F430298

General Info

Members Datasets Scaffolds Average Seq Length
385 199 770 190

Family's Representative Sequence

Representative Sequence 3300046559|Ga0495667_0142494|Ga0495667_0142494_47_727
Length 226
Sequence MSERFLNIRNKIKRTYGFVKALGFRTVPKVTQEHLEARRAEILDGARRAFAEYGYEGATVAKLEEATGLSRGAIFHYFENKNDLFVELAMEMNTRFGDILLAEGLEEAFRELSKENPEWLAVLIETESRMRHDEDFVRRLEAKSADASPRIQEWFKQQQAEGKLRDDVSWLELGRFATSLLNGLALRVAGGDPFDIESMLRLLDDAIAAPRKPQKVRRPRPVAKTS

Samples

Sample ID Description Type Environment
1 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
79 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
85 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
86 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
87 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
100 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
101 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
102 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
103 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
104 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
105 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 1.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 7.79
Rhizosphere 91.95
Stem 0
Stem Tuber 0
Unclassified 13.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495667_0142494 3300046559 Unclassified 1544
2 Ga0070658_10046499 3300005327 Bacteria 3512
3 Ga0070658_10060229 3300005327 Bacteria 3091
4 Ga0070658_10091169 3300005327 Bacteria 2512
5 Ga0070658_10154129 3300005327 Bacteria 1925
6 Ga0070658_11277212 3300005327 Bacteria 638
7 Ga0070683_100006603 3300005329 Bacteria 9743
8 Ga0070683_100013979 3300005329 Bacteria 7011
9 Ga0070683_100551595 3300005329 Bacteria 1102
10 Ga0070680_100312985 3300005336 Bacteria 1332
11 Ga0070680_100564636 3300005336 Bacteria 976
12 Ga0070680_100776013 3300005336 Bacteria 825
13 Ga0070682_100096253 3300005337 Bacteria 1946
14 Ga0070660_100007111 3300005339 Bacteria 7779
15 Ga0070660_100012078 3300005339 Bacteria 6165
16 Ga0070660_100035161 3300005339 Unclassified 3791
17 Ga0070660_100431491 3300005339 Bacteria 1092
18 Ga0070661_100008458 3300005344 Bacteria 7119
19 Ga0070692_10026410 3300005345 Bacteria 2870
20 Ga0070671_100049827 3300005355 Bacteria 3484
21 Ga0070659_100094667 3300005366 Bacteria 2398
22 Ga0070709_10379045 3300005434 Bacteria 1051
23 Ga0070714_100006885 3300005435 Bacteria 8811
24 Ga0070714_100024225 3300005435 Bacteria 4994
25 Ga0070714_100024784 3300005435 Bacteria 4943
26 Ga0070714_100031464 3300005435 Bacteria 4427
27 Ga0070714_100033949 3300005435 Bacteria 4271
28 Ga0070714_100250462 3300005435 Bacteria 1638
29 Ga0070713_100020204 3300005436 Bacteria 5100
30 Ga0070713_100113719 3300005436 Bacteria 2363
31 Ga0070713_101267905 3300005436 Unclassified 714
32 Ga0070710_10003052 3300005437 Bacteria 7960
33 Ga0070710_10118893 3300005437 Unclassified 1597
34 Ga0070711_100010939 3300005439 Bacteria 5625
35 Ga0070711_100658040 3300005439 Bacteria 879
36 Ga0070678_100146707 3300005456 Unclassified 1895
37 Ga0070678_101036173 3300005456 Bacteria 755
38 Ga0070681_10116359 3300005458 Bacteria 2611
39 Ga0070681_10194988 3300005458 Bacteria 1945
40 Ga0070681_10253874 3300005458 Bacteria 1670
41 Ga0070707_100829481 3300005468 Bacteria 889
42 Ga0070679_100033692 3300005530 Bacteria 5071
43 Ga0070679_100035426 3300005530 Bacteria 4952
44 Ga0070679_100125029 3300005530 Bacteria 2554
45 Ga0070684_100187698 3300005535 Bacteria 1880
46 Ga0070684_100282372 3300005535 Bacteria 1521
47 Ga0070684_101029502 3300005535 Bacteria 773
48 Ga0068855_100031498 3300005563 Bacteria 6332
49 Ga0068855_100107547 3300005563 Bacteria 3204
50 Ga0068855_100383361 3300005563 Bacteria 1543
51 Ga0068855_101280149 3300005563 Bacteria 760
52 Ga0068856_100113510 3300005614 Bacteria 2707
53 Ga0068856_100212587 3300005614 Bacteria 1949
54 Ga0068856_100233675 3300005614 Bacteria 1854
55 Ga0068852_100602983 3300005616 Bacteria 1102
56 Ga0070717_10008666 3300006028 Bacteria 7606
57 Ga0070717_10053445 3300006028 Bacteria 3329
58 Ga0070717_10199172 3300006028 Bacteria 1753
59 Ga0070716_100242067 3300006173 Unclassified 1224
60 Ga0070712_100020762 3300006175 Bacteria 4302
61 Ga0070712_100034661 3300006175 Bacteria 3422
62 Ga0070712_100538545 3300006175 Unclassified 983
63 Ga0075367_10476772 3300006178 Unclassified 791
64 Ga0097621_100192043 3300006237 Unclassified 1769
65 Ga0075431_100508368 3300006847 Bacteria 1195
66 Ga0075433_10127319 3300006852 Bacteria 2262
67 Ga0075433_10288997 3300006852 Bacteria 1452
68 Ga0075434_100143315 3300006871 Bacteria 2410
69 Ga0075436_100594031 3300006914 Bacteria 815
70 Ga0075435_100178206 3300007076 Bacteria 1796
71 Ga0099795_10114656 3300007788 Bacteria 1072
72 Ga0105240_10253664 3300009093 Bacteria 2033
73 Ga0105240_10546090 3300009093 Bacteria 1283
74 Ga0111539_10168506 3300009094 Bacteria 2559
75 Ga0111539_10274253 3300009094 Bacteria 1963
76 Ga0105245_10059919 3300009098 Bacteria 3428
77 Ga0105245_10454179 3300009098 Bacteria 1290
78 Ga0105245_11143986 3300009098 Bacteria 825
79 Ga0105243_10022321 3300009148 Bacteria 4809
80 Ga0105242_10433671 3300009176 Unclassified 1235
81 Ga0105248_10155415 3300009177 Bacteria 2581
82 Ga0157373_10314105 3300013100 Bacteria 1114
83 Ga0157371_10228281 3300013102 Bacteria 1338
84 Ga0157370_10170230 3300013104 Unclassified 2025
85 Ga0157370_10341956 3300013104 Bacteria 1379
86 Ga0157369_10032149 3300013105 Bacteria 5771
87 Ga0157369_10334961 3300013105 Bacteria 1572
88 Ga0157374_11108810 3300013296 Bacteria 812
89 Ga0157372_10077406 3300013307 Bacteria 3757
90 Ga0157372_10210349 3300013307 Bacteria 2254
91 Ga0157372_10919788 3300013307 Bacteria 1014
92 Ga0157372_11139831 3300013307 Bacteria 902
93 Ga0182008_10008011 3300014497 Bacteria 5790
94 Ga0182006_1008508 3300015261 Bacteria 4649
95 Ga0182007_10038871 3300015262 Bacteria 1594
96 Ga0197907_10620593 3300020069 Bacteria 703
97 Ga0206356_10360412 3300020070 Bacteria 1646
98 Ga0206354_10456141 3300020081 Bacteria 1651
99 Ga0206353_11207445 3300020082 Bacteria 4937
100 Ga0206353_11719275 3300020082 Bacteria 5464
101 Ga0207692_10024034 3300025898 Bacteria 2827
102 Ga0207692_10323857 3300025898 Bacteria 944
103 Ga0207699_10082184 3300025906 Bacteria 2001
104 Ga0207699_10247792 3300025906 Bacteria 1226
105 Ga0207699_10565800 3300025906 Bacteria 825
106 Ga0207705_10026509 3300025909 Bacteria 4133
107 Ga0207705_10062434 3300025909 Bacteria 2691
108 Ga0207705_10092610 3300025909 Bacteria 2215
109 Ga0207707_10152777 3300025912 Bacteria 2018
110 Ga0207707_10630510 3300025912 Bacteria 905
111 Ga0207693_10008762 3300025915 Bacteria 8270
112 Ga0207693_10037652 3300025915 Bacteria 3812
113 Ga0207693_10307889 3300025915 Unclassified 1240
114 Ga0207663_10004442 3300025916 Bacteria 6975
115 Ga0207663_10229846 3300025916 Unclassified 1355
116 Ga0207663_10546615 3300025916 Bacteria 905
117 Ga0207660_10034827 3300025917 Bacteria 3492
118 Ga0207660_10455964 3300025917 Bacteria 1034
119 Ga0207657_10002585 3300025919 Bacteria 19586
120 Ga0207657_10027092 3300025919 Bacteria 5254
121 Ga0207649_10104552 3300025920 Bacteria 1880
122 Ga0207652_10087181 3300025921 Bacteria 2738
123 Ga0207652_10408816 3300025921 Bacteria 1224
124 Ga0207646_10555118 3300025922 Bacteria 1033
125 Ga0207687_10247370 3300025927 Bacteria 1416
126 Ga0207700_10082306 3300025928 Bacteria 2517
127 Ga0207700_10082966 3300025928 Bacteria 2508
128 Ga0207664_10008450 3300025929 Bacteria 7183
129 Ga0207664_10027525 3300025929 Bacteria 4311
130 Ga0207664_10052778 3300025929 Bacteria 3216
131 Ga0207664_10543869 3300025929 Bacteria 1042
132 Ga0207644_10152860 3300025931 Unclassified 1787
133 Ga0207690_10016012 3300025932 Bacteria 4557
134 Ga0207686_10544722 3300025934 Unclassified 906
135 Ga0207709_10599674 3300025935 Unclassified 872
136 Ga0207665_10420000 3300025939 Bacteria 1021
137 Ga0207661_10010506 3300025944 Bacteria 6666
138 Ga0207661_10207095 3300025944 Bacteria 1727
139 Ga0207667_10218610 3300025949 Bacteria 1952
140 Ga0207667_10740083 3300025949 Bacteria 983
141 Ga0207667_10814481 3300025949 Bacteria 930
142 Ga0207702_10014692 3300026078 Bacteria 6496
143 Ga0207702_10176948 3300026078 Bacteria 1961
144 Ga0207702_10417450 3300026078 Unclassified 1297
145 Ga0207683_10128089 3300026121 Bacteria 2282
146 Ga0207428_10220657 3300027907 Bacteria 1421
147 Ga0265326_10130808 3300028558 Bacteria 715
148 Ga0265336_10014326 3300028666 Bacteria 2629
149 Ga0265324_10010959 3300029957 Bacteria 3473
150 Ga0307408_100389466 3300031548 Bacteria 1194
151 Ga0307405_10645583 3300031731 Bacteria 870
152 Ga0307409_101881064 3300031995 Bacteria 628
153 Ga0316583_10241108 3300032133 Bacteria 626
154 Ga0373938_0089075 3300034957 Bacteria 761
155 Ga0373944_0000359 3300035089 Bacteria 10324
156 Ga0373945_0023396 3300035116 Bacteria 2133
157 Ga0373943_0004786 3300035170 Bacteria 6117
158 Ga0373946_0009390 3300035171 Bacteria 3602
159 Ga0373935_0026032 3300035692 Bacteria 3607
160 Ga0373927_0052933 3300035695 Bacteria 2625
161 Ga0373947_0000786 3300035725 Bacteria 19086
162 Ga0373947_0881526 3300035725 Unclassified 611
163 Ga0373937_0468598 3300036401 Bacteria 1196
164 Ga0395899_0122714 3300037312 Bacteria 1860
165 Ga0395899_0125188 3300037312 Bacteria 1838
166 Ga0395899_0420316 3300037312 Bacteria 881
167 Ga0395900_0007593 3300037418 Bacteria 11198
168 Ga0395900_0067028 3300037418 Bacteria 3688
169 Ga0395900_0170463 3300037418 Bacteria 2216
170 Ga0395900_0369724 3300037418 Bacteria 1404
171 Ga0395900_0735668 3300037418 Bacteria 918
172 Ga0395898_0038711 3300037466 Bacteria 4724
173 Ga0395898_0267659 3300037466 Bacteria 1630
174 Ga0395898_0426024 3300037466 Bacteria 1264
175 Ga0395898_0616901 3300037466 Unclassified 1027
176 Ga0395905_0681896 3300037471 Bacteria 930
177 Ga0395901_0008098 3300038443 Bacteria 10615
178 Ga0395901_0210376 3300038443 Bacteria 2036
179 Ga0395901_0629435 3300038443 Bacteria 1079
180 Ga0395901_0666432 3300038443 Bacteria 1042
181 Ga0395901_1336181 3300038443 Bacteria 677
182 Ga0439439_0007010 3300041406 Bacteria 2625
183 Ga0439439_0114593 3300041406 Unclassified 749
184 Ga0439431_0166046 3300041997 Bacteria 632
185 Ga0439433_0001484 3300041999 Bacteria 4839
186 Ga0439462_0085815 3300042015 Unclassified 861
187 Ga0450910_027848 3300042147 Unclassified 877
188 Ga0439446_0000714 3300042156 Bacteria 6944
189 Ga0439446_0081748 3300042156 Bacteria 1001
190 Ga0439446_0161405 3300042156 Bacteria 741
191 Ga0439434_0011576 3300042435 Bacteria 2610
192 Ga0466965_0227450 3300044683 Unclassified 995
193 Ga0466963_0001831 3300044694 Bacteria 11588
194 Ga0466963_0005687 3300044694 Bacteria 7323
195 Ga0466963_0006940 3300044694 Bacteria 6737
196 Ga0466963_0008318 3300044694 Bacteria 6214
197 Ga0466963_0070035 3300044694 Bacteria 2359
198 Ga0466963_0129963 3300044694 Bacteria 1739
199 Ga0466963_0166549 3300044694 Bacteria 1535
200 Ga0466963_0237639 3300044694 Unclassified 1277
201 Ga0466963_0507813 3300044694 Bacteria 851
202 Ga0466964_0023776 3300044706 Bacteria 2383
203 Ga0466964_0076003 3300044706 Bacteria 1431
204 Ga0466964_0442788 3300044706 Unclassified 687
205 Ga0466971_0096348 3300044719 Bacteria 1357
206 Ga0466971_0111128 3300044719 Unclassified 1265
207 Ga0466971_0299521 3300044719 Unclassified 772
208 Ga0466968_0059653 3300044735 Bacteria 1643
209 Ga0466970_0279835 3300044765 Unclassified 938
210 Ga0466957_0009655 3300044842 Bacteria 5509
211 Ga0466957_0010114 3300044842 Bacteria 5400
212 Ga0466957_0028606 3300044842 Bacteria 3319
213 Ga0466957_0051749 3300044842 Bacteria 2500
214 Ga0466957_0056942 3300044842 Bacteria 2391
215 Ga0466957_0161442 3300044842 Bacteria 1456
216 Ga0466958_0006783 3300045836 Bacteria 6256
217 Ga0466958_0010570 3300045836 Bacteria 5172
218 Ga0466958_0032892 3300045836 Bacteria 3087
219 Ga0466958_0039048 3300045836 Bacteria 2851
220 Ga0466958_0069129 3300045836 Unclassified 2159
221 Ga0466958_0239108 3300045836 Unclassified 1160
222 Ga0466967_0001497 3300045976 Bacteria 13643
223 Ga0466967_0002770 3300045976 Bacteria 11099
224 Ga0466967_0011065 3300045976 Bacteria 6812
225 Ga0466967_0032451 3300045976 Bacteria 4410
226 Ga0466967_0035090 3300045976 Bacteria 4265
227 Ga0466967_0062230 3300045976 Bacteria 3312
228 Ga0466967_0199518 3300045976 Bacteria 1894
229 Ga0466967_0254204 3300045976 Bacteria 1679
230 Ga0466967_0263473 3300045976 Bacteria 1649
231 Ga0466967_1364042 3300045976 Bacteria 706
232 Ga0495592_0152708 3300046454 Bacteria 1595
233 Ga0495592_0235497 3300046454 Unclassified 1217
234 Ga0495592_0453355 3300046454 Unclassified 803
235 Ga0495603_0077286 3300046455 Unclassified 1953
236 Ga0495629_0090205 3300046459 Bacteria 2138
237 Ga0495641_0005737 3300046461 Bacteria 8254
238 Ga0495651_0052757 3300046462 Bacteria 3131
239 Ga0495653_0017149 3300046463 Bacteria 5890
240 Ga0495653_0530183 3300046463 Bacteria 731
241 Ga0495582_0005914 3300046473 Bacteria 6819
242 Ga0495582_0058872 3300046473 Bacteria 2119
243 Ga0495639_0002115 3300046475 Bacteria 8765
244 Ga0495664_0030842 3300046477 Bacteria 3141
245 Ga0495594_0147720 3300046499 Unclassified 1334
246 Ga0495608_0064712 3300046511 Bacteria 2396
247 Ga0495618_0031848 3300046514 Bacteria 3302
248 Ga0495618_0113617 3300046514 Unclassified 1734
249 Ga0495618_0125294 3300046514 Bacteria 1645
250 Ga0495628_0021828 3300046516 Bacteria 5261
251 Ga0495628_0353190 3300046516 Bacteria 1080
252 Ga0495630_0023053 3300046517 Bacteria 4600
253 Ga0495630_0028543 3300046517 Bacteria 4145
254 Ga0495630_0045732 3300046517 Bacteria 3271
255 Ga0495652_0096169 3300046529 Unclassified 2412
256 Ga0495665_0020555 3300046531 Bacteria 3544
257 Ga0495665_0117591 3300046531 Unclassified 1393
258 Ga0495640_0038076 3300046533 Bacteria 3385
259 Ga0495586_0137751 3300046535 Bacteria 1369
260 Ga0495587_0075416 3300046536 Bacteria 1958
261 Ga0495587_0090947 3300046536 Unclassified 1763
262 Ga0495645_0017344 3300046543 Bacteria 5157
263 Ga0495645_0264460 3300046543 Bacteria 1137
264 Ga0495667_0017173 3300046559 Bacteria 4887
265 Ga0495634_0009598 3300046642 Bacteria 7130
266 Ga0495634_0117038 3300046642 Bacteria 1709
267 Ga0495634_0136801 3300046642 Unclassified 1558
268 Ga0495635_0016957 3300046663 Bacteria 5087
269 Ga0495635_0020710 3300046663 Bacteria 4581
270 Ga0495657_0031090 3300046675 Bacteria 3735
271 Ga0495657_0062518 3300046675 Bacteria 2459
272 Ga0495657_0120465 3300046675 Bacteria 1653
273 Ga0495657_0288840 3300046675 Bacteria 980
274 Ga0495657_0409840 3300046675 Bacteria 797
275 Ga0495599_0125748 3300046678 Bacteria 1593
276 Ga0495599_0251880 3300046678 Unclassified 1074
277 Ga0495623_0189432 3300046679 Unclassified 1190
278 Ga0495647_0006408 3300046681 Bacteria 3895
279 Ga0495647_0017116 3300046681 Bacteria 2561
280 Ga0495647_0038021 3300046681 Bacteria 1819
281 Ga0495658_0006389 3300046683 Bacteria 5790
282 Ga0495613_0008028 3300046689 Bacteria 7851
283 Ga0495613_0025355 3300046689 Bacteria 4418
284 Ga0495613_0152261 3300046689 Bacteria 1649
285 Ga0495613_0539551 3300046689 Bacteria 782
286 Ga0495624_0017540 3300046690 Bacteria 4805
287 Ga0495624_0058600 3300046690 Bacteria 2418
288 Ga0495600_0028219 3300046809 Bacteria 3630
289 Ga0495581_0018183 3300047315 Bacteria 4083
290 Ga0495581_0055939 3300047315 Bacteria 2277
291 Ga0495581_0184955 3300047315 Bacteria 1219
292 Ga0495581_0358491 3300047315 Bacteria 851
293 Ga0495604_0027333 3300047317 Bacteria 4539
294 Ga0495604_0061930 3300047317 Bacteria 2860
295 Ga0495674_0035671 3300047319 Bacteria 4484
296 Ga0495674_0040737 3300047319 Bacteria 4152
297 Ga0495674_0350093 3300047319 Unclassified 1199
298 Ga0495674_0389725 3300047319 Bacteria 1126
299 Ga0495676_0000951 3300047321 Bacteria 24308
300 Ga0495676_0060412 3300047321 Bacteria 2971
301 Ga0495676_0100139 3300047321 Bacteria 2146
302 Ga0495680_0003087 3300047322 Bacteria 16597
303 Ga0495680_0017652 3300047322 Bacteria 6082
304 Ga0495680_0053921 3300047322 Bacteria 3125
305 Ga0495680_0374257 3300047322 Bacteria 988
306 Ga0495680_0443590 3300047322 Bacteria 889
307 Ga0495675_0286785 3300047444 Unclassified 981
308 Ga0495684_0066331 3300047471 Bacteria 2744
309 Ga0495684_0140976 3300047471 Bacteria 1807
310 Ga0495593_0018471 3300047673 Bacteria 3917
311 Ga0495602_0053548 3300048088 Bacteria 3573
312 Ga0495614_0004367 3300048089 Bacteria 6371
313 Ga0496100_0054807 3300048903 Unclassified 2602
314 Ga0496100_0190040 3300048903 Bacteria 1490
315 Ga0496100_1071573 3300048903 Unclassified 635
316 Ga0496101_0009912 3300048904 Bacteria 6277
317 Ga0496101_0081065 3300048904 Bacteria 2399
318 Ga0496102_0139670 3300048905 Unclassified 2271
319 Ga0496102_0699396 3300048905 Bacteria 937
320 Ga0496103_0048398 3300048906 Unclassified 2627
321 Ga0496104_0002791 3300048907 Bacteria 15048
322 Ga0496104_0014307 3300048907 Bacteria 7164
323 Ga0496104_1217366 3300048907 Bacteria 656
324 Ga0496105_0037593 3300048908 Bacteria 3986
325 Ga0496105_0045391 3300048908 Bacteria 3625
326 Ga0496105_0060179 3300048908 Bacteria 3133
327 Ga0496105_0067657 3300048908 Bacteria 2949
328 Ga0496105_0175658 3300048908 Bacteria 1755
329 Ga0496107_0006632 3300048910 Bacteria 7968
330 Ga0496108_0134454 3300048911 Bacteria 2126
331 Ga0496109_0087710 3300048912 Bacteria 2874
332 Ga0496109_0579957 3300048912 Unclassified 1057
333 Ga0496110_0140062 3300048913 Unclassified 2187
334 Ga0496112_0116250 3300048915 Bacteria 2645
335 Ga0496114_0080980 3300048917 Unclassified 2742
336 Ga0496114_0089548 3300048917 Bacteria 2611
337 Ga0496114_0157560 3300048917 Bacteria 1972
338 Ga0496114_0187765 3300048917 Bacteria 1807
339 Ga0496114_0459028 3300048917 Bacteria 1128
340 Ga0496115_0055959 3300048918 Bacteria 3170
341 Ga0496115_0156251 3300048918 Bacteria 1884
342 Ga0496115_0229185 3300048918 Bacteria 1532
343 Ga0501031_0109970 3300049568 Bacteria 1799
344 Ga0501032_0004462 3300049569 Bacteria 10550
345 Ga0501033_0006809 3300049570 Bacteria 8922
346 Ga0501034_0001138 3300049571 Bacteria 37013
347 Ga0501036_0020996 3300049572 Bacteria 5483
348 Ga0501041_0032775 3300049577 Bacteria 3140
349 Ga0501043_0006002 3300049579 Bacteria 9765
350 Ga0501046_0007692 3300049580 Bacteria 9448
351 Ga0501047_0168928 3300049581 Bacteria 2057
352 Ga0501067_0158182 3300049583 Bacteria 1262
353 Ga0501068_0004275 3300049584 Bacteria 7755
354 Ga0501068_0407253 3300049584 Bacteria 877
355 Ga0501069_0014328 3300049585 Bacteria 4238
356 Ga0501069_0060688 3300049585 Bacteria 2111
357 Ga0501070_0024926 3300049586 Bacteria 5016
358 Ga0501070_0150747 3300049586 Bacteria 1918
359 Ga0501075_0050013 3300049591 Bacteria 3141
360 Ga0501077_0037504 3300049593 Bacteria 3086
361 Ga0501080_0008582 3300049742 Bacteria 9270
362 Ga0501080_0025320 3300049742 Bacteria 5505
363 Ga0501081_0753469 3300049743 Bacteria 732
364 Ga0501035_0020893 3300049822 Bacteria 6016
365 Ga0501044_0318291 3300049823 Bacteria 1481
366 Ga0501044_0333446 3300049823 Bacteria 1439
367 Ga0501045_0057476 3300049824 Bacteria 2846
368 nmdc:mga08y16_250776_c1 3300050511 Bacteria 1829
369 nmdc:mga08y16_620165_c1 3300050511 Bacteria 1088
370 nmdc:mga0n895_80116_c1 3300050512 Bacteria 3253
371 nmdc:mga08x19_630752_c1 3300050514 Bacteria 760
372 nmdc:mga0a205_173619_c1 3300050515 Bacteria 2051
373 Ga0495601_0042037 3300053077 Bacteria 2866
374 Ga0495601_0126960 3300053077 Bacteria 1659
375 Ga0495601_0181627 3300053077 Unclassified 1375
376 Ga0495612_0165603 3300053078 Unclassified 966
377 Ga0495612_0298253 3300053078 Bacteria 722
378 Ga0495595_0027901 3300053084 Bacteria 2517
379 Ga0495619_0012870 3300053085 Bacteria 5270
380 Ga0495619_0153348 3300053085 Bacteria 1589
381 Ga0495619_0164987 3300053085 Bacteria 1531
382 Ga0501084_0239748 3300054114 Bacteria 1531
383 Ga0501082_0033952 3300060353 Bacteria 4400
384 Ga0466962_0151721 3300061719 Unclassified 1124
385 Ga0530510_0081819 3300061734 Bacteria 2351
386 Ga0495667_0142494
387 Ga0070658_10046499
388 Ga0070658_10060229
389 Ga0070658_10091169
390 Ga0070658_10154129
391 Ga0070658_11277212
392 Ga0070683_100006603
393 Ga0070683_100013979
394 Ga0070683_100551595
395 Ga0070680_100312985
396 Ga0070680_100564636
397 Ga0070680_100776013
398 Ga0070682_100096253
399 Ga0070660_100007111
400 Ga0070660_100012078
401 Ga0070660_100035161
402 Ga0070660_100431491
403 Ga0070661_100008458
404 Ga0070692_10026410
405 Ga0070671_100049827
406 Ga0070659_100094667
407 Ga0070709_10379045
408 Ga0070714_100006885
409 Ga0070714_100024225
410 Ga0070714_100024784
411 Ga0070714_100031464
412 Ga0070714_100033949
413 Ga0070714_100250462
414 Ga0070713_100020204
415 Ga0070713_100113719
416 Ga0070713_101267905
417 Ga0070710_10003052
418 Ga0070710_10118893
419 Ga0070711_100010939
420 Ga0070711_100658040
421 Ga0070678_100146707
422 Ga0070678_101036173
423 Ga0070681_10116359
424 Ga0070681_10194988
425 Ga0070681_10253874
426 Ga0070707_100829481
427 Ga0070679_100033692
428 Ga0070679_100035426
429 Ga0070679_100125029
430 Ga0070684_100187698
431 Ga0070684_100282372
432 Ga0070684_101029502
433 Ga0068855_100031498
434 Ga0068855_100107547
435 Ga0068855_100383361
436 Ga0068855_101280149
437 Ga0068856_100113510
438 Ga0068856_100212587
439 Ga0068856_100233675
440 Ga0068852_100602983
441 Ga0070717_10008666
442 Ga0070717_10053445
443 Ga0070717_10199172
444 Ga0070716_100242067
445 Ga0070712_100020762
446 Ga0070712_100034661
447 Ga0070712_100538545
448 Ga0075367_10476772
449 Ga0097621_100192043
450 Ga0075431_100508368
451 Ga0075433_10127319
452 Ga0075433_10288997
453 Ga0075434_100143315
454 Ga0075436_100594031
455 Ga0075435_100178206
456 Ga0099795_10114656
457 Ga0105240_10253664
458 Ga0105240_10546090
459 Ga0111539_10168506
460 Ga0111539_10274253
461 Ga0105245_10059919
462 Ga0105245_10454179
463 Ga0105245_11143986
464 Ga0105243_10022321
465 Ga0105242_10433671
466 Ga0105248_10155415
467 Ga0157373_10314105
468 Ga0157371_10228281
469 Ga0157370_10170230
470 Ga0157370_10341956
471 Ga0157369_10032149
472 Ga0157369_10334961
473 Ga0157374_11108810
474 Ga0157372_10077406
475 Ga0157372_10210349
476 Ga0157372_10919788
477 Ga0157372_11139831
478 Ga0182008_10008011
479 Ga0182006_1008508
480 Ga0182007_10038871
481 Ga0197907_10620593
482 Ga0206356_10360412
483 Ga0206354_10456141
484 Ga0206353_11207445
485 Ga0206353_11719275
486 Ga0207692_10024034
487 Ga0207692_10323857
488 Ga0207699_10082184
489 Ga0207699_10247792
490 Ga0207699_10565800
491 Ga0207705_10026509
492 Ga0207705_10062434
493 Ga0207705_10092610
494 Ga0207707_10152777
495 Ga0207707_10630510
496 Ga0207693_10008762
497 Ga0207693_10037652
498 Ga0207693_10307889
499 Ga0207663_10004442
500 Ga0207663_10229846
501 Ga0207663_10546615
502 Ga0207660_10034827
503 Ga0207660_10455964
504 Ga0207657_10002585
505 Ga0207657_10027092
506 Ga0207649_10104552
507 Ga0207652_10087181
508 Ga0207652_10408816
509 Ga0207646_10555118
510 Ga0207687_10247370
511 Ga0207700_10082306
512 Ga0207700_10082966
513 Ga0207664_10008450
514 Ga0207664_10027525
515 Ga0207664_10052778
516 Ga0207664_10543869
517 Ga0207644_10152860
518 Ga0207690_10016012
519 Ga0207686_10544722
520 Ga0207709_10599674
521 Ga0207665_10420000
522 Ga0207661_10010506
523 Ga0207661_10207095
524 Ga0207667_10218610
525 Ga0207667_10740083
526 Ga0207667_10814481
527 Ga0207702_10014692
528 Ga0207702_10176948
529 Ga0207702_10417450
530 Ga0207683_10128089
531 Ga0207428_10220657
532 Ga0265326_10130808
533 Ga0265336_10014326
534 Ga0265324_10010959
535 Ga0307408_100389466
536 Ga0307405_10645583
537 Ga0307409_101881064
538 Ga0316583_10241108
539 Ga0373938_0089075
540 Ga0373944_0000359
541 Ga0373945_0023396
542 Ga0373943_0004786
543 Ga0373946_0009390
544 Ga0373935_0026032
545 Ga0373927_0052933
546 Ga0373947_0000786
547 Ga0373947_0881526
548 Ga0373937_0468598
549 Ga0395899_0122714
550 Ga0395899_0125188
551 Ga0395899_0420316
552 Ga0395900_0007593
553 Ga0395900_0067028
554 Ga0395900_0170463
555 Ga0395900_0369724
556 Ga0395900_0735668
557 Ga0395898_0038711
558 Ga0395898_0267659
559 Ga0395898_0426024
560 Ga0395898_0616901
561 Ga0395905_0681896
562 Ga0395901_0008098
563 Ga0395901_0210376
564 Ga0395901_0629435
565 Ga0395901_0666432
566 Ga0395901_1336181
567 Ga0439439_0007010
568 Ga0439439_0114593
569 Ga0439431_0166046
570 Ga0439433_0001484
571 Ga0439462_0085815
572 Ga0450910_027848
573 Ga0439446_0000714
574 Ga0439446_0081748
575 Ga0439446_0161405
576 Ga0439434_0011576
577 Ga0466965_0227450
578 Ga0466963_0001831
579 Ga0466963_0005687
580 Ga0466963_0006940
581 Ga0466963_0008318
582 Ga0466963_0070035
583 Ga0466963_0129963
584 Ga0466963_0166549
585 Ga0466963_0237639
586 Ga0466963_0507813
587 Ga0466964_0023776
588 Ga0466964_0076003
589 Ga0466964_0442788
590 Ga0466971_0096348
591 Ga0466971_0111128
592 Ga0466971_0299521
593 Ga0466968_0059653
594 Ga0466970_0279835
595 Ga0466957_0009655
596 Ga0466957_0010114
597 Ga0466957_0028606
598 Ga0466957_0051749
599 Ga0466957_0056942
600 Ga0466957_0161442
601 Ga0466958_0006783
602 Ga0466958_0010570
603 Ga0466958_0032892
604 Ga0466958_0039048
605 Ga0466958_0069129
606 Ga0466958_0239108
607 Ga0466967_0001497
608 Ga0466967_0002770
609 Ga0466967_0011065
610 Ga0466967_0032451
611 Ga0466967_0035090
612 Ga0466967_0062230
613 Ga0466967_0199518
614 Ga0466967_0254204
615 Ga0466967_0263473
616 Ga0466967_1364042
617 Ga0495592_0152708
618 Ga0495592_0235497
619 Ga0495592_0453355
620 Ga0495603_0077286
621 Ga0495629_0090205
622 Ga0495641_0005737
623 Ga0495651_0052757
624 Ga0495653_0017149
625 Ga0495653_0530183
626 Ga0495582_0005914
627 Ga0495582_0058872
628 Ga0495639_0002115
629 Ga0495664_0030842
630 Ga0495594_0147720
631 Ga0495608_0064712
632 Ga0495618_0031848
633 Ga0495618_0113617
634 Ga0495618_0125294
635 Ga0495628_0021828
636 Ga0495628_0353190
637 Ga0495630_0023053
638 Ga0495630_0028543
639 Ga0495630_0045732
640 Ga0495652_0096169
641 Ga0495665_0020555
642 Ga0495665_0117591
643 Ga0495640_0038076
644 Ga0495586_0137751
645 Ga0495587_0075416
646 Ga0495587_0090947
647 Ga0495645_0017344
648 Ga0495645_0264460
649 Ga0495667_0017173
650 Ga0495634_0009598
651 Ga0495634_0117038
652 Ga0495634_0136801
653 Ga0495635_0016957
654 Ga0495635_0020710
655 Ga0495657_0031090
656 Ga0495657_0062518
657 Ga0495657_0120465
658 Ga0495657_0288840
659 Ga0495657_0409840
660 Ga0495599_0125748
661 Ga0495599_0251880
662 Ga0495623_0189432
663 Ga0495647_0006408
664 Ga0495647_0017116
665 Ga0495647_0038021
666 Ga0495658_0006389
667 Ga0495613_0008028
668 Ga0495613_0025355
669 Ga0495613_0152261
670 Ga0495613_0539551
671 Ga0495624_0017540
672 Ga0495624_0058600
673 Ga0495600_0028219
674 Ga0495581_0018183
675 Ga0495581_0055939
676 Ga0495581_0184955
677 Ga0495581_0358491
678 Ga0495604_0027333
679 Ga0495604_0061930
680 Ga0495674_0035671
681 Ga0495674_0040737
682 Ga0495674_0350093
683 Ga0495674_0389725
684 Ga0495676_0000951
685 Ga0495676_0060412
686 Ga0495676_0100139
687 Ga0495680_0003087
688 Ga0495680_0017652
689 Ga0495680_0053921
690 Ga0495680_0374257
691 Ga0495680_0443590
692 Ga0495675_0286785
693 Ga0495684_0066331
694 Ga0495684_0140976
695 Ga0495593_0018471
696 Ga0495602_0053548
697 Ga0495614_0004367
698 Ga0496100_0054807
699 Ga0496100_0190040
700 Ga0496100_1071573
701 Ga0496101_0009912
702 Ga0496101_0081065
703 Ga0496102_0139670
704 Ga0496102_0699396
705 Ga0496103_0048398
706 Ga0496104_0002791
707 Ga0496104_0014307
708 Ga0496104_1217366
709 Ga0496105_0037593
710 Ga0496105_0045391
711 Ga0496105_0060179
712 Ga0496105_0067657
713 Ga0496105_0175658
714 Ga0496107_0006632
715 Ga0496108_0134454
716 Ga0496109_0087710
717 Ga0496109_0579957
718 Ga0496110_0140062
719 Ga0496112_0116250
720 Ga0496114_0080980
721 Ga0496114_0089548
722 Ga0496114_0157560
723 Ga0496114_0187765
724 Ga0496114_0459028
725 Ga0496115_0055959
726 Ga0496115_0156251
727 Ga0496115_0229185
728 Ga0501031_0109970
729 Ga0501032_0004462
730 Ga0501033_0006809
731 Ga0501034_0001138
732 Ga0501036_0020996
733 Ga0501041_0032775
734 Ga0501043_0006002
735 Ga0501046_0007692
736 Ga0501047_0168928
737 Ga0501067_0158182
738 Ga0501068_0004275
739 Ga0501068_0407253
740 Ga0501069_0014328
741 Ga0501069_0060688
742 Ga0501070_0024926
743 Ga0501070_0150747
744 Ga0501075_0050013
745 Ga0501077_0037504
746 Ga0501080_0008582
747 Ga0501080_0025320
748 Ga0501081_0753469
749 Ga0501035_0020893
750 Ga0501044_0318291
751 Ga0501044_0333446
752 Ga0501045_0057476
753 nmdc:mga08y16_250776_c1
754 nmdc:mga08y16_620165_c1
755 nmdc:mga0n895_80116_c1
756 nmdc:mga08x19_630752_c1
757 nmdc:mga0a205_173619_c1
758 Ga0495601_0042037
759 Ga0495601_0126960
760 Ga0495601_0181627
761 Ga0495612_0165603
762 Ga0495612_0298253
763 Ga0495595_0027901
764 Ga0495619_0012870
765 Ga0495619_0153348
766 Ga0495619_0164987
767 Ga0501084_0239748
768 Ga0501082_0033952
769 Ga0466962_0151721
770 Ga0530510_0081819

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

42

88

0.98

PF13977

TetR_C_6

BetI-type transcriptional repressor, C-terminal

100

210

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ac6-assembly1.cif.gz_A corynebacterium glutamicum acnr au derivative structure 0.9345 12 182
4ac6-assembly1.cif.gz_A corynebacterium glutamicum acnr au derivative structure 0.9043 12 182
2g3b-assembly1.cif.gz_B crystal structure of putative tetr-family transcriptional regulator from rhodococcus sp. 0.7768 11 181
2gen-assembly1.cif.gz_A-2 structural genomics, the crystal structure of a probable transcriptional regulator from pseudomonas aeruginosa pao1 0.7749 13 182
2g3b-assembly1.cif.gz_A crystal structure of putative tetr-family transcriptional regulator from rhodococcus sp. 0.7643 10 180
ID Description Score Start End Superfamily
2np3B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9316 10 62 1.10.10.60
1pb6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9309 9 61 1.10.10.60
3whcE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.926 10 54 1.10.10.60
4xk4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9256 11 61 1.10.10.60
4xk4D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9249 11 61 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7Y6CQV0-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9848 1 69 GO:0000976
GO:0003700
AF-A0A538DXF7-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9803 1 184 GO:0000976
GO:0003700
AF-A0A537WEY9-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9777 1 184 GO:0000976
GO:0003700
AF-A0A538DXF7-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9751 1 184 GO:0000976
GO:0003700
AF-A0A537WEY9-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9725 1 184 GO:0000976
GO:0003700

Map