F430291

General Info

Members Datasets Scaffolds Average Seq Length
385 248 336 158

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0422016|Ga0495630_0422016_240_803
Length 187
Sequence VPPADYAGCSPRFATRFTADIITVLTKELPVPERLIAGAMAPEFTLKNAEGQDVSLRDFRGRNTVIYFYPAAATPGCTKQACDFRDSLASLQHAGYDVVGISPDPAGKLATFAAAEGLTFPLLSDEDHAVAEAYAAWGEKKNYGKTYQGLIRSTVVVDPEGKVVMAQYNVRATGHVAKLRRELKLDA

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
3 2643221553 Microbacterium sp. Root553 Isolate Unclassified
4 2643221613 Oerskovia sp. Root22 Isolate Unclassified
5 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
6 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
7 2643221721 Oerskovia sp. Root918 Isolate Unclassified
8 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
9 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
10 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
11 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
12 2739367653 Kocuria sp. OV113 Isolate Unclassified
13 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
14 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
15 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
16 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
17 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
18 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
19 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
20 2857727296 Kocuria sp. R-72562 Isolate Unclassified
21 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
22 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
23 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
24 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
25 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
26 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
27 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
28 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
29 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
30 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
31 2920879853 Kocuria salina CV6 Isolate Unclassified
32 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
33 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
34 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
35 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
36 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
37 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
38 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
39 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
40 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
41 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
42 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
43 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
44 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
45 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
77 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
102 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
124 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
125 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
126 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
127 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
128 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
129 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
130 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
131 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
132 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
133 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
134 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
135 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
136 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
137 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
138 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
139 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
140 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
141 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
142 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
143 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
144 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
145 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
146 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
147 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
159 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
246 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
247 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
248 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.12
Metatranscriptomes 4.16
Isolates 12.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0
Rhizoplane 8.83
Rhizosphere 77.66
Stem 0
Stem Tuber 0
Unclassified 11.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10104764 3300005288 Bacteria 1578
2 Ga0065712_10217317 3300005290 Bacteria 1052
3 Ga0070658_10976316 3300005327 Bacteria 737
4 Ga0068869_100159448 3300005334 Bacteria 1755
5 Ga0070660_100247437 3300005339 Bacteria 1453
6 Ga0070663_101638879 3300005455 Bacteria 574
7 Ga0070678_100073980 3300005456 Bacteria 2559
8 Ga0068853_100061127 3300005539 Bacteria 3258
9 Ga0068855_100092213 3300005563 Bacteria 3493
10 Ga0068852_101799976 3300005616 Bacteria 635
11 Ga0068870_10073403 3300005840 Bacteria 1871
12 Ga0068860_101102898 3300005843 Bacteria 813
13 Ga0075365_10001820 3300006038 Bacteria 9970
14 Ga0075432_10358116 3300006058 Bacteria 620
15 Ga0105244_10009366 3300009036 Bacteria 6026
16 Ga0105244_10297722 3300009036 Bacteria 747
17 Ga0105244_10305882 3300009036 Bacteria 735
18 Ga0105244_10359552 3300009036 Bacteria 671
19 Ga0105240_10326152 3300009093 Bacteria 1748
20 Ga0105243_11456846 3300009148 Bacteria 707
21 Ga0105241_12241545 3300009174 Bacteria 542
22 Ga0105242_10119436 3300009176 Bacteria 2260
23 Ga0105237_10021263 3300009545 Bacteria 6674
24 Ga0105237_10854883 3300009545 Bacteria 916
25 Ga0105238_11540592 3300009551 Bacteria 694
26 Ga0105246_10005340 3300011119 Bacteria 7820
27 Ga0105246_10032963 3300011119 Bacteria 3439
28 Ga0105246_10157026 3300011119 Bacteria 1729
29 Ga0157370_10818899 3300013104 Bacteria 847
30 Ga0157369_10919715 3300013105 Bacteria 897
31 Ga0157369_10921594 3300013105 Bacteria 896
32 Ga0157369_11049896 3300013105 Bacteria 834
33 Ga0157369_11475461 3300013105 Bacteria 692
34 Ga0157378_10145015 3300013297 Bacteria 2208
35 Ga0163162_10593474 3300013306 Bacteria 1234
36 Ga0157372_11580758 3300013307 Bacteria 755
37 Ga0157375_10185761 3300013308 Bacteria 2232
38 Ga0157375_11161397 3300013308 Bacteria 905
39 Ga0157377_10201417 3300014745 Bacteria 1264
40 Ga0163161_10384820 3300017792 Bacteria 1122
41 Ga0224712_10590878 3300022467 Bacteria 542
42 Ga0209759_1026746 3300025256 Bacteria 1203
43 Ga0207673_1019572 3300025290 Bacteria 910
44 Ga0209051_1003158 3300025303 Bacteria 11051
45 Ga0207697_10038356 3300025315 Bacteria 1964
46 Ga0207655_1007470 3300025728 Bacteria 7087
47 Ga0207688_10186138 3300025901 Bacteria 1240
48 Ga0207647_10101951 3300025904 Bacteria 1702
49 Ga0207654_10197777 3300025911 Bacteria 1322
50 Ga0207695_10114271 3300025913 Bacteria 2675
51 Ga0207671_10510165 3300025914 Bacteria 959
52 Ga0207662_10166898 3300025918 Bacteria 1410
53 Ga0207657_10164205 3300025919 Bacteria 1802
54 Ga0207650_10810161 3300025925 Bacteria 794
55 Ga0207706_11073673 3300025933 Bacteria 674
56 Ga0207709_10590291 3300025935 Bacteria 878
57 Ga0207665_10266039 3300025939 Bacteria 1272
58 Ga0207689_10133403 3300025942 Bacteria 2044
59 Ga0207661_10185772 3300025944 Bacteria 1819
60 Ga0207667_10032737 3300025949 Bacteria 5597
61 Ga0207667_10126300 3300025949 Bacteria 2635
62 Ga0207668_10360827 3300025972 Bacteria 1218
63 Ga0207639_10205488 3300026041 Bacteria 1692
64 Ga0207678_11209748 3300026067 Bacteria 669
65 Ga0207683_10106662 3300026121 Bacteria 2505
66 Ga0207698_10503150 3300026142 Bacteria 1179
67 Ga0268266_11223399 3300028379 Bacteria 726
68 Ga0316181_1029091 3300030744 Bacteria 951
69 Ga0265329_10154681 3300031242 Bacteria 744
70 Ga0265327_10210217 3300031251 Bacteria 878
71 Ga0307513_10720705 3300031456 Bacteria 703
72 Ga0307509_10073439 3300031507 Bacteria 3561
73 Ga0307408_100244143 3300031548 Bacteria 1477
74 Ga0307405_10065233 3300031731 Bacteria 2317
75 Ga0307405_10115384 3300031731 Bacteria 1827
76 Ga0307405_10309856 3300031731 Bacteria 1201
77 Ga0307405_10343721 3300031731 Bacteria 1148
78 Ga0307405_10410593 3300031731 Bacteria 1062
79 Ga0307413_10000136 3300031824 Bacteria 19426
80 Ga0307413_10015781 3300031824 Bacteria 3881
81 Ga0307413_10132749 3300031824 Bacteria 1707
82 Ga0307413_10134788 3300031824 Bacteria 1696
83 Ga0307413_12023011 3300031824 Bacteria 520
84 Ga0307410_10050318 3300031852 Bacteria 2801
85 Ga0307410_10053543 3300031852 Bacteria 2731
86 Ga0307410_10224608 3300031852 Bacteria 1446
87 Ga0307410_10494418 3300031852 Bacteria 1005
88 Ga0307410_11047122 3300031852 Bacteria 705
89 Ga0307406_10006432 3300031901 Bacteria 6485
90 Ga0307406_10681581 3300031901 Bacteria 856
91 Ga0307407_10091494 3300031903 Bacteria 1865
92 Ga0307407_10187332 3300031903 Bacteria 1376
93 Ga0307407_11025334 3300031903 Bacteria 638
94 Ga0307412_10015825 3300031911 Bacteria 4479
95 Ga0307412_10069167 3300031911 Bacteria 2402
96 Ga0307412_10125431 3300031911 Bacteria 1856
97 Ga0307412_10167866 3300031911 Bacteria 1638
98 Ga0307412_10168451 3300031911 Bacteria 1635
99 Ga0307412_10321333 3300031911 Bacteria 1231
100 Ga0307412_10819336 3300031911 Bacteria 809
101 Ga0307412_11258664 3300031911 Bacteria 664
102 Ga0307409_100029857 3300031995 Bacteria 3908
103 Ga0307409_100052539 3300031995 Bacteria 3125
104 Ga0307409_100173939 3300031995 Bacteria 1898
105 Ga0307409_102630840 3300031995 Bacteria 532
106 Ga0307416_100124425 3300032002 Bacteria 2307
107 Ga0307416_100151824 3300032002 Bacteria 2125
108 Ga0307416_100325093 3300032002 Bacteria 1542
109 Ga0307416_100387341 3300032002 Bacteria 1430
110 Ga0307414_10064090 3300032004 Bacteria 2615
111 Ga0307411_10326225 3300032005 Bacteria 1242
112 Ga0307411_10379431 3300032005 Bacteria 1162
113 Ga0307411_11585815 3300032005 Bacteria 604
114 Ga0307415_100146819 3300032126 Bacteria 1809
115 Ga0307415_100298125 3300032126 Bacteria 1334
116 Ga0307415_100697754 3300032126 Bacteria 915
117 Ga0395899_0268435 3300037312 Bacteria 1164
118 Ga0395899_0431922 3300037312 Bacteria 866
119 Ga0395900_0082012 3300037418 Bacteria 3313
120 Ga0395900_0191835 3300037418 Bacteria 2072
121 Ga0395900_0918612 3300037418 Bacteria 798
122 Ga0395898_0051913 3300037466 Bacteria 4007
123 Ga0395898_0129015 3300037466 Bacteria 2422
124 Ga0395898_0238954 3300037466 Bacteria 1733
125 Ga0395898_0434556 3300037466 Bacteria 1251
126 Ga0395898_0525775 3300037466 Bacteria 1124
127 Ga0395905_1121019 3300037471 Bacteria 690
128 Ga0395901_0015675 3300038443 Bacteria 7720
129 Ga0395901_0195588 3300038443 Bacteria 2120
130 Ga0395901_0347795 3300038443 Bacteria 1530
131 Ga0439436_0002608 3300041404 Bacteria 5427
132 Ga0439436_0028895 3300041404 Bacteria 1616
133 Ga0439436_0046439 3300041404 Bacteria 1234
134 Ga0439436_0073523 3300041404 Bacteria 952
135 Ga0439438_053774 3300041405 Bacteria 1018
136 Ga0439439_0000524 3300041406 Bacteria 6626
137 Ga0439439_0010474 3300041406 Bacteria 2217
138 Ga0439461_0010439 3300041410 Bacteria 1705
139 Ga0439466_0009907 3300041411 Bacteria 3547
140 Ga0439466_0031033 3300041411 Bacteria 1830
141 Ga0439466_0032881 3300041411 Bacteria 1765
142 Ga0439466_0110303 3300041411 Bacteria 854
143 Ga0439465_0133488 3300041413 Bacteria 878
144 Ga0439465_0204316 3300041413 Bacteria 721
145 Ga0451795_1513609 3300041456 Bacteria 590
146 Ga0451804_0921085 3300041463 Bacteria 749
147 Ga0451837_1324518 3300041494 Bacteria 709
148 Ga0451849_0435973 3300041505 Bacteria 667
149 Ga0439431_0046008 3300041997 Bacteria 1122
150 Ga0439433_0000504 3300041999 Bacteria 7295
151 Ga0439433_0009451 3300041999 Bacteria 2124
152 Ga0439433_0011702 3300041999 Bacteria 1923
153 Ga0439433_0032970 3300041999 Bacteria 1189
154 Ga0439433_0046826 3300041999 Bacteria 1014
155 Ga0439442_000014 3300042002 Bacteria 47589
156 Ga0439442_002310 3300042002 Bacteria 3742
157 Ga0439442_008045 3300042002 Bacteria 2131
158 Ga0439442_020370 3300042002 Bacteria 1374
159 Ga0439432_002609 3300042006 Bacteria 6778
160 Ga0439449_0000228 3300042007 Bacteria 20163
161 Ga0439449_0003573 3300042007 Bacteria 6040
162 Ga0439449_0010103 3300042007 Bacteria 3571
163 Ga0439449_0030984 3300042007 Bacteria 1993
164 Ga0439449_0031252 3300042007 Bacteria 1985
165 Ga0439449_0057756 3300042007 Bacteria 1432
166 Ga0439452_001504 3300042010 Bacteria 9448
167 Ga0439452_049460 3300042010 Bacteria 967
168 Ga0439457_003157 3300042014 Bacteria 4546
169 Ga0439457_009960 3300042014 Bacteria 2198
170 Ga0439457_013849 3300042014 Bacteria 1809
171 Ga0439462_0004196 3300042015 Bacteria 3505
172 Ga0439462_0029957 3300042015 Bacteria 1439
173 Ga0450919_008876 3300042121 Bacteria 1159
174 Ga0450920_001508 3300042122 Bacteria 3860
175 Ga0450923_066198 3300042125 Bacteria 795
176 Ga0450906_035385 3300042145 Bacteria 881
177 Ga0450906_081962 3300042145 Bacteria 583
178 Ga0450907_006145 3300042146 Bacteria 2011
179 Ga0439434_0000527 3300042435 Bacteria 10938
180 Ga0450918_001297 3300042531 Bacteria 5065
181 Ga0466961_0348450 3300044693 Bacteria 901
182 Ga0466963_0519569 3300044694 Bacteria 841
183 Ga0466964_0048391 3300044706 Bacteria 1738
184 Ga0466957_0030290 3300044842 Bacteria 3230
185 Ga0466958_0001592 3300045836 Bacteria 10901
186 Ga0466958_0191036 3300045836 Bacteria 1302
187 Ga0466967_0039418 3300045976 Bacteria 4061
188 Ga0466967_0474602 3300045976 Bacteria 1225
189 Ga0466967_0755575 3300045976 Bacteria 964
190 Ga0466967_1362272 3300045976 Bacteria 707
191 Ga0495629_0990660 3300046459 Bacteria 547
192 Ga0495653_0013249 3300046463 Bacteria 6722
193 Ga0495580_0095146 3300046472 Bacteria 2072
194 Ga0495582_0054276 3300046473 Bacteria 2210
195 Ga0495639_0020538 3300046475 Bacteria 2886
196 Ga0495662_0026724 3300046476 Bacteria 2787
197 Ga0495662_0319070 3300046476 Bacteria 764
198 Ga0495594_0053246 3300046499 Bacteria 2229
199 Ga0495594_0100121 3300046499 Bacteria 1630
200 Ga0495607_0035226 3300046501 Bacteria 3030
201 Ga0495630_0304005 3300046517 Bacteria 1219
202 Ga0495630_0422016 3300046517 Bacteria 1022
203 Ga0495642_0043139 3300046528 Bacteria 1839
204 Ga0495665_0000724 3300046531 Bacteria 17057
205 Ga0495665_0037917 3300046531 Bacteria 2571
206 Ga0495586_0018046 3300046535 Bacteria 3752
207 Ga0495586_0119166 3300046535 Bacteria 1473
208 Ga0495587_0014274 3300046536 Bacteria 4984
209 Ga0495645_0001789 3300046543 Bacteria 14596
210 Ga0495667_0082923 3300046559 Bacteria 2082
211 Ga0495656_0075308 3300046615 Bacteria 1509
212 Ga0495635_0126164 3300046663 Bacteria 1745
213 Ga0495635_0244559 3300046663 Bacteria 1210
214 Ga0495661_0516831 3300046665 Bacteria 568
215 Ga0495588_0004896 3300046674 Bacteria 5938
216 Ga0495588_0385869 3300046674 Bacteria 735
217 Ga0495623_0113808 3300046679 Bacteria 1636
218 Ga0495658_0756123 3300046683 Bacteria 622
219 Ga0495670_0036395 3300046691 Bacteria 2452
220 Ga0495600_0006974 3300046809 Bacteria 6894
221 Ga0495600_0144956 3300046809 Bacteria 1539
222 Ga0495660_0217054 3300046810 Bacteria 904
223 Ga0495581_0001134 3300047315 Bacteria 14581
224 Ga0495636_0051744 3300047318 Bacteria 1722
225 Ga0495683_0000393 3300047323 Bacteria 35386
226 Ga0495675_0017076 3300047444 Bacteria 4595
227 Ga0495677_0320951 3300047445 Bacteria 610
228 Ga0495684_0098464 3300047471 Bacteria 2211
229 Ga0495593_0120312 3300047673 Bacteria 1336
230 Ga0495593_0215663 3300047673 Bacteria 963
231 Ga0496100_0016602 3300048903 Bacteria 4327
232 Ga0496101_0033209 3300048904 Bacteria 3637
233 Ga0496101_1163554 3300048904 Bacteria 605
234 Ga0496102_0056366 3300048905 Bacteria 3584
235 Ga0496102_0105280 3300048905 Bacteria 2624
236 Ga0496102_0316598 3300048905 Bacteria 1470
237 Ga0496103_0020502 3300048906 Bacteria 3971
238 Ga0496103_0026854 3300048906 Bacteria 3484
239 Ga0496103_0196706 3300048906 Bacteria 1296
240 Ga0496103_0271212 3300048906 Bacteria 1091
241 Ga0496104_0770150 3300048907 Bacteria 869
242 Ga0496105_0602955 3300048908 Bacteria 852
243 Ga0496106_0411169 3300048909 Bacteria 1087
244 Ga0496107_0570420 3300048910 Bacteria 837
245 Ga0496109_0090212 3300048912 Bacteria 2834
246 Ga0496109_0094463 3300048912 Bacteria 2768
247 Ga0496110_0183034 3300048913 Bacteria 1902
248 Ga0496110_0233280 3300048913 Bacteria 1674
249 Ga0496110_0717980 3300048913 Bacteria 901
250 Ga0496111_0151393 3300048914 Bacteria 1720
251 Ga0496111_0210387 3300048914 Bacteria 1445
252 Ga0496111_0239137 3300048914 Bacteria 1348
253 Ga0496111_0302746 3300048914 Bacteria 1185
254 Ga0496112_0068072 3300048915 Bacteria 3516
255 Ga0496112_0328046 3300048915 Bacteria 1474
256 Ga0496113_0116080 3300048916 Bacteria 2088
257 Ga0496113_0329870 3300048916 Bacteria 1223
258 Ga0496113_0910737 3300048916 Bacteria 695
259 Ga0496113_1010728 3300048916 Bacteria 655
260 Ga0496114_0311419 3300048917 Bacteria 1391
261 Ga0496114_0772904 3300048917 Bacteria 838
262 Ga0496114_0783993 3300048917 Bacteria 831
263 Ga0496117_0000497 3300048920 Bacteria 64914
264 Ga0496117_0197683 3300048920 Bacteria 1139
265 Ga0496121_0254823 3300048924 Bacteria 1215
266 Ga0496122_0000685 3300048925 Bacteria 67841
267 Ga0496122_0007274 3300048925 Bacteria 12376
268 Ga0496122_0434951 3300048925 Bacteria 655
269 Ga0496123_0000421 3300048926 Bacteria 76637
270 Ga0496123_0031870 3300048926 Bacteria 3827
271 Ga0496124_0000548 3300048927 Bacteria 63507
272 Ga0496124_0194982 3300048927 Bacteria 1546
273 Ga0496124_0794132 3300048927 Bacteria 587
274 Ga0496125_0013448 3300048928 Bacteria 8041
275 Ga0496125_0017063 3300048928 Bacteria 6938
276 Ga0496125_0018881 3300048928 Bacteria 6526
277 Ga0496126_0009757 3300048929 Bacteria 10165
278 Ga0496126_0184769 3300048929 Bacteria 1768
279 Ga0501306_075154 3300049127 Bacteria 575
280 Ga0501310_018900 3300049130 Bacteria 844
281 Ga0501305_065962 3300049161 Bacteria 630
282 Ga0501307_023525 3300049162 Bacteria 817
283 Ga0501311_083988 3300049527 Bacteria 545
284 Ga0501312_075869 3300049528 Bacteria 602
285 Ga0501315_019813 3300049531 Bacteria 898
286 Ga0501317_083403 3300049533 Bacteria 556
287 Ga0501318_022680 3300049534 Bacteria 806
288 Ga0501323_021972 3300049539 Bacteria 847
289 Ga0501325_016459 3300049541 Bacteria 739
290 Ga0501327_04670 3300049543 Bacteria 789
291 Ga0501333_008747 3300049549 Bacteria 703
292 Ga0501335_019370 3300049551 Bacteria 718
293 Ga0501340_006396 3300049556 Bacteria 790
294 Ga0501031_0028554 3300049568 Bacteria 3637
295 Ga0501032_0010586 3300049569 Bacteria 6646
296 Ga0501034_0000123 3300049571 Bacteria 143688
297 Ga0501034_0018102 3300049571 Bacteria 7230
298 Ga0501034_0090544 3300049571 Bacteria 3057
299 Ga0501034_0153371 3300049571 Bacteria 2279
300 Ga0501034_0280168 3300049571 Bacteria 1607
301 Ga0501034_1479189 3300049571 Bacteria 553
302 Ga0501036_0076156 3300049572 Bacteria 2838
303 Ga0501036_0331933 3300049572 Bacteria 1270
304 Ga0501037_0006619 3300049573 Bacteria 8471
305 Ga0501037_0011979 3300049573 Bacteria 6388
306 Ga0501037_0088612 3300049573 Bacteria 2240
307 Ga0501037_0169202 3300049573 Bacteria 1554
308 Ga0501038_0004326 3300049574 Bacteria 13205
309 Ga0501038_0006105 3300049574 Bacteria 11149
310 Ga0501038_0074772 3300049574 Bacteria 2865
311 Ga0501038_0099811 3300049574 Bacteria 2419
312 Ga0501038_0120766 3300049574 Bacteria 2161
313 Ga0501038_0137840 3300049574 Bacteria 1998
314 Ga0501039_0111903 3300049575 Bacteria 2134
315 Ga0501042_0219457 3300049578 Bacteria 1371
316 Ga0501043_0005956 3300049579 Bacteria 9806
317 Ga0501043_0016475 3300049579 Bacteria 5793
318 Ga0501043_0016867 3300049579 Bacteria 5725
319 Ga0501047_0015599 3300049581 Bacteria 7240
320 Ga0501047_0037220 3300049581 Bacteria 4705
321 Ga0501069_0142949 3300049585 Bacteria 1373
322 Ga0501070_0030147 3300049586 Bacteria 4546
323 Ga0501071_0521422 3300049587 Bacteria 912
324 Ga0501073_0251181 3300049589 Bacteria 1221
325 Ga0501083_0035018 3300049744 Bacteria 3431
326 Ga0501035_0026829 3300049822 Bacteria 5268
327 Ga0501044_0047510 3300049823 Bacteria 4439
328 Ga0501044_0329371 3300049823 Bacteria 1450
329 nmdc:mga00v17_26934_c1 3300050491 Bacteria 3353
330 nmdc:mga0yw44_245980_c1 3300050492 Bacteria 1190
331 nmdc:mga0yw44_442455_c1 3300050492 Bacteria 881
332 nmdc:mga0sz30_131912_c2 3300050516 Bacteria 703
333 Ga0495601_0102083 3300053077 Bacteria 1853
334 Ga0495619_0165999 3300053085 Bacteria 1526
335 Ga0501084_0981211 3300054114 Bacteria 710
336 Ga0466962_0012844 3300061719 Bacteria 4028

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2585428157 2588106734 151
2 iso_pu_bacteria 2643221690 2644506332 151
3 iso_pu_bacteria 2643221694 2644526324 151
4 iso_pu_bacteria 2643221722 2644670999 151
5 iso_pu_bacteria 2643221724 2644679631 151
6 iso_pu_bacteria 2728369380 2730229141 151
7 iso_pu_bacteria 2884994152 2884994886 151
8 3300025911 Ga0207654_10197777 Ga0207654_101977771 152
9 3300031731 Ga0307405_10065233 Ga0307405_100652333 152
10 3300031824 Ga0307413_10134788 Ga0307413_101347883 152
11 3300031911 Ga0307412_10168451 Ga0307412_101684512 152
12 3300032005 Ga0307411_10379431 Ga0307411_103794312 152
13 3300041404 Ga0439436_0073523 Ga0439436_0073523_280_738 152
14 3300041413 Ga0439465_0204316 Ga0439465_0204316_158_616 152
15 3300041999 Ga0439433_0046826 Ga0439433_0046826_112_570 152
16 3300042007 Ga0439449_0010103 Ga0439449_0010103_2610_3068 152
17 3300042007 Ga0439449_0031252 Ga0439449_0031252_1262_1720 152
18 3300042122 Ga0450920_001508 Ga0450920_001508_2431_2889 152
19 3300042145 Ga0450906_035385 Ga0450906_035385_217_675 152
20 iso_pu_bacteria 2866552031 2866553232 152
21 3300009545 Ga0105237_10021263 Ga0105237_100212637 153
22 3300025949 Ga0207667_10032737 Ga0207667_100327376 153
23 3300026142 Ga0207698_10503150 Ga0207698_105031502 153
24 3300044706 Ga0466964_0048391 Ga0466964_0048391_1088_1555 153
25 3300045976 Ga0466967_0039418 Ga0466967_0039418_1279_1746 153
26 3300045976 Ga0466967_0474602 Ga0466967_0474602_688_1155 153
27 3300045976 Ga0466967_0755575 Ga0466967_0755575_449_916 153
28 3300046683 Ga0495658_0756123 Ga0495658_0756123_39_506 153
29 iso_pu_bacteria 2537561592 2537898776 153
30 iso_pu_bacteria 2643221553 2643785293 153
31 iso_pu_bacteria 2643221613 2644082034 153
32 iso_pu_bacteria 2643221721 2644664983 153
33 iso_pu_bacteria 2739367653 2739602617 153
34 iso_pu_bacteria 2747842429 2747953845 153
35 iso_pu_bacteria 2775506735 2775655254 153
36 iso_pu_bacteria 2808606357 2808827498 153
37 iso_pu_bacteria 2808606360 2808852865 153
38 iso_pu_bacteria 2811994871 2812320717 153
39 iso_pu_bacteria 2857723135 2857723329 153
40 iso_pu_bacteria 2857727296 2857729218 153
41 iso_pu_bacteria 2857740372 2857741519 153
42 iso_pu_bacteria 2904497146 2904500051 153
43 iso_pu_bacteria 2904776348 2904776436 153
44 iso_pu_bacteria 2910809715 2910813569 153
45 iso_pu_bacteria 2919034639 2919037565 153
46 iso_pu_bacteria 2919059106 2919063262 153
47 iso_pu_bacteria 2919391150 2919391240 153
48 iso_pu_bacteria 2919538618 2919541952 153
49 iso_pu_bacteria 2920879853 2920882149 153
50 iso_pu_bacteria 2932426870 2932429053 153
51 iso_pu_bacteria 2932431166 2932434172 153
52 iso_pu_bacteria 2933418574 2933421203 153
53 iso_pu_bacteria 2935890801 2935894225 153
54 iso_pu_bacteria 2939647034 2939649060 153
55 iso_pu_bacteria 2939674588 2939676254 153
56 iso_pu_bacteria 2945916053 2945918477 153
57 iso_pu_bacteria 2945941187 2945942590 153
58 iso_pu_bacteria 2945956166 2945959658 153
59 iso_pu_bacteria 2946059875 2946062336 153
60 iso_pu_bacteria 2953998280 2953999790 153
61 iso_pu_bacteria 2974302888 2974306504 153
62 iso_pu_bacteria 8004021418 8004021884 153
63 iso_pu_bacteria 8004182704 8004185996 153
64 iso_pu_bacteria 8054107350 8054111213 153
65 iso_pu_bacteria 8056054917 8056060213 153
66 3300005327 Ga0070658_10976316 Ga0070658_109763161 154
67 3300009093 Ga0105240_10326152 Ga0105240_103261522 154
68 3300009545 Ga0105237_10854883 Ga0105237_108548831 154
69 3300025933 Ga0207706_11073673 Ga0207706_110736732 154
70 3300045836 Ga0466958_0191036 Ga0466958_0191036_716_1189 154
71 iso_pu_bacteria 2811994874 2812331755 154
72 iso_pu_bacteria 2946033335 2946034257 154
73 3300005339 Ga0070660_100247437 Ga0070660_1002474372 155
74 3300005455 Ga0070663_101638879 Ga0070663_1016388791 155
75 3300005539 Ga0068853_100061127 Ga0068853_1000611272 155
76 3300005843 Ga0068860_101102898 Ga0068860_1011028981 155
77 3300006038 Ga0075365_10001820 Ga0075365_1000182012 155
78 3300009174 Ga0105241_12241545 Ga0105241_122415451 155
79 3300013307 Ga0157372_11580758 Ga0157372_115807581 155
80 3300013308 Ga0157375_11161397 Ga0157375_111613971 155
81 3300017792 Ga0163161_10384820 Ga0163161_103848201 155
82 3300025904 Ga0207647_10101951 Ga0207647_101019513 155
83 3300025918 Ga0207662_10166898 Ga0207662_101668981 155
84 3300025919 Ga0207657_10164205 Ga0207657_101642052 155
85 3300025935 Ga0207709_10590291 Ga0207709_105902912 155
86 3300025972 Ga0207668_10360827 Ga0207668_103608272 155
87 3300026041 Ga0207639_10205488 Ga0207639_102054882 155
88 3300026067 Ga0207678_11209748 Ga0207678_112097482 155
89 3300031251 Ga0265327_10210217 Ga0265327_102102171 155
90 3300031456 Ga0307513_10720705 Ga0307513_107207051 155
91 3300031824 Ga0307413_10000136 Ga0307413_1000013622 155
92 3300031901 Ga0307406_10006432 Ga0307406_100064323 155
93 3300031903 Ga0307407_10091494 Ga0307407_100914943 155
94 3300031911 Ga0307412_10069167 Ga0307412_100691673 155
95 3300031911 Ga0307412_10125431 Ga0307412_101254312 155
96 3300031995 Ga0307409_100052539 Ga0307409_1000525392 155
97 3300031995 Ga0307409_102630840 Ga0307409_1026308401 155
98 3300032002 Ga0307416_100151824 Ga0307416_1001518243 155
99 3300032126 Ga0307415_100146819 Ga0307415_1001468193 155
100 3300037418 Ga0395900_0918612 Ga0395900_0918612_70_537 155
101 3300037466 Ga0395898_0434556 Ga0395898_0434556_371_838 155
102 3300038443 Ga0395901_0347795 Ga0395901_0347795_61_528 155
103 3300041411 Ga0439466_0110303 Ga0439466_0110303_226_705 155
104 3300041413 Ga0439465_0133488 Ga0439465_0133488_225_692 155
105 3300041456 Ga0451795_1513609 Ga0451795_1513609_61_528 155
106 3300041494 Ga0451837_1324518 Ga0451837_1324518_130_597 155
107 3300041505 Ga0451849_0435973 Ga0451849_0435973_159_626 155
108 3300045976 Ga0466967_1362272 Ga0466967_1362272_20_487 155
109 3300046501 Ga0495607_0035226 Ga0495607_0035226_1837_2310 155
110 3300047323 Ga0495683_0000393 Ga0495683_0000393_12902_13375 155
111 3300048914 Ga0496111_0239137 Ga0496111_0239137_49_516 155
112 3300048916 Ga0496113_1010728 Ga0496113_1010728_102_569 155
113 3300048917 Ga0496114_0311419 Ga0496114_0311419_885_1352 155
114 3300048925 Ga0496122_0000685 Ga0496122_0000685_4612_5079 155
115 3300048926 Ga0496123_0000421 Ga0496123_0000421_4612_5079 155
116 3300048927 Ga0496124_0000548 Ga0496124_0000548_10085_10552 155
117 3300048927 Ga0496124_0194982 Ga0496124_0194982_917_1384 155
118 3300049127 Ga0501306_075154 Ga0501306_075154_18_497 155
119 3300049130 Ga0501310_018900 Ga0501310_018900_290_769 155
120 3300049161 Ga0501305_065962 Ga0501305_065962_92_571 155
121 3300049162 Ga0501307_023525 Ga0501307_023525_278_757 155
122 3300049527 Ga0501311_083988 Ga0501311_083988_28_507 155
123 3300049528 Ga0501312_075869 Ga0501312_075869_18_497 155
124 3300049531 Ga0501315_019813 Ga0501315_019813_291_770 155
125 3300049533 Ga0501317_083403 Ga0501317_083403_28_507 155
126 3300049534 Ga0501318_022680 Ga0501318_022680_40_519 155
127 3300049539 Ga0501323_021972 Ga0501323_021972_90_569 155
128 3300049541 Ga0501325_016459 Ga0501325_016459_129_608 155
129 3300049543 Ga0501327_04670 Ga0501327_04670_132_611 155
130 3300049549 Ga0501333_008747 Ga0501333_008747_72_551 155
131 3300049551 Ga0501335_019370 Ga0501335_019370_67_546 155
132 3300049556 Ga0501340_006396 Ga0501340_006396_96_575 155
133 3300049578 Ga0501042_0219457 Ga0501042_0219457_792_1259 155
134 3300050491 nmdc:mga00v17_26934_c1 nmdc:mga00v17_26934_c1_1429_1896 155
135 3300050492 nmdc:mga0yw44_245980_c1 nmdc:mga0yw44_245980_c1_638_1105 155
136 3300050516 nmdc:mga0sz30_131912_c2 nmdc:mga0sz30_131912_c2_220_687 155
137 3300053085 Ga0495619_0165999 Ga0495619_0165999_802_1269 155
138 iso_pu_bacteria 2945956166 2945960841 155
139 3300005616 Ga0068852_101799976 Ga0068852_1017999761 156
140 3300009551 Ga0105238_11540592 Ga0105238_115405922 156
141 3300013104 Ga0157370_10818899 Ga0157370_108188991 156
142 3300013105 Ga0157369_11475461 Ga0157369_114754612 156
143 3300025939 Ga0207665_10266039 Ga0207665_102660393 156
144 3300031242 Ga0265329_10154681 Ga0265329_101546812 156
145 3300031507 Ga0307509_10073439 Ga0307509_100734395 156
146 3300031548 Ga0307408_100244143 Ga0307408_1002441433 156
147 3300031731 Ga0307405_10115384 Ga0307405_101153841 156
148 3300031852 Ga0307410_10053543 Ga0307410_100535432 156
149 3300031903 Ga0307407_10187332 Ga0307407_101873322 156
150 3300031995 Ga0307409_100029857 Ga0307409_1000298573 156
151 3300032002 Ga0307416_100325093 Ga0307416_1003250931 156
152 3300032126 Ga0307415_100298125 Ga0307415_1002981252 156
153 3300041404 Ga0439436_0028895 Ga0439436_0028895_688_1158 156
154 3300041404 Ga0439436_0046439 Ga0439436_0046439_152_655 156
155 3300041405 Ga0439438_053774 Ga0439438_053774_165_635 156
156 3300041406 Ga0439439_0000524 Ga0439439_0000524_5084_5554 156
157 3300041410 Ga0439461_0010439 Ga0439461_0010439_417_887 156
158 3300041411 Ga0439466_0031033 Ga0439466_0031033_267_770 156
159 3300041411 Ga0439466_0032881 Ga0439466_0032881_1082_1552 156
160 3300041997 Ga0439431_0046008 Ga0439431_0046008_109_579 156
161 3300041999 Ga0439433_0000504 Ga0439433_0000504_5712_6182 156
162 3300041999 Ga0439433_0011702 Ga0439433_0011702_62_565 156
163 3300042002 Ga0439442_002310 Ga0439442_002310_221_724 156
164 3300042002 Ga0439442_008045 Ga0439442_008045_734_1204 156
165 3300042006 Ga0439432_002609 Ga0439432_002609_5557_6027 156
166 3300042007 Ga0439449_0000228 Ga0439449_0000228_16089_16592 156
167 3300042007 Ga0439449_0003573 Ga0439449_0003573_211_681 156
168 3300042010 Ga0439452_001504 Ga0439452_001504_8328_8798 156
169 3300042014 Ga0439457_009960 Ga0439457_009960_838_1308 156
170 3300042014 Ga0439457_013849 Ga0439457_013849_304_807 156
171 3300042015 Ga0439462_0004196 Ga0439462_0004196_2085_2555 156
172 3300042015 Ga0439462_0029957 Ga0439462_0029957_898_1401 156
173 3300042121 Ga0450919_008876 Ga0450919_008876_450_920 156
174 3300042125 Ga0450923_066198 Ga0450923_066198_74_544 156
175 3300042146 Ga0450907_006145 Ga0450907_006145_1072_1542 156
176 3300042435 Ga0439434_0000527 Ga0439434_0000527_9986_10456 156
177 3300042531 Ga0450918_001297 Ga0450918_001297_823_1293 156
178 3300044693 Ga0466961_0348450 Ga0466961_0348450_213_683 156
179 3300046663 Ga0495635_0126164 Ga0495635_0126164_102_578 156
180 3300048914 Ga0496111_0210387 Ga0496111_0210387_799_1293 156
181 3300049568 Ga0501031_0028554 Ga0501031_0028554_228_701 156
182 3300049569 Ga0501032_0010586 Ga0501032_0010586_5578_6051 156
183 3300049571 Ga0501034_0018102 Ga0501034_0018102_5471_5944 156
184 3300049572 Ga0501036_0076156 Ga0501036_0076156_2007_2480 156
185 3300049574 Ga0501038_0004326 Ga0501038_0004326_254_727 156
186 3300049579 Ga0501043_0016867 Ga0501043_0016867_3315_3788 156
187 3300049581 Ga0501047_0015599 Ga0501047_0015599_4283_4756 156
188 3300049586 Ga0501070_0030147 Ga0501070_0030147_170_643 156
189 3300049744 Ga0501083_0035018 Ga0501083_0035018_690_1163 156
190 3300049822 Ga0501035_0026829 Ga0501035_0026829_4607_5080 156
191 3300054114 Ga0501084_0981211 Ga0501084_0981211_192_665 156
192 3300005288 Ga0065714_10104764 Ga0065714_101047643 157
193 3300005290 Ga0065712_10217317 Ga0065712_102173172 157
194 3300005334 Ga0068869_100159448 Ga0068869_1001594483 157
195 3300005456 Ga0070678_100073980 Ga0070678_1000739802 157
196 3300005563 Ga0068855_100092213 Ga0068855_1000922137 157
197 3300005840 Ga0068870_10073403 Ga0068870_100734034 157
198 3300006058 Ga0075432_10358116 Ga0075432_103581161 157
199 3300009036 Ga0105244_10009366 Ga0105244_100093664 157
200 3300009036 Ga0105244_10297722 Ga0105244_102977221 157
201 3300009036 Ga0105244_10305882 Ga0105244_103058822 157
202 3300009036 Ga0105244_10359552 Ga0105244_103595521 157
203 3300009148 Ga0105243_11456846 Ga0105243_114568461 157
204 3300009176 Ga0105242_10119436 Ga0105242_101194363 157
205 3300011119 Ga0105246_10005340 Ga0105246_100053405 157
206 3300011119 Ga0105246_10032963 Ga0105246_100329634 157
207 3300011119 Ga0105246_10157026 Ga0105246_101570263 157
208 3300013105 Ga0157369_10919715 Ga0157369_109197152 157
209 3300013105 Ga0157369_10921594 Ga0157369_109215942 157
210 3300013105 Ga0157369_11049896 Ga0157369_110498962 157
211 3300013297 Ga0157378_10145015 Ga0157378_101450153 157
212 3300013306 Ga0163162_10593474 Ga0163162_105934741 157
213 3300013308 Ga0157375_10185761 Ga0157375_101857614 157
214 3300014745 Ga0157377_10201417 Ga0157377_102014172 157
215 3300022467 Ga0224712_10590878 Ga0224712_105908781 157
216 3300025256 Ga0209759_1026746 Ga0209759_10267462 157
217 3300025290 Ga0207673_1019572 Ga0207673_10195721 157
218 3300025303 Ga0209051_1003158 Ga0209051_100315810 157
219 3300025315 Ga0207697_10038356 Ga0207697_100383562 157
220 3300025728 Ga0207655_1007470 Ga0207655_10074705 157
221 3300025901 Ga0207688_10186138 Ga0207688_101861381 157
222 3300025913 Ga0207695_10114271 Ga0207695_101142712 157
223 3300025914 Ga0207671_10510165 Ga0207671_105101652 157
224 3300025925 Ga0207650_10810161 Ga0207650_108101611 157
225 3300025942 Ga0207689_10133403 Ga0207689_101334032 157
226 3300025944 Ga0207661_10185772 Ga0207661_101857723 157
227 3300025949 Ga0207667_10126300 Ga0207667_101263002 157
228 3300026121 Ga0207683_10106662 Ga0207683_101066624 157
229 3300028379 Ga0268266_11223399 Ga0268266_112233991 157
230 3300030744 Ga0316181_1029091 Ga0316181_10290912 157
231 3300031731 Ga0307405_10309856 Ga0307405_103098562 157
232 3300031731 Ga0307405_10343721 Ga0307405_103437212 157
233 3300031731 Ga0307405_10410593 Ga0307405_104105932 157
234 3300031824 Ga0307413_10015781 Ga0307413_100157814 157
235 3300031824 Ga0307413_10132749 Ga0307413_101327491 157
236 3300031824 Ga0307413_12023011 Ga0307413_120230111 157
237 3300031852 Ga0307410_10050318 Ga0307410_100503183 157
238 3300031852 Ga0307410_10224608 Ga0307410_102246081 157
239 3300031852 Ga0307410_10494418 Ga0307410_104944182 157
240 3300031852 Ga0307410_11047122 Ga0307410_110471221 157
241 3300031901 Ga0307406_10681581 Ga0307406_106815811 157
242 3300031903 Ga0307407_11025334 Ga0307407_110253341 157
243 3300031911 Ga0307412_10015825 Ga0307412_100158254 157
244 3300031911 Ga0307412_10167866 Ga0307412_101678663 157
245 3300031911 Ga0307412_10321333 Ga0307412_103213331 157
246 3300031911 Ga0307412_10819336 Ga0307412_108193361 157
247 3300031911 Ga0307412_11258664 Ga0307412_112586641 157
248 3300031995 Ga0307409_100173939 Ga0307409_1001739392 157
249 3300032002 Ga0307416_100124425 Ga0307416_1001244253 157
250 3300032002 Ga0307416_100387341 Ga0307416_1003873413 157
251 3300032004 Ga0307414_10064090 Ga0307414_100640901 157
252 3300032005 Ga0307411_10326225 Ga0307411_103262252 157
253 3300032005 Ga0307411_11585815 Ga0307411_115858151 157
254 3300032126 Ga0307415_100697754 Ga0307415_1006977541 157
255 3300037312 Ga0395899_0268435 Ga0395899_0268435_445_918 157
256 3300037312 Ga0395899_0431922 Ga0395899_0431922_69_542 157
257 3300037418 Ga0395900_0082012 Ga0395900_0082012_1424_1900 157
258 3300037418 Ga0395900_0191835 Ga0395900_0191835_460_933 157
259 3300037466 Ga0395898_0051913 Ga0395898_0051913_841_1317 157
260 3300037466 Ga0395898_0129015 Ga0395898_0129015_603_1076 157
261 3300037466 Ga0395898_0238954 Ga0395898_0238954_1069_1563 157
262 3300037466 Ga0395898_0525775 Ga0395898_0525775_469_942 157
263 3300037471 Ga0395905_1121019 Ga0395905_1121019_34_507 157
264 3300038443 Ga0395901_0015675 Ga0395901_0015675_2399_2893 157
265 3300038443 Ga0395901_0195588 Ga0395901_0195588_224_697 157
266 3300041404 Ga0439436_0002608 Ga0439436_0002608_1106_1579 157
267 3300041406 Ga0439439_0010474 Ga0439439_0010474_1035_1508 157
268 3300041411 Ga0439466_0009907 Ga0439466_0009907_2848_3321 157
269 3300041463 Ga0451804_0921085 Ga0451804_0921085_30_503 157
270 3300041999 Ga0439433_0009451 Ga0439433_0009451_1297_1770 157
271 3300041999 Ga0439433_0032970 Ga0439433_0032970_88_570 157
272 3300042002 Ga0439442_000014 Ga0439442_000014_34743_35228 157
273 3300042002 Ga0439442_020370 Ga0439442_020370_467_940 157
274 3300042007 Ga0439449_0030984 Ga0439449_0030984_1266_1739 157
275 3300042007 Ga0439449_0057756 Ga0439449_0057756_929_1411 157
276 3300042010 Ga0439452_049460 Ga0439452_049460_430_912 157
277 3300042014 Ga0439457_003157 Ga0439457_003157_1172_1645 157
278 3300042145 Ga0450906_081962 Ga0450906_081962_91_564 157
279 3300044694 Ga0466963_0519569 Ga0466963_0519569_308_781 157
280 3300044842 Ga0466957_0030290 Ga0466957_0030290_591_1070 157
281 3300045836 Ga0466958_0001592 Ga0466958_0001592_8164_8643 157
282 3300046459 Ga0495629_0990660 Ga0495629_0990660_52_528 157
283 3300046463 Ga0495653_0013249 Ga0495653_0013249_3624_4163 157
284 3300046472 Ga0495580_0095146 Ga0495580_0095146_668_1144 157
285 3300046473 Ga0495582_0054276 Ga0495582_0054276_648_1124 157
286 3300046475 Ga0495639_0020538 Ga0495639_0020538_2201_2677 157
287 3300046476 Ga0495662_0026724 Ga0495662_0026724_1482_2021 157
288 3300046476 Ga0495662_0319070 Ga0495662_0319070_131_607 157
289 3300046499 Ga0495594_0053246 Ga0495594_0053246_156_656 157
290 3300046499 Ga0495594_0100121 Ga0495594_0100121_125_664 157
291 3300046517 Ga0495630_0304005 Ga0495630_0304005_587_1126 157
292 3300046517 Ga0495630_0422016 Ga0495630_0422016_240_803 157
293 3300046528 Ga0495642_0043139 Ga0495642_0043139_362_835 157
294 3300046531 Ga0495665_0000724 Ga0495665_0000724_3084_3623 157
295 3300046531 Ga0495665_0037917 Ga0495665_0037917_730_1206 157
296 3300046535 Ga0495586_0018046 Ga0495586_0018046_165_641 157
297 3300046535 Ga0495586_0119166 Ga0495586_0119166_755_1294 157
298 3300046536 Ga0495587_0014274 Ga0495587_0014274_1695_2234 157
299 3300046543 Ga0495645_0001789 Ga0495645_0001789_9929_10468 157
300 3300046559 Ga0495667_0082923 Ga0495667_0082923_133_672 157
301 3300046615 Ga0495656_0075308 Ga0495656_0075308_982_1482 157
302 3300046663 Ga0495635_0244559 Ga0495635_0244559_489_965 157
303 3300046665 Ga0495661_0516831 Ga0495661_0516831_22_495 157
304 3300046674 Ga0495588_0004896 Ga0495588_0004896_119_595 157
305 3300046674 Ga0495588_0385869 Ga0495588_0385869_135_608 157
306 3300046679 Ga0495623_0113808 Ga0495623_0113808_1017_1556 157
307 3300046691 Ga0495670_0036395 Ga0495670_0036395_1166_1666 157
308 3300046809 Ga0495600_0006974 Ga0495600_0006974_4383_4922 157
309 3300046809 Ga0495600_0144956 Ga0495600_0144956_828_1304 157
310 3300046810 Ga0495660_0217054 Ga0495660_0217054_72_545 157
311 3300047315 Ga0495581_0001134 Ga0495581_0001134_7605_8081 157
312 3300047318 Ga0495636_0051744 Ga0495636_0051744_136_609 157
313 3300047444 Ga0495675_0017076 Ga0495675_0017076_2479_3018 157
314 3300047445 Ga0495677_0320951 Ga0495677_0320951_100_573 157
315 3300047471 Ga0495684_0098464 Ga0495684_0098464_717_1256 157
316 3300047673 Ga0495593_0120312 Ga0495593_0120312_638_1114 157
317 3300047673 Ga0495593_0215663 Ga0495593_0215663_60_599 157
318 3300048903 Ga0496100_0016602 Ga0496100_0016602_3657_4130 157
319 3300048904 Ga0496101_0033209 Ga0496101_0033209_193_666 157
320 3300048904 Ga0496101_1163554 Ga0496101_1163554_93_566 157
321 3300048905 Ga0496102_0056366 Ga0496102_0056366_1117_1596 157
322 3300048905 Ga0496102_0105280 Ga0496102_0105280_366_839 157
323 3300048905 Ga0496102_0316598 Ga0496102_0316598_758_1231 157
324 3300048906 Ga0496103_0020502 Ga0496103_0020502_2660_3139 157
325 3300048906 Ga0496103_0026854 Ga0496103_0026854_2753_3226 157
326 3300048906 Ga0496103_0196706 Ga0496103_0196706_59_532 157
327 3300048906 Ga0496103_0271212 Ga0496103_0271212_228_728 157
328 3300048907 Ga0496104_0770150 Ga0496104_0770150_125_598 157
329 3300048908 Ga0496105_0602955 Ga0496105_0602955_195_695 157
330 3300048909 Ga0496106_0411169 Ga0496106_0411169_422_895 157
331 3300048910 Ga0496107_0570420 Ga0496107_0570420_186_659 157
332 3300048912 Ga0496109_0090212 Ga0496109_0090212_2139_2639 157
333 3300048912 Ga0496109_0094463 Ga0496109_0094463_1599_2072 157
334 3300048913 Ga0496110_0183034 Ga0496110_0183034_989_1462 157
335 3300048913 Ga0496110_0233280 Ga0496110_0233280_74_553 157
336 3300048913 Ga0496110_0717980 Ga0496110_0717980_170_670 157
337 3300048914 Ga0496111_0151393 Ga0496111_0151393_127_627 157
338 3300048914 Ga0496111_0302746 Ga0496111_0302746_216_695 157
339 3300048915 Ga0496112_0068072 Ga0496112_0068072_2717_3190 157
340 3300048915 Ga0496112_0328046 Ga0496112_0328046_779_1252 157
341 3300048916 Ga0496113_0116080 Ga0496113_0116080_927_1427 157
342 3300048916 Ga0496113_0329870 Ga0496113_0329870_186_659 157
343 3300048916 Ga0496113_0910737 Ga0496113_0910737_68_541 157
344 3300048917 Ga0496114_0772904 Ga0496114_0772904_169_669 157
345 3300048917 Ga0496114_0783993 Ga0496114_0783993_161_634 157
346 3300048920 Ga0496117_0000497 Ga0496117_0000497_4385_4858 157
347 3300048920 Ga0496117_0197683 Ga0496117_0197683_531_1007 157
348 3300048924 Ga0496121_0254823 Ga0496121_0254823_302_778 157
349 3300048925 Ga0496122_0007274 Ga0496122_0007274_7294_7767 157
350 3300048925 Ga0496122_0434951 Ga0496122_0434951_43_516 157
351 3300048926 Ga0496123_0031870 Ga0496123_0031870_2909_3382 157
352 3300048927 Ga0496124_0794132 Ga0496124_0794132_77_550 157
353 3300048928 Ga0496125_0013448 Ga0496125_0013448_3504_3977 157
354 3300048928 Ga0496125_0017063 Ga0496125_0017063_5600_6073 157
355 3300048928 Ga0496125_0018881 Ga0496125_0018881_4918_5391 157
356 3300048929 Ga0496126_0009757 Ga0496126_0009757_7133_7606 157
357 3300048929 Ga0496126_0184769 Ga0496126_0184769_676_1149 157
358 3300049571 Ga0501034_0000123 Ga0501034_0000123_13149_13649 157
359 3300049571 Ga0501034_0090544 Ga0501034_0090544_178_654 157
360 3300049571 Ga0501034_0153371 Ga0501034_0153371_1001_1477 157
361 3300049571 Ga0501034_0280168 Ga0501034_0280168_535_1014 157
362 3300049571 Ga0501034_1479189 Ga0501034_1479189_39_512 157
363 3300049572 Ga0501036_0331933 Ga0501036_0331933_312_785 157
364 3300049573 Ga0501037_0006619 Ga0501037_0006619_6502_7002 157
365 3300049573 Ga0501037_0011979 Ga0501037_0011979_1480_1953 157
366 3300049573 Ga0501037_0088612 Ga0501037_0088612_852_1328 157
367 3300049573 Ga0501037_0169202 Ga0501037_0169202_56_529 157
368 3300049574 Ga0501038_0006105 Ga0501038_0006105_7584_8063 157
369 3300049574 Ga0501038_0074772 Ga0501038_0074772_29_502 157
370 3300049574 Ga0501038_0099811 Ga0501038_0099811_16_489 157
371 3300049574 Ga0501038_0120766 Ga0501038_0120766_1557_2030 157
372 3300049574 Ga0501038_0137840 Ga0501038_0137840_956_1432 157
373 3300049575 Ga0501039_0111903 Ga0501039_0111903_1557_2030 157
374 3300049579 Ga0501043_0005956 Ga0501043_0005956_4743_5243 157
375 3300049579 Ga0501043_0016475 Ga0501043_0016475_2759_3232 157
376 3300049581 Ga0501047_0037220 Ga0501047_0037220_554_1033 157
377 3300049585 Ga0501069_0142949 Ga0501069_0142949_737_1219 157
378 3300049587 Ga0501071_0521422 Ga0501071_0521422_153_626 157
379 3300049589 Ga0501073_0251181 Ga0501073_0251181_308_781 157
380 3300049823 Ga0501044_0047510 Ga0501044_0047510_309_788 157
381 3300049823 Ga0501044_0329371 Ga0501044_0329371_231_704 157
382 3300050492 nmdc:mga0yw44_442455_c1 nmdc:mga0yw44_442455_c1_299_811 157
383 3300053077 Ga0495601_0102083 Ga0495601_0102083_1211_1687 157
384 3300061719 Ga0466962_0012844 Ga0466962_0012844_2324_2803 157
385 iso_pu_bacteria 2654587600 2655032291 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

37

166

0.98

PF08534

Redoxin

Redoxin

36

183

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9495 14 154
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.946 14 154
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9459 14 154
5imf-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - structure f5 0.9453 14 154
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9384 3 154
ID Description Score Start End Superfamily
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9858 5 155 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9794 5 155 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9776 5 154 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9625 6 154 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9563 6 154 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7X0GG14-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9931 1 154 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-K4MJT0-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9928 3 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A3C1CM47-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9916 3 154 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A382PNQ9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9911 5 106 GO:0008379
GO:0009543
GO:0034599
GO:0045454
AF-A0A3E0I1U9-F1-model_v4 deleted 0.9908 4 157

Feature Viewer

pLDDT pTM Quality
94.32 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map