ga0207700_10205986
487 Ga0207664_10355651
488 Ga0207711_10005648
489 Ga0207711_10172923
490 Ga0207689_10018015
491 Ga0207689_10196739
492 Ga0207712_10000016
493 Ga0207668_10001826
494 Ga0207668_10066006
495 Ga0207640_10032305
496 Ga0207658_10002895
497 Ga0207658_10004486
498 Ga0207703_10188670
499 Ga0207639_10047034
500 Ga0207678_10042759
501 Ga0207641_10003179
502 Ga0207641_10074032
503 Ga0207641_10160066
504 Ga0207676_10580267
505 Ga0207674_10507873
506 Ga0207683_10008673
507 Ga0268266_10009508
508 Ga0268266_10314270
509 Ga0268265_10000572
510 Ga0268265_10029082
511 Ga0268265_10341328
512 Ga0268264_10000053
513 Ga0268264_10215857
514 Ga0307517_10189102
515 Ga0307517_10250940
516 Ga0307515_10000924
517 Ga0307515_10022061
518 Ga0307515_10037553
519 Ga0307515_10113933
520 Ga0307512_10018708
521 Ga0265328_10018235
522 Ga0265327_10002859
523 Ga0307513_10012858
524 Ga0307513_10021263
525 Ga0307509_10151060
526 Ga0307408_100047368
527 Ga0307508_10024420
528 Ga0307508_10143454
529 Ga0307516_10002219
530 Ga0307516_10016179
531 Ga0307516_10088921
532 Ga0307410_10002615
533 Ga0307410_10027263
534 Ga0307406_10011429
535 Ga0307406_10067774
536 Ga0307406_10078247
537 Ga0307406_10331077
538 Ga0307406_10364752
539 Ga0307407_10078301
540 Ga0307409_100006656
541 Ga0307409_100008028
542 Ga0307409_100052267
543 Ga0307409_100103589
544 Ga0307409_100308766
545 Ga0307416_100181335
546 Ga0307416_100197090
547 Ga0307416_100362520
548 Ga0307416_100548246
549 Ga0307411_10197344
550 Ga0307415_100004315
551 Ga0307415_100023739
552 Ga0307415_100056981
553 Ga0307415_100087685
554 Ga0307415_100311238
555 Ga0307510_10053744
556 Ga0373951_0000478
557 Ga0373942_0001934
558 Ga0373962_0000410
559 Ga0316584_0233611
560 Ga0395899_0057160
561 Ga0395900_0060262
562 Ga0395898_0048133
563 Ga0395898_0251837
564 Ga0395898_0709901
565 Ga0395905_0033797
566 Ga0395905_0106023
567 Ga0395901_0003926
568 Ga0395901_0133251
569 Ga0400483_035435
570 Ga0400483_120469
571 Ga0400483_203034
572 Ga0400483_262266
573 Ga0436362_0961432
574 Ga0439448_0002485
575 Ga0466972_0048293
576 Ga0466965_0016322
577 Ga0466965_0165729
578 Ga0466966_0075104
579 Ga0466966_0262742
580 Ga0466961_0019662
581 Ga0466961_0028392
582 Ga0466961_0202312
583 Ga0466963_0045973
584 Ga0466964_0037534
585 Ga0466964_0202339
586 Ga0466968_0141563
587 Ga0466970_0011842
588 Ga0466970_0018242
589 Ga0466970_0056551
590 Ga0466970_0115104
591 Ga0466970_0127564
592 Ga0466957_0110567
593 Ga0466957_0173385
594 Ga0466957_0206388
595 Ga0466957_0251417
596 Ga0466960_0139006
597 Ga0466959_0009679
598 Ga0466959_0041986
599 Ga0466959_0046506
600 Ga0466958_0019186
601 Ga0466958_0160563
602 Ga0466967_0015345
603 Ga0466967_0079465
604 Ga0466967_0191633
605 Ga0466967_0206612
606 Ga0466967_0266604
607 Ga0466967_0309786
608 Ga0495651_0003282
609 Ga0495651_0006883
610 Ga0495583_0023377
611 Ga0495606_0002262
612 Ga0495606_0012663
613 Ga0495608_0006974
614 Ga0495628_0046021
615 Ga0495630_0279978
616 Ga0495632_0095125
617 Ga0495663_0082578
618 Ga0495652_0016008
619 Ga0495586_0067667
620 Ga0495587_0038807
621 Ga0495668_0000386
622 Ga0495611_0020008
623 Ga0495625_0001172
624 Ga0495623_0027246
625 Ga0495671_0052789
626 Ga0495581_0033264
627 Ga0495604_0074656
628 Ga0495672_0017282
629 Ga0495680_0032264
630 Ga0495673_0001212
631 Ga0495686_0167285
632 Ga0495602_0014039
633 Ga0495626_0004546
634 Ga0496100_0000157
635 Ga0496100_0007716
636 Ga0496101_0000295
637 Ga0496101_0000353
638 Ga0496101_0016417
639 Ga0496102_0000239
640 Ga0496102_0000989
641 Ga0496103_0000148
642 Ga0496103_0000679
643 Ga0496103_0007820
644 Ga0496104_0110422
645 Ga0496105_0006100
646 Ga0496106_0006883
647 Ga0496106_0207195
648 Ga0496107_0013997
649 Ga0496107_0043148
650 Ga0496108_0000555
651 Ga0496108_0052814
652 Ga0496108_0278393
653 Ga0496109_0000200
654 Ga0496109_0003154
655 Ga0496109_0016898
656 Ga0496109_0399788
657 Ga0496110_0012672
658 Ga0496110_0012907
659 Ga0496111_0001525
660 Ga0496111_0011061
661 Ga0496112_0104042
662 Ga0496112_0404511
663 Ga0496113_0045165
664 Ga0496114_0000560
665 Ga0496115_0013981
666 Ga0496116_0000355
667 Ga0496117_0000051
668 Ga0496117_0001798
669 Ga0496117_0138785
670 Ga0496118_0000043
671 Ga0496118_0006591
672 Ga0496119_0000990
673 Ga0496119_0039525
674 Ga0496120_0001994
675 Ga0496120_0015253
676 Ga0496120_0032564
677 Ga0496121_0000134
678 Ga0496121_0005390
679 Ga0496121_0165927
680 Ga0496122_0001041
681 Ga0496123_0026903
682 Ga0496124_0000113
683 Ga0496124_0318585
684 Ga0496125_0000127
685 Ga0496125_0045997
686 Ga0496126_0000140
687 Ga0496126_0005587
688 Ga0496126_0100683
689 Ga0496126_0136985
690 Ga0501034_0122784
691 Ga0501070_0199293
692 Ga0501044_0009877
693 nmdc:mga05p37_6457_c1
694 nmdc:mga05p37_709_c1
695 nmdc:mga05p37_810439_c1
696 nmdc:mga09592_49239_c1
697 nmdc:mga09592_669_c1
698 nmdc:mga0qj67_1073_c1
699 nmdc:mga0qj67_45403_c1
700 nmdc:mga0qj67_802_c1
701 nmdc:mga06r32_32821_c1
702 nmdc:mga06r32_90076_c1
703 Ga0495601_0040990
704 Ga0495619_0049645
705 Ga0500643_006939
706 Ga0500644_0084181
707 Ga0500646_0079618
708 Ga0500650_0019710
709 Ga0500660_072106
710 Ga0500652_009363
711 Ga0500568_0003039
712 Ga0500600_0060140
713 Ga0500633_0118263
714 Ga0466962_0020046
715 Ga0466962_0135182
716 2501941024
717 2515497725
718 2515722766
719 2515757611
720 2516086966
721 2516092461
722 2623498638
723 2623588053
724 2676484542
725 2738667802
726 2739146872
727 2753270145
728 2772643191
729 2795797939
730 2831939286
731 2832008769
732 2855672914
733 2855687183
734 2856862081
735 2857290480
736 2858853621
737 2858873782
738 2858885727
739 2858893898
740 2858897750
741 2858908588
742 2866070776
743 2866614238
744 2867317944
745 2867324138
746 2867510422
747 2869051842
748 2869064593
749 2869075078
750 2880492004
751 2880500291
752 2887486349
753 2891328334
754 2902586047
755 2902793636
756 2917741136
757 2929222185
758 2929228851
759 2996226293
760 649816170
761 8001785997
762 8003834194
763 8003860983
764 8054709040
765 8054730583
766 8054739451
767 8055066514
768 8055179808
769 8056212932
770 8057572609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

5

52

0.95

PF01728

FtsJ

FtsJ-like methyltransferase

63

249

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5eov-assembly1.cif.gz_A c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. 0.9853 63 267
5eov-assembly1.cif.gz_A c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. 0.9806 63 267
3opn-assembly1.cif.gz_A the crystal structure of a putative hemolysin from lactococcus lactis 0.9292 61 261
1h3f-assembly1.cif.gz_A tyrosyl-trna synthetase from thermus thermophilus complexed with tyrosinol 0.8951 4 56
3opn-assembly1.cif.gz_A the crystal structure of a putative hemolysin from lactococcus lactis 0.8948 61 261
ID Description Score Start End Superfamily
5eovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9853 63 267 3.40.50.150
5eovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9806 63 267 3.40.50.150
af_Q9LSV5_49_110_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9431 2 53 3.10.290.10
1h3eA03 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9282 4 53 3.10.290.10
af_C0P590_106_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9273 68 253 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6M5E062-F1-model_v4 TlyA 0.9953 81 231 GO:0008168
GO:0032259
AF-A0A6B3FMK4-F1-model_v4 16S/23S rRNA (Cytidine-2'-O)-methyltransferase 0.9916 126 244 GO:0008168
GO:0032259
AF-A0A3D0ZDX3-F1-model_v4 16S/23S rRNA (Cytidine-2'-O)-methyltransferase 0.987 138 243 GO:0008168
GO:0016020
GO:0032259
AF-A0A1N0CQ81-F1-model_v4 deleted 0.9855 136 268
AF-A0A7K0PYZ2-F1-model_v4 16S/23S rRNA (Cytidine-2'-O)-methyltransferase 0.9847 89 268 GO:0008168
GO:0032259

Map