F430171

General Info

Members Datasets Scaffolds Average Seq Length
385 204 385 397

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10059794|Ga0075433_100597944
Length 443
Sequence VAAPALCKPANEKYNKGRPRKGRPYNEFVMTAAESTLDNGVSLAARRKWRALTLLAVAELFGMSLWFSGSAVVPALTREWHLTESQVSWIAIAVQLGFVAGTLISAVFNLSDIISSRHLFAVSGLAGALINASFGLYADHPTSAIVLRFLTGVCLAGVYPPGMKVMATWFRKRRGMALGVLVGALTLGKATPYLINAIGSSSWRTNVVLVSGLALIGSVIVLFFVNDGPHALPRATFDLSQVARVFQNRGVRLASFGYFGHMWELYGMWIWIPVMMRASVSISGGSAQFVEVGSFLIIGFGALGCVLAGVLADRVGRTVVTSWAMTISGSCCLVVGFLYGGNPYLLFVIAAIWGASVVADSAQFSSCVTELGDPQYIGTALTLQMCLGFLLTTISIELVPRAVSLVTWRYAFVLLAPGPFLGVLSMLRLRQLPEAVKIAHGRR

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
181 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
184 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
185 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
186 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
187 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
188 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
189 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
190 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
191 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
192 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
193 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
194 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 2.34
Rhizosphere 95.06
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000036 3300000532 Bacteria 8835
2 JGI24751J29686_10000040 3300002459 Bacteria 79191
3 JGI25406J46586_10025048 3300003203 Unclassified 2323
4 rootL2_10127364 3300003322 Unclassified 1306
5 rootL2_10127365 3300003322 Bacteria 3896
6 Ga0065714_10064546 3300005288 Bacteria 38244
7 Ga0065712_10000133 3300005290 Bacteria 66806
8 Ga0065712_10010491 3300005290 Bacteria 3719
9 Ga0065712_10086597 3300005290 Bacteria 2626
10 Ga0065712_10130657 3300005290 Unclassified 1545
11 Ga0065715_10008065 3300005293 Bacteria 3299
12 Ga0065715_10023659 3300005293 Bacteria 2255
13 Ga0065715_10023964 3300005293 Bacteria 1913
14 Ga0065715_10092590 3300005293 Bacteria 5010
15 Ga0065715_10098926 3300005293 Bacteria 3481
16 Ga0065715_10103535 3300005293 Bacteria 2999
17 Ga0065715_10104896 3300005293 Unclassified 2928
18 Ga0065715_10112528 3300005293 Unclassified 2526
19 Ga0065715_10126279 3300005293 Bacteria 2102
20 Ga0065715_10141519 3300005293 Bacteria 1795
21 Ga0065707_10152821 3300005295 Bacteria 1640
22 Ga0070690_100009958 3300005330 Bacteria 5516
23 Ga0070670_100000225 3300005331 Bacteria 52142
24 Ga0070670_100063082 3300005331 Bacteria 3180
25 Ga0068869_100032696 3300005334 Bacteria 3667
26 Ga0068869_100105107 3300005334 Bacteria 2141
27 Ga0068869_100163051 3300005334 Bacteria 1736
28 Ga0070680_100034147 3300005336 Bacteria 4101
29 Ga0070682_100000033 3300005337 Bacteria 154740
30 Ga0070682_100000687 3300005337 Bacteria 20450
31 Ga0068868_100070749 3300005338 Bacteria 2782
32 Ga0068868_100289775 3300005338 Bacteria 1388
33 Ga0070660_100063624 3300005339 Bacteria 2868
34 Ga0070689_100000256 3300005340 Bacteria 30601
35 Ga0070687_100005701 3300005343 Bacteria 5054
36 Ga0070661_100004921 3300005344 Bacteria 9199
37 Ga0070692_10083102 3300005345 Bacteria 1728
38 Ga0070669_100031254 3300005353 Bacteria 3846
39 Ga0070669_100222217 3300005353 Bacteria 1494
40 Ga0070671_100170829 3300005355 Bacteria 1839
41 Ga0070674_100067148 3300005356 Bacteria 2522
42 Ga0070673_100034406 3300005364 Bacteria 3835
43 Ga0070673_100036505 3300005364 Bacteria 3736
44 Ga0070673_100300976 3300005364 Bacteria 1412
45 Ga0070659_100002468 3300005366 Bacteria 13128
46 Ga0070659_100098094 3300005366 Bacteria 2356
47 Ga0070667_100093273 3300005367 Unclassified 2592
48 Ga0070713_100057426 3300005436 Bacteria 3241
49 Ga0070701_10134033 3300005438 Bacteria 1410
50 Ga0070705_100014938 3300005440 Bacteria 4006
51 Ga0070705_100077355 3300005440 Bacteria 2032
52 Ga0070700_100000090 3300005441 Bacteria 61626
53 Ga0070700_100017433 3300005441 Bacteria 4106
54 Ga0070700_100019791 3300005441 Bacteria 3889
55 Ga0070700_100045656 3300005441 Bacteria 2703
56 Ga0070694_100011365 3300005444 Bacteria 5512
57 Ga0070694_100045364 3300005444 Bacteria 2946
58 Ga0070662_100028004 3300005457 Bacteria 3918
59 Ga0070681_10000011 3300005458 Bacteria 139059
60 Ga0070681_10017767 3300005458 Bacteria 7107
61 Ga0068867_100036679 3300005459 Bacteria 3561
62 Ga0068867_100049291 3300005459 Bacteria 3100
63 Ga0068867_100065429 3300005459 Bacteria 2705
64 Ga0068867_100133668 3300005459 Bacteria 1931
65 Ga0070706_100000312 3300005467 Bacteria 59056
66 Ga0070706_100013974 3300005467 Bacteria 7416
67 Ga0070706_100050291 3300005467 Bacteria 3846
68 Ga0070706_100099890 3300005467 Bacteria 2696
69 Ga0070706_100181344 3300005467 Unclassified 1966
70 Ga0070707_100014862 3300005468 Bacteria 7300
71 Ga0070707_100016533 3300005468 Bacteria 6925
72 Ga0070698_100031519 3300005471 Bacteria 5496
73 Ga0070698_100090183 3300005471 Bacteria 3049
74 Ga0070698_100160567 3300005471 Bacteria 2191
75 Ga0070699_100006392 3300005518 Bacteria 10264
76 Ga0070699_100034894 3300005518 Bacteria 4346
77 Ga0070699_100065913 3300005518 Bacteria 3143
78 Ga0070679_100000013 3300005530 Bacteria 151602
79 Ga0070679_100012532 3300005530 Bacteria 8109
80 Ga0070679_100037430 3300005530 Bacteria 4820
81 Ga0070697_100049046 3300005536 Unclassified 3425
82 Ga0070697_100090011 3300005536 Bacteria 2536
83 Ga0070697_100138980 3300005536 Bacteria 2042
84 Ga0070672_100008129 3300005543 Bacteria 7172
85 Ga0070686_100010523 3300005544 Bacteria 5220
86 Ga0070686_100079403 3300005544 Bacteria 2169
87 Ga0070695_100022630 3300005545 Bacteria 3857
88 Ga0070695_100050886 3300005545 Bacteria 2657
89 Ga0070693_100076368 3300005547 Unclassified 1986
90 Ga0070693_100122884 3300005547 Unclassified 1612
91 Ga0070704_100072496 3300005549 Bacteria 2505
92 Ga0070664_100000729 3300005564 Bacteria 25302
93 Ga0070664_100209677 3300005564 Bacteria 1741
94 Ga0068857_100020437 3300005577 Bacteria 5823
95 Ga0068856_100009499 3300005614 Bacteria 9444
96 Ga0070702_100057476 3300005615 Bacteria 2251
97 Ga0070702_100067732 3300005615 Bacteria 2098
98 Ga0068852_100343213 3300005616 Bacteria 1456
99 Ga0068859_100010229 3300005617 Bacteria 9441
100 Ga0068859_100039413 3300005617 Bacteria 4740
101 Ga0068859_100047164 3300005617 Bacteria 4328
102 Ga0068859_100076150 3300005617 Bacteria 3396
103 Ga0068859_100087214 3300005617 Bacteria 3168
104 Ga0068859_100101330 3300005617 Bacteria 2936
105 Ga0068859_100124186 3300005617 Bacteria 2649
106 Ga0068859_100159473 3300005617 Unclassified 2335
107 Ga0068859_100268456 3300005617 Unclassified 1798
108 Ga0068859_100316501 3300005617 Bacteria 1654
109 Ga0068864_100010919 3300005618 Bacteria 7509
110 Ga0068864_100042767 3300005618 Bacteria 3877
111 Ga0068864_100061161 3300005618 Bacteria 3262
112 Ga0068864_100076441 3300005618 Bacteria 2926
113 Ga0068864_100246048 3300005618 Bacteria 1658
114 Ga0068866_10114242 3300005718 Bacteria 1511
115 Ga0068861_100052559 3300005719 Bacteria 3097
116 Ga0068861_100062626 3300005719 Bacteria 2858
117 Ga0068861_100089698 3300005719 Bacteria 2423
118 Ga0068861_100204490 3300005719 Bacteria 1659
119 Ga0068863_100344294 3300005841 Unclassified 1451
120 Ga0068858_100036796 3300005842 Bacteria 4538
121 Ga0068858_100039699 3300005842 Bacteria 4364
122 Ga0068858_100052969 3300005842 Unclassified 3755
123 Ga0068858_100104434 3300005842 Bacteria 2643
124 Ga0068860_100010185 3300005843 Bacteria 9309
125 Ga0068860_100158300 3300005843 Bacteria 2183
126 Ga0068860_100260841 3300005843 Bacteria 1689
127 Ga0068862_100282134 3300005844 Bacteria 1523
128 Ga0081539_10002465 3300005985 Bacteria 26058
129 Ga0081539_10006059 3300005985 Bacteria 11834
130 Ga0070717_10000082 3300006028 Bacteria 77627
131 Ga0070716_100020985 3300006173 Bacteria 3437
132 Ga0070716_100033617 3300006173 Bacteria 2806
133 Ga0097621_100028007 3300006237 Bacteria 4436
134 Ga0068871_100030440 3300006358 Bacteria 4250
135 Ga0068871_100032410 3300006358 Bacteria 4128
136 Ga0068871_100041725 3300006358 Bacteria 3680
137 Ga0075430_100045278 3300006846 Bacteria 3717
138 Ga0075430_100109389 3300006846 Bacteria 2305
139 Ga0075431_100110399 3300006847 Bacteria 2838
140 Ga0075431_100134241 3300006847 Bacteria 2551
141 Ga0075431_100189566 3300006847 Bacteria 2107
142 Ga0075431_100375918 3300006847 Archaea 1425
143 Ga0075433_10059794 3300006852 Bacteria 3334
144 Ga0075433_10115837 3300006852 Bacteria 2378
145 Ga0075433_10215803 3300006852 Bacteria 1705
146 Ga0075434_100189895 3300006871 Bacteria 2074
147 Ga0075429_100062834 3300006880 Bacteria 3235
148 Ga0075429_100180204 3300006880 Bacteria 1851
149 Ga0068865_100193878 3300006881 Bacteria 1573
150 Ga0068865_100198716 3300006881 Unclassified 1555
151 Ga0097620_100010229 3300006931 Bacteria 9441
152 Ga0097620_100039411 3300006931 Bacteria 4740
153 Ga0097620_100047166 3300006931 Bacteria 4328
154 Ga0097620_100087217 3300006931 Bacteria 3168
155 Ga0097620_100101325 3300006931 Bacteria 2936
156 Ga0097620_100124196 3300006931 Bacteria 2649
157 Ga0097620_100159461 3300006931 Unclassified 2335
158 Ga0097620_100268481 3300006931 Unclassified 1798
159 Ga0097620_100316509 3300006931 Bacteria 1654
160 Ga0075435_100034916 3300007076 Bacteria 3988
161 Ga0075435_100080134 3300007076 Unclassified 2680
162 Ga0075435_100203977 3300007076 Unclassified 1676
163 Ga0111539_10013017 3300009094 Bacteria 10410
164 Ga0111539_10018624 3300009094 Bacteria 8602
165 Ga0105245_10002136 3300009098 Bacteria 17896
166 Ga0105245_10029996 3300009098 Bacteria 4809
167 Ga0105247_10000979 3300009101 Bacteria 21524
168 Ga0105247_10011414 3300009101 Bacteria 5357
169 Ga0114129_10059658 3300009147 Bacteria 5334
170 Ga0105243_10010264 3300009148 Bacteria 7116
171 Ga0105241_10033383 3300009174 Bacteria 3864
172 Ga0105241_10255678 3300009174 Bacteria 1487
173 Ga0105242_10085161 3300009176 Bacteria 2650
174 Ga0105242_10129573 3300009176 Bacteria 2175
175 Ga0105248_10017330 3300009177 Bacteria 7938
176 Ga0105248_10089385 3300009177 Bacteria 3467
177 Ga0105248_10107416 3300009177 Bacteria 3147
178 Ga0105248_10123194 3300009177 Bacteria 2925
179 Ga0105248_10199171 3300009177 Bacteria 2256
180 Ga0105248_10315578 3300009177 Bacteria 1760
181 Ga0105237_10044474 3300009545 Unclassified 4471
182 Ga0105238_10042236 3300009551 Bacteria 4618
183 Ga0105249_10008920 3300009553 Bacteria 8759
184 Ga0105249_10068481 3300009553 Bacteria 3273
185 Ga0105239_10176335 3300010375 Bacteria 2391
186 Ga0105246_10097523 3300011119 Bacteria 2133
187 Ga0157373_10067485 3300013100 Bacteria 2529
188 Ga0157371_10051728 3300013102 Bacteria 2919
189 Ga0157374_10077207 3300013296 Bacteria 3151
190 Ga0157378_10014538 3300013297 Bacteria 6893
191 Ga0157378_10032574 3300013297 Bacteria 4605
192 Ga0157378_10370189 3300013297 Unclassified 1404
193 Ga0157378_10373089 3300013297 Bacteria 1399
194 Ga0163162_10012585 3300013306 Bacteria 8262
195 Ga0163162_10128703 3300013306 Bacteria 2640
196 Ga0157375_10000032 3300013308 Bacteria 187931
197 Ga0157375_10003637 3300013308 Bacteria 13372
198 Ga0157375_10127024 3300013308 Bacteria 2666
199 Ga0157375_10189629 3300013308 Unclassified 2210
200 Ga0157375_10296997 3300013308 Bacteria 1779
201 Ga0163163_10005180 3300014325 Bacteria 11243
202 Ga0163163_10006604 3300014325 Bacteria 10159
203 Ga0163163_10015839 3300014325 Bacteria 6983
204 Ga0163163_10023125 3300014325 Bacteria 5896
205 Ga0163163_10044351 3300014325 Bacteria 4362
206 Ga0163163_10051025 3300014325 Bacteria 4077
207 Ga0163163_10110650 3300014325 Bacteria 2775
208 Ga0157380_10008560 3300014326 Bacteria 7315
209 Ga0157380_10014212 3300014326 Bacteria 5822
210 Ga0157380_10104089 3300014326 Bacteria 2370
211 Ga0157377_10000040 3300014745 Bacteria 112182
212 Ga0157377_10047429 3300014745 Bacteria 2407
213 Ga0157379_10291172 3300014968 Bacteria 1487
214 Ga0157376_10006986 3300014969 Bacteria 8008
215 Ga0157376_10016521 3300014969 Bacteria 5606
216 Ga0157376_10017892 3300014969 Bacteria 5418
217 Ga0163161_10017644 3300017792 Bacteria 5000
218 Ga0209673_1019267 3300025273 Bacteria 2455
219 Ga0207697_10065730 3300025315 Bacteria 1514
220 Ga0207642_10095716 3300025899 Bacteria 1478
221 Ga0207710_10001203 3300025900 Bacteria 13133
222 Ga0207647_10001379 3300025904 Bacteria 18664
223 Ga0207643_10095091 3300025908 Bacteria 1741
224 Ga0207684_10000448 3300025910 Bacteria 54372
225 Ga0207684_10007138 3300025910 Bacteria 10096
226 Ga0207684_10181647 3300025910 Bacteria 1814
227 Ga0207654_10044273 3300025911 Bacteria 2527
228 Ga0207707_10000004 3300025912 Bacteria 391281
229 Ga0207707_10002272 3300025912 Bacteria 17382
230 Ga0207707_10004071 3300025912 Bacteria 12942
231 Ga0207695_10103947 3300025913 Bacteria 2831
232 Ga0207660_10019853 3300025917 Bacteria 4500
233 Ga0207660_10019976 3300025917 Bacteria 4488
234 Ga0207662_10003497 3300025918 Bacteria 8092
235 Ga0207662_10009032 3300025918 Bacteria 5475
236 Ga0207657_10064293 3300025919 Bacteria 3132
237 Ga0207649_10005161 3300025920 Bacteria 7057
238 Ga0207652_10000122 3300025921 Bacteria 85075
239 Ga0207646_10003251 3300025922 Bacteria 18520
240 Ga0207681_10025900 3300025923 Bacteria 3778
241 Ga0207681_10064525 3300025923 Bacteria 2529
242 Ga0207681_10111820 3300025923 Unclassified 1988
243 Ga0207694_10072808 3300025924 Bacteria 2687
244 Ga0207650_10000001 3300025925 Bacteria 1545726
245 Ga0207650_10211195 3300025925 Bacteria 1558
246 Ga0207659_10133417 3300025926 Bacteria 1920
247 Ga0207687_10001921 3300025927 Bacteria 14301
248 Ga0207700_10021799 3300025928 Bacteria 4382
249 Ga0207644_10017767 3300025931 Bacteria 4809
250 Ga0207690_10019551 3300025932 Bacteria 4174
251 Ga0207690_10066399 3300025932 Bacteria 2471
252 Ga0207706_10250570 3300025933 Bacteria 1547
253 Ga0207709_10079989 3300025935 Bacteria 2103
254 Ga0207670_10000820 3300025936 Bacteria 16263
255 Ga0207704_10126967 3300025938 Bacteria 1758
256 Ga0207665_10030529 3300025939 Bacteria 3562
257 Ga0207665_10049231 3300025939 Bacteria 2830
258 Ga0207691_10001245 3300025940 Bacteria 25434
259 Ga0207691_10011484 3300025940 Bacteria 8500
260 Ga0207691_10121546 3300025940 Bacteria 2314
261 Ga0207691_10208308 3300025940 Bacteria 1699
262 Ga0207711_10050911 3300025941 Bacteria 3547
263 Ga0207711_10074546 3300025941 Bacteria 2951
264 Ga0207711_10230829 3300025941 Unclassified 1695
265 Ga0207689_10011776 3300025942 Bacteria 7494
266 Ga0207689_10193993 3300025942 Bacteria 1676
267 Ga0207661_10094641 3300025944 Bacteria 2496
268 Ga0207679_10010307 3300025945 Bacteria 6014
269 Ga0207712_10029793 3300025961 Bacteria 3665
270 Ga0207712_10161753 3300025961 Bacteria 1741
271 Ga0207677_10151096 3300026023 Unclassified 1792
272 Ga0207677_10251457 3300026023 Unclassified 1435
273 Ga0207703_10020851 3300026035 Bacteria 5127
274 Ga0207703_10064254 3300026035 Bacteria 3012
275 Ga0207703_10133684 3300026035 Bacteria 2145
276 Ga0207703_10154963 3300026035 Bacteria 2001
277 Ga0207639_10128147 3300026041 Unclassified 2096
278 Ga0207708_10000095 3300026075 Bacteria 67730
279 Ga0207708_10010989 3300026075 Bacteria 6733
280 Ga0207708_10031615 3300026075 Bacteria 4018
281 Ga0207708_10033496 3300026075 Bacteria 3904
282 Ga0207708_10084136 3300026075 Bacteria 2446
283 Ga0207708_10098683 3300026075 Bacteria 2258
284 Ga0207702_10020878 3300026078 Bacteria 5418
285 Ga0207641_10004043 3300026088 Bacteria 12791
286 Ga0207641_10070672 3300026088 Bacteria 3000
287 Ga0207648_10024137 3300026089 Bacteria 5432
288 Ga0207648_10027577 3300026089 Bacteria 5041
289 Ga0207648_10199205 3300026089 Bacteria 1776
290 Ga0207648_10260704 3300026089 Bacteria 1547
291 Ga0207676_10027027 3300026095 Bacteria 4270
292 Ga0207676_10043169 3300026095 Bacteria 3470
293 Ga0207676_10112076 3300026095 Bacteria 2285
294 Ga0207676_10204032 3300026095 Bacteria 1749
295 Ga0207674_10000108 3300026116 Bacteria 95567
296 Ga0207674_10070850 3300026116 Archaea 3505
297 Ga0207674_10284380 3300026116 Bacteria 1602
298 Ga0207675_100012327 3300026118 Bacteria 7987
299 Ga0207675_100018464 3300026118 Bacteria 6505
300 Ga0207675_100031224 3300026118 Bacteria 4961
301 Ga0207675_100129338 3300026118 Bacteria 2394
302 Ga0207675_100271866 3300026118 Archaea 1645
303 Ga0209966_1016202 3300027695 Bacteria 1407
304 Ga0207428_10001203 3300027907 Bacteria 27741
305 Ga0268265_10025121 3300028380 Bacteria 4224
306 Ga0268265_10050390 3300028380 Bacteria 3137
307 Ga0268265_10275788 3300028380 Bacteria 1502
308 Ga0268264_10079313 3300028381 Bacteria 2800
309 Ga0265331_10005486 3300031250 Bacteria 7657
310 Ga0307408_100006709 3300031548 Bacteria 7635
311 Ga0307408_100096765 3300031548 Bacteria 2241
312 Ga0307405_10005975 3300031731 Bacteria 5941
313 Ga0307405_10046990 3300031731 Unclassified 2656
314 Ga0307413_10018998 3300031824 Unclassified 3620
315 Ga0307406_10005744 3300031901 Bacteria 6796
316 Ga0307414_10008814 3300032004 Bacteria 5754
317 Ga0307411_10100609 3300032005 Unclassified 2043
318 Ga0307415_100176062 3300032126 Unclassified 1673
319 Ga0373942_0007644 3300035207 Bacteria 2512
320 Ga0373937_0008952 3300036401 Bacteria 8690
321 Ga0395898_0183268 3300037466 Bacteria 2001
322 Ga0395905_0001338 3300037471 Bacteria 30026
323 Ga0395901_0199424 3300038443 Bacteria 2098
324 Ga0242420_015245 3300038996 Unclassified 1328
325 Ga0451577_0122098 3300042876 Bacteria 2334
326 Ga0451576_0112111 3300045051 Unclassified 2839
327 Ga0451576_0178271 3300045051 Bacteria 2219
328 Ga0495663_0000880 3300046525 Bacteria 10119
329 Ga0495598_0000239 3300046537 Bacteria 9795
330 Ga0495621_0000111 3300046539 Bacteria 16979
331 Ga0495668_0158116 3300046616 Bacteria 1241
332 Ga0495635_0065037 3300046663 Bacteria 2502
333 Ga0495647_0081344 3300046681 Bacteria 1314
334 Ga0495658_0043060 3300046683 Bacteria 2523
335 Ga0496103_0058292 3300048906 Unclassified 2399
336 Ga0496104_0196839 3300048907 Unclassified 1927
337 Ga0496104_0254292 3300048907 Bacteria 1670
338 Ga0496106_0087883 3300048909 Bacteria 2395
339 Ga0496107_0057407 3300048910 Bacteria 2814
340 Ga0496110_0089198 3300048913 Bacteria 2756
341 Ga0496110_0112587 3300048913 Bacteria 2447
342 Ga0496112_0176533 3300048915 Bacteria 2101
343 Ga0496113_0105533 3300048916 Bacteria 2188
344 Ga0496121_0025173 3300048924 Bacteria 5659
345 Ga0496121_0053147 3300048924 Bacteria 3395
346 Ga0496122_0003976 3300048925 Bacteria 18866
347 Ga0496123_0005631 3300048926 Bacteria 12506
348 Ga0496124_0080446 3300048927 Bacteria 2681
349 Ga0496126_0111069 3300048929 Bacteria 2387
350 Ga0501290_005739 3300049513 Bacteria 1549
351 Ga0501292_000844 3300049515 Archaea 3725
352 Ga0501038_0001767 3300049574 Bacteria 20103
353 Ga0501198_000894 3300049649 Bacteria 3763
354 Ga0501216_002069 3300049660 Unclassified 2810
355 Ga0501217_000690 3300049661 Bacteria 5787
356 Ga0501217_008051 3300049661 Archaea 2272
357 Ga0501223_009827 3300049663 Unclassified 1931
358 Ga0501223_013168 3300049663 Archaea 1648
359 Ga0501227_014587 3300049665 Unclassified 1745
360 Ga0501227_020174 3300049665 Bacteria 1526
361 Ga0501235_003763 3300049669 Bacteria 3278
362 Ga0501235_020644 3300049669 Unclassified 1462
363 Ga0501243_003025 3300049675 Bacteria 2478
364 Ga0501256_003535 3300049685 Bacteria 1304
365 Ga0501257_003148 3300049686 Unclassified 3516
366 Ga0501261_001615 3300049690 Archaea 2767
367 Ga0501225_0002910 3300049705 Bacteria 5255
368 Ga0501212_002424 3300049851 Unclassified 2246
369 nmdc:mga07m45_68557_c1 3300050496 Bacteria 1450
370 nmdc:mga05p37_102220_c1 3300050507 Bacteria 3530
371 nmdc:mga05p37_300950_c1 3300050507 Bacteria 1905
372 nmdc:mga05p37_7927_c1 3300050507 Bacteria 12535
373 nmdc:mga0qj67_116525_c1 3300050509 Bacteria 2159
374 nmdc:mga0qj67_27436_c1 3300050509 Bacteria 4415
375 nmdc:mga06r32_299743_c1 3300050510 Archaea 1593
376 nmdc:mga06r32_84650_c1 3300050510 Bacteria 3091
377 nmdc:mga08y16_11316_c1 3300050511 Bacteria 9372
378 nmdc:mga08y16_2321_c1 3300050511 Bacteria 19497
379 nmdc:mga08y16_4868_c1 3300050511 Bacteria 14021
380 nmdc:mga0n895_127938_c1 3300050512 Unclassified 2564
381 nmdc:mga0rr50_135753_c1 3300050513 Bacteria 1974
382 nmdc:mga0rr50_187778_c1 3300050513 Bacteria 1692
383 nmdc:mga08x19_4724_c1 3300050514 Bacteria 8081
384 nmdc:mga0a205_122186_c1 3300050515 Bacteria 2504
385 Ga0495619_0016350 3300053085 Bacteria 4697

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025940 Ga0207691_10208308 Ga0207691_102083083 308
2 3300050513 nmdc:mga0rr50_187778_c1 nmdc:mga0rr50_187778_c1_360_1529 338
3 3300050514 nmdc:mga08x19_4724_c1 nmdc:mga08x19_4724_c1_4468_5643 341
4 3300005334 Ga0068869_100105107 Ga0068869_1001051072 343
5 3300025942 Ga0207689_10193993 Ga0207689_101939932 343
6 3300005293 Ga0065715_10104896 Ga0065715_101048963 346
7 3300048907 Ga0496104_0254292 Ga0496104_0254292_44_1249 347
8 3300048913 Ga0496110_0112587 Ga0496110_0112587_1108_2313 347
9 3300005719 Ga0068861_100204490 Ga0068861_1002044902 348
10 3300014745 Ga0157377_10000040 Ga0157377_1000004092 348
11 3300006173 Ga0070716_100020985 Ga0070716_1000209853 350
12 3300025939 Ga0207665_10030529 Ga0207665_100305292 350
13 3300026116 Ga0207674_10070850 Ga0207674_100708503 357
14 3300025926 Ga0207659_10133417 Ga0207659_101334171 361
15 3300038443 Ga0395901_0199424 Ga0395901_0199424_868_2013 361
16 3300005366 Ga0070659_100098094 Ga0070659_1000980942 362
17 3300005458 Ga0070681_10017767 Ga0070681_100177672 362
18 3300025917 Ga0207660_10019976 Ga0207660_100199762 362
19 3300025932 Ga0207690_10066399 Ga0207690_100663993 362
20 3300027695 Ga0209966_1016202 Ga0209966_10162022 362
21 3300005293 Ga0065715_10126279 Ga0065715_101262791 363
22 3300005330 Ga0070690_100009958 Ga0070690_1000099585 363
23 3300005343 Ga0070687_100005701 Ga0070687_1000057014 363
24 3300005345 Ga0070692_10083102 Ga0070692_100831021 363
25 3300005441 Ga0070700_100000090 Ga0070700_10000009021 363
26 3300005544 Ga0070686_100010523 Ga0070686_1000105233 363
27 3300005843 Ga0068860_100158300 Ga0068860_1001583002 363
28 3300006881 Ga0068865_100193878 Ga0068865_1001938781 363
29 3300009098 Ga0105245_10002136 Ga0105245_1000213611 363
30 3300009177 Ga0105248_10315578 Ga0105248_103155782 363
31 3300013297 Ga0157378_10032574 Ga0157378_100325744 363
32 3300013306 Ga0163162_10128703 Ga0163162_101287033 363
33 3300014326 Ga0157380_10014212 Ga0157380_100142122 363
34 3300025918 Ga0207662_10009032 Ga0207662_100090324 363
35 3300025927 Ga0207687_10001921 Ga0207687_100019216 363
36 3300025938 Ga0207704_10126967 Ga0207704_101269672 363
37 3300026075 Ga0207708_10000095 Ga0207708_1000009529 363
38 3300026089 Ga0207648_10024137 Ga0207648_100241373 363
39 3300005440 Ga0070705_100014938 Ga0070705_1000149382 364
40 3300005471 Ga0070698_100160567 Ga0070698_1001605673 364
41 3300025910 Ga0207684_10181647 Ga0207684_101816472 364
42 3300005293 Ga0065715_10008065 Ga0065715_100080652 366
43 3300005436 Ga0070713_100057426 Ga0070713_1000574262 366
44 3300005467 Ga0070706_100000312 Ga0070706_10000031214 366
45 3300005467 Ga0070706_100050291 Ga0070706_1000502912 366
46 3300005617 Ga0068859_100047164 Ga0068859_1000471642 366
47 3300005617 Ga0068859_100087214 Ga0068859_1000872143 366
48 3300005841 Ga0068863_100344294 Ga0068863_1003442941 366
49 3300006028 Ga0070717_10000082 Ga0070717_1000008275 366
50 3300006931 Ga0097620_100047166 Ga0097620_1000471662 366
51 3300006931 Ga0097620_100087217 Ga0097620_1000872173 366
52 3300009177 Ga0105248_10199171 Ga0105248_101991712 366
53 3300025910 Ga0207684_10000448 Ga0207684_1000044838 366
54 3300025928 Ga0207700_10021799 Ga0207700_100217991 366
55 3300005288 Ga0065714_10064546 Ga0065714_1006454614 367
56 3300005290 Ga0065712_10000133 Ga0065712_1000013337 367
57 3300005293 Ga0065715_10098926 Ga0065715_100989262 367
58 3300005440 Ga0070705_100077355 Ga0070705_1000773551 367
59 3300005518 Ga0070699_100006392 Ga0070699_10000639211 367
60 3300005547 Ga0070693_100076368 Ga0070693_1000763681 367
61 3300005618 Ga0068864_100042767 Ga0068864_1000427672 367
62 3300005618 Ga0068864_100061161 Ga0068864_1000611611 367
63 3300006871 Ga0075434_100189895 Ga0075434_1001898952 367
64 3300013308 Ga0157375_10003637 Ga0157375_100036376 367
65 3300014325 Ga0163163_10051025 Ga0163163_100510254 367
66 3300025912 Ga0207707_10004071 Ga0207707_100040715 367
67 3300026095 Ga0207676_10027027 Ga0207676_100270273 367
68 3300031548 Ga0307408_100096765 Ga0307408_1000967652 367
69 3300045051 Ga0451576_0112111 Ga0451576_0112111_297_1508 367
70 3300049513 Ga0501290_005739 Ga0501290_005739_168_1379 367
71 3300049665 Ga0501227_020174 Ga0501227_020174_77_1288 367
72 3300049675 Ga0501243_003025 Ga0501243_003025_1062_2273 367
73 3300050512 nmdc:mga0n895_127938_c1 nmdc:mga0n895_127938_c1_1201_2412 367
74 3300050515 nmdc:mga0a205_122186_c1 nmdc:mga0a205_122186_c1_796_1941 367
75 3300048910 Ga0496107_0057407 Ga0496107_0057407_345_1523 368
76 3300049661 Ga0501217_008051 Ga0501217_008051_1137_2252 368
77 3300005364 Ga0070673_100300976 Ga0070673_1003009761 369
78 3300005468 Ga0070707_100016533 Ga0070707_1000165335 369
79 3300005337 Ga0070682_100000033 Ga0070682_100000033130 370
80 3300037466 Ga0395898_0183268 Ga0395898_0183268_35_1180 371
81 3300046539 Ga0495621_0000111 Ga0495621_0000111_14705_15940 371
82 3300005467 Ga0070706_100013974 Ga0070706_1000139742 372
83 3300005468 Ga0070707_100014862 Ga0070707_1000148626 372
84 3300005518 Ga0070699_100065913 Ga0070699_1000659135 372
85 3300007076 Ga0075435_100034916 Ga0075435_1000349164 372
86 3300025922 Ga0207646_10003251 Ga0207646_1000325117 372
87 3300005530 Ga0070679_100037430 Ga0070679_1000374302 373
88 3300005564 Ga0070664_100209677 Ga0070664_1002096771 373
89 3300006847 Ga0075431_100110399 Ga0075431_1001103993 373
90 3300025908 Ga0207643_10095091 Ga0207643_100950912 373
91 3300006847 Ga0075431_100134241 Ga0075431_1001342411 375
92 3300026095 Ga0207676_10112076 Ga0207676_101120761 375
93 3300050510 nmdc:mga06r32_84650_c1 nmdc:mga06r32_84650_c1_357_1562 375
94 3300005617 Ga0068859_100076150 Ga0068859_1000761504 376
95 3300009174 Ga0105241_10255678 Ga0105241_102556781 376
96 3300013102 Ga0157371_10051728 Ga0157371_100517282 376
97 3300025913 Ga0207695_10103947 Ga0207695_101039473 376
98 3300042876 Ga0451577_0122098 Ga0451577_0122098_787_1959 376
99 3300045051 Ga0451576_0178271 Ga0451576_0178271_753_1979 376
100 3300003322 rootL2_10127365 rootL2_101273653 377
101 3300005459 Ga0068867_100133668 Ga0068867_1001336682 377
102 3300005543 Ga0070672_100008129 Ga0070672_1000081293 377
103 3300013308 Ga0157375_10000032 Ga0157375_100000324 377
104 3300025273 Ga0209673_1019267 Ga0209673_10192672 377
105 3300025940 Ga0207691_10011484 Ga0207691_100114844 377
106 3300048924 Ga0496121_0025173 Ga0496121_0025173_743_2020 377
107 3300048924 Ga0496121_0053147 Ga0496121_0053147_289_1539 377
108 3300048925 Ga0496122_0003976 Ga0496122_0003976_9502_10779 377
109 3300048926 Ga0496123_0005631 Ga0496123_0005631_9795_11072 377
110 3300048927 Ga0496124_0080446 Ga0496124_0080446_687_1964 377
111 3300048929 Ga0496126_0111069 Ga0496126_0111069_851_2128 377
112 3300050496 nmdc:mga07m45_68557_c1 nmdc:mga07m45_68557_c1_11_1159 377
113 3300050507 nmdc:mga05p37_300950_c1 nmdc:mga05p37_300950_c1_101_1297 377
114 3300050511 nmdc:mga08y16_4868_c1 nmdc:mga08y16_4868_c1_8739_9977 377
115 3300000532 CNAas_1000036 CNAas_10000364 378
116 3300002459 JGI24751J29686_10000040 JGI24751J29686_1000004022 378
117 3300003203 JGI25406J46586_10025048 JGI25406J46586_100250484 378
118 3300003322 rootL2_10127364 rootL2_101273641 378
119 3300005290 Ga0065712_10010491 Ga0065712_100104912 378
120 3300005290 Ga0065712_10086597 Ga0065712_100865971 378
121 3300005290 Ga0065712_10130657 Ga0065712_101306571 378
122 3300005293 Ga0065715_10023659 Ga0065715_100236593 378
123 3300005293 Ga0065715_10023964 Ga0065715_100239641 378
124 3300005293 Ga0065715_10092590 Ga0065715_100925904 378
125 3300005293 Ga0065715_10103535 Ga0065715_101035354 378
126 3300005293 Ga0065715_10112528 Ga0065715_101125282 378
127 3300005293 Ga0065715_10141519 Ga0065715_101415193 378
128 3300005295 Ga0065707_10152821 Ga0065707_101528211 378
129 3300005331 Ga0070670_100000225 Ga0070670_10000022522 378
130 3300005331 Ga0070670_100063082 Ga0070670_1000630822 378
131 3300005334 Ga0068869_100032696 Ga0068869_1000326962 378
132 3300005334 Ga0068869_100163051 Ga0068869_1001630511 378
133 3300005336 Ga0070680_100034147 Ga0070680_1000341473 378
134 3300005337 Ga0070682_100000687 Ga0070682_10000068715 378
135 3300005338 Ga0068868_100070749 Ga0068868_1000707493 378
136 3300005338 Ga0068868_100289775 Ga0068868_1002897751 378
137 3300005339 Ga0070660_100063624 Ga0070660_1000636242 378
138 3300005340 Ga0070689_100000256 Ga0070689_10000025611 378
139 3300005344 Ga0070661_100004921 Ga0070661_1000049211 378
140 3300005353 Ga0070669_100031254 Ga0070669_1000312544 378
141 3300005353 Ga0070669_100222217 Ga0070669_1002222171 378
142 3300005355 Ga0070671_100170829 Ga0070671_1001708291 378
143 3300005356 Ga0070674_100067148 Ga0070674_1000671482 378
144 3300005364 Ga0070673_100034406 Ga0070673_1000344063 378
145 3300005364 Ga0070673_100036505 Ga0070673_1000365053 378
146 3300005366 Ga0070659_100002468 Ga0070659_1000024682 378
147 3300005367 Ga0070667_100093273 Ga0070667_1000932732 378
148 3300005438 Ga0070701_10134033 Ga0070701_101340331 378
149 3300005441 Ga0070700_100017433 Ga0070700_1000174333 378
150 3300005441 Ga0070700_100019791 Ga0070700_1000197914 378
151 3300005441 Ga0070700_100045656 Ga0070700_1000456563 378
152 3300005444 Ga0070694_100011365 Ga0070694_1000113652 378
153 3300005444 Ga0070694_100045364 Ga0070694_1000453644 378
154 3300005457 Ga0070662_100028004 Ga0070662_1000280041 378
155 3300005458 Ga0070681_10000011 Ga0070681_100000118 378
156 3300005459 Ga0068867_100036679 Ga0068867_1000366793 378
157 3300005459 Ga0068867_100049291 Ga0068867_1000492911 378
158 3300005459 Ga0068867_100065429 Ga0068867_1000654293 378
159 3300005467 Ga0070706_100099890 Ga0070706_1000998902 378
160 3300005467 Ga0070706_100181344 Ga0070706_1001813441 378
161 3300005471 Ga0070698_100031519 Ga0070698_1000315192 378
162 3300005471 Ga0070698_100090183 Ga0070698_1000901831 378
163 3300005518 Ga0070699_100034894 Ga0070699_1000348943 378
164 3300005530 Ga0070679_100000013 Ga0070679_10000001360 378
165 3300005530 Ga0070679_100012532 Ga0070679_1000125328 378
166 3300005536 Ga0070697_100049046 Ga0070697_1000490463 378
167 3300005536 Ga0070697_100090011 Ga0070697_1000900113 378
168 3300005536 Ga0070697_100138980 Ga0070697_1001389802 378
169 3300005544 Ga0070686_100079403 Ga0070686_1000794031 378
170 3300005545 Ga0070695_100022630 Ga0070695_1000226303 378
171 3300005545 Ga0070695_100050886 Ga0070695_1000508862 378
172 3300005547 Ga0070693_100122884 Ga0070693_1001228841 378
173 3300005549 Ga0070704_100072496 Ga0070704_1000724961 378
174 3300005564 Ga0070664_100000729 Ga0070664_1000007299 378
175 3300005577 Ga0068857_100020437 Ga0068857_1000204373 378
176 3300005614 Ga0068856_100009499 Ga0068856_1000094997 378
177 3300005615 Ga0070702_100057476 Ga0070702_1000574762 378
178 3300005615 Ga0070702_100067732 Ga0070702_1000677322 378
179 3300005616 Ga0068852_100343213 Ga0068852_1003432131 378
180 3300005617 Ga0068859_100010229 Ga0068859_1000102296 378
181 3300005617 Ga0068859_100039413 Ga0068859_1000394134 378
182 3300005617 Ga0068859_100101330 Ga0068859_1001013301 378
183 3300005617 Ga0068859_100124186 Ga0068859_1001241862 378
184 3300005617 Ga0068859_100159473 Ga0068859_1001594731 378
185 3300005617 Ga0068859_100268456 Ga0068859_1002684562 378
186 3300005617 Ga0068859_100316501 Ga0068859_1003165011 378
187 3300005618 Ga0068864_100010919 Ga0068864_1000109193 378
188 3300005618 Ga0068864_100076441 Ga0068864_1000764413 378
189 3300005618 Ga0068864_100246048 Ga0068864_1002460481 378
190 3300005718 Ga0068866_10114242 Ga0068866_101142421 378
191 3300005719 Ga0068861_100052559 Ga0068861_1000525592 378
192 3300005719 Ga0068861_100062626 Ga0068861_1000626262 378
193 3300005719 Ga0068861_100089698 Ga0068861_1000896981 378
194 3300005842 Ga0068858_100036796 Ga0068858_1000367961 378
195 3300005842 Ga0068858_100039699 Ga0068858_1000396994 378
196 3300005842 Ga0068858_100052969 Ga0068858_1000529691 378
197 3300005842 Ga0068858_100104434 Ga0068858_1001044342 378
198 3300005843 Ga0068860_100010185 Ga0068860_1000101857 378
199 3300005843 Ga0068860_100260841 Ga0068860_1002608411 378
200 3300005844 Ga0068862_100282134 Ga0068862_1002821341 378
201 3300005985 Ga0081539_10002465 Ga0081539_100024653 378
202 3300005985 Ga0081539_10006059 Ga0081539_100060593 378
203 3300006173 Ga0070716_100033617 Ga0070716_1000336172 378
204 3300006237 Ga0097621_100028007 Ga0097621_1000280073 378
205 3300006358 Ga0068871_100030440 Ga0068871_1000304404 378
206 3300006358 Ga0068871_100032410 Ga0068871_1000324102 378
207 3300006358 Ga0068871_100041725 Ga0068871_1000417252 378
208 3300006846 Ga0075430_100045278 Ga0075430_1000452782 378
209 3300006846 Ga0075430_100109389 Ga0075430_1001093893 378
210 3300006847 Ga0075431_100189566 Ga0075431_1001895661 378
211 3300006847 Ga0075431_100375918 Ga0075431_1003759181 378
212 3300006852 Ga0075433_10059794 Ga0075433_100597944 378
213 3300006852 Ga0075433_10115837 Ga0075433_101158372 378
214 3300006852 Ga0075433_10215803 Ga0075433_102158031 378
215 3300006880 Ga0075429_100062834 Ga0075429_1000628344 378
216 3300006880 Ga0075429_100180204 Ga0075429_1001802041 378
217 3300006881 Ga0068865_100198716 Ga0068865_1001987162 378
218 3300006931 Ga0097620_100010229 Ga0097620_1000102296 378
219 3300006931 Ga0097620_100039411 Ga0097620_1000394114 378
220 3300006931 Ga0097620_100101325 Ga0097620_1001013251 378
221 3300006931 Ga0097620_100124196 Ga0097620_1001241961 378
222 3300006931 Ga0097620_100159461 Ga0097620_1001594611 378
223 3300006931 Ga0097620_100268481 Ga0097620_1002684812 378
224 3300006931 Ga0097620_100316509 Ga0097620_1003165091 378
225 3300007076 Ga0075435_100080134 Ga0075435_1000801342 378
226 3300007076 Ga0075435_100203977 Ga0075435_1002039771 378
227 3300009094 Ga0111539_10013017 Ga0111539_100130174 378
228 3300009094 Ga0111539_10018624 Ga0111539_100186243 378
229 3300009098 Ga0105245_10029996 Ga0105245_100299965 378
230 3300009101 Ga0105247_10000979 Ga0105247_100009796 378
231 3300009101 Ga0105247_10011414 Ga0105247_100114143 378
232 3300009147 Ga0114129_10059658 Ga0114129_100596581 378
233 3300009148 Ga0105243_10010264 Ga0105243_100102645 378
234 3300009174 Ga0105241_10033383 Ga0105241_100333833 378
235 3300009176 Ga0105242_10085161 Ga0105242_100851613 378
236 3300009176 Ga0105242_10129573 Ga0105242_101295733 378
237 3300009177 Ga0105248_10017330 Ga0105248_100173304 378
238 3300009177 Ga0105248_10089385 Ga0105248_100893852 378
239 3300009177 Ga0105248_10107416 Ga0105248_101074162 378
240 3300009177 Ga0105248_10123194 Ga0105248_101231942 378
241 3300009545 Ga0105237_10044474 Ga0105237_100444741 378
242 3300009551 Ga0105238_10042236 Ga0105238_100422365 378
243 3300009553 Ga0105249_10008920 Ga0105249_100089204 378
244 3300009553 Ga0105249_10068481 Ga0105249_100684812 378
245 3300010375 Ga0105239_10176335 Ga0105239_101763352 378
246 3300011119 Ga0105246_10097523 Ga0105246_100975232 378
247 3300013100 Ga0157373_10067485 Ga0157373_100674852 378
248 3300013296 Ga0157374_10077207 Ga0157374_100772071 378
249 3300013297 Ga0157378_10014538 Ga0157378_100145385 378
250 3300013297 Ga0157378_10370189 Ga0157378_103701891 378
251 3300013297 Ga0157378_10373089 Ga0157378_103730892 378
252 3300013306 Ga0163162_10012585 Ga0163162_100125855 378
253 3300013308 Ga0157375_10127024 Ga0157375_101270242 378
254 3300013308 Ga0157375_10189629 Ga0157375_101896292 378
255 3300013308 Ga0157375_10296997 Ga0157375_102969972 378
256 3300014325 Ga0163163_10005180 Ga0163163_100051805 378
257 3300014325 Ga0163163_10006604 Ga0163163_100066046 378
258 3300014325 Ga0163163_10015839 Ga0163163_100158393 378
259 3300014325 Ga0163163_10023125 Ga0163163_100231253 378
260 3300014325 Ga0163163_10044351 Ga0163163_100443514 378
261 3300014325 Ga0163163_10110650 Ga0163163_101106503 378
262 3300014326 Ga0157380_10008560 Ga0157380_100085606 378
263 3300014326 Ga0157380_10104089 Ga0157380_101040892 378
264 3300014745 Ga0157377_10047429 Ga0157377_100474291 378
265 3300014968 Ga0157379_10291172 Ga0157379_102911721 378
266 3300014969 Ga0157376_10006986 Ga0157376_100069861 378
267 3300014969 Ga0157376_10016521 Ga0157376_100165212 378
268 3300014969 Ga0157376_10017892 Ga0157376_100178924 378
269 3300017792 Ga0163161_10017644 Ga0163161_100176441 378
270 3300025315 Ga0207697_10065730 Ga0207697_100657301 378
271 3300025899 Ga0207642_10095716 Ga0207642_100957161 378
272 3300025900 Ga0207710_10001203 Ga0207710_100012036 378
273 3300025904 Ga0207647_10001379 Ga0207647_100013795 378
274 3300025910 Ga0207684_10007138 Ga0207684_100071383 378
275 3300025911 Ga0207654_10044273 Ga0207654_100442732 378
276 3300025912 Ga0207707_10000004 Ga0207707_10000004265 378
277 3300025912 Ga0207707_10002272 Ga0207707_100022725 378
278 3300025917 Ga0207660_10019853 Ga0207660_100198533 378
279 3300025918 Ga0207662_10003497 Ga0207662_100034973 378
280 3300025919 Ga0207657_10064293 Ga0207657_100642933 378
281 3300025920 Ga0207649_10005161 Ga0207649_100051615 378
282 3300025921 Ga0207652_10000122 Ga0207652_100001225 378
283 3300025923 Ga0207681_10025900 Ga0207681_100259002 378
284 3300025923 Ga0207681_10064525 Ga0207681_100645252 378
285 3300025923 Ga0207681_10111820 Ga0207681_101118202 378
286 3300025924 Ga0207694_10072808 Ga0207694_100728081 378
287 3300025925 Ga0207650_10000001 Ga0207650_100000011129 378
288 3300025925 Ga0207650_10211195 Ga0207650_102111951 378
289 3300025931 Ga0207644_10017767 Ga0207644_100177671 378
290 3300025932 Ga0207690_10019551 Ga0207690_100195512 378
291 3300025933 Ga0207706_10250570 Ga0207706_102505701 378
292 3300025935 Ga0207709_10079989 Ga0207709_100799891 378
293 3300025936 Ga0207670_10000820 Ga0207670_100008205 378
294 3300025939 Ga0207665_10049231 Ga0207665_100492311 378
295 3300025940 Ga0207691_10001245 Ga0207691_1000124514 378
296 3300025940 Ga0207691_10121546 Ga0207691_101215462 378
297 3300025941 Ga0207711_10050911 Ga0207711_100509112 378
298 3300025941 Ga0207711_10074546 Ga0207711_100745461 378
299 3300025941 Ga0207711_10230829 Ga0207711_102308291 378
300 3300025942 Ga0207689_10011776 Ga0207689_100117765 378
301 3300025944 Ga0207661_10094641 Ga0207661_100946412 378
302 3300025945 Ga0207679_10010307 Ga0207679_100103072 378
303 3300025961 Ga0207712_10029793 Ga0207712_100297933 378
304 3300025961 Ga0207712_10161753 Ga0207712_101617531 378
305 3300026023 Ga0207677_10151096 Ga0207677_101510961 378
306 3300026023 Ga0207677_10251457 Ga0207677_102514571 378
307 3300026035 Ga0207703_10020851 Ga0207703_100208512 378
308 3300026035 Ga0207703_10064254 Ga0207703_100642543 378
309 3300026035 Ga0207703_10133684 Ga0207703_101336841 378
310 3300026035 Ga0207703_10154963 Ga0207703_101549632 378
311 3300026041 Ga0207639_10128147 Ga0207639_101281471 378
312 3300026075 Ga0207708_10010989 Ga0207708_100109894 378
313 3300026075 Ga0207708_10031615 Ga0207708_100316153 378
314 3300026075 Ga0207708_10033496 Ga0207708_100334962 378
315 3300026075 Ga0207708_10084136 Ga0207708_100841362 378
316 3300026075 Ga0207708_10098683 Ga0207708_100986832 378
317 3300026078 Ga0207702_10020878 Ga0207702_100208785 378
318 3300026088 Ga0207641_10004043 Ga0207641_100040433 378
319 3300026088 Ga0207641_10070672 Ga0207641_100706724 378
320 3300026089 Ga0207648_10027577 Ga0207648_100275774 378
321 3300026089 Ga0207648_10199205 Ga0207648_101992052 378
322 3300026089 Ga0207648_10260704 Ga0207648_102607042 378
323 3300026095 Ga0207676_10043169 Ga0207676_100431692 378
324 3300026095 Ga0207676_10204032 Ga0207676_102040322 378
325 3300026116 Ga0207674_10000108 Ga0207674_1000010859 378
326 3300026116 Ga0207674_10284380 Ga0207674_102843802 378
327 3300026118 Ga0207675_100012327 Ga0207675_1000123277 378
328 3300026118 Ga0207675_100018464 Ga0207675_1000184644 378
329 3300026118 Ga0207675_100031224 Ga0207675_1000312242 378
330 3300026118 Ga0207675_100129338 Ga0207675_1001293382 378
331 3300026118 Ga0207675_100271866 Ga0207675_1002718662 378
332 3300027907 Ga0207428_10001203 Ga0207428_1000120317 378
333 3300028380 Ga0268265_10025121 Ga0268265_100251214 378
334 3300028380 Ga0268265_10050390 Ga0268265_100503902 378
335 3300028380 Ga0268265_10275788 Ga0268265_102757881 378
336 3300028381 Ga0268264_10079313 Ga0268264_100793131 378
337 3300031250 Ga0265331_10005486 Ga0265331_100054866 378
338 3300031548 Ga0307408_100006709 Ga0307408_1000067095 378
339 3300031731 Ga0307405_10005975 Ga0307405_100059752 378
340 3300031731 Ga0307405_10046990 Ga0307405_100469903 378
341 3300031824 Ga0307413_10018998 Ga0307413_100189983 378
342 3300031901 Ga0307406_10005744 Ga0307406_100057443 378
343 3300032004 Ga0307414_10008814 Ga0307414_100088142 378
344 3300032005 Ga0307411_10100609 Ga0307411_101006092 378
345 3300032126 Ga0307415_100176062 Ga0307415_1001760621 378
346 3300035207 Ga0373942_0007644 Ga0373942_0007644_985_2187 378
347 3300036401 Ga0373937_0008952 Ga0373937_0008952_462_1688 378
348 3300037471 Ga0395905_0001338 Ga0395905_0001338_13316_14554 378
349 3300038996 Ga0242420_015245 Ga0242420_015245_47_1183 378
350 3300046525 Ga0495663_0000880 Ga0495663_0000880_5215_6450 378
351 3300046537 Ga0495598_0000239 Ga0495598_0000239_3692_4927 378
352 3300046616 Ga0495668_0158116 Ga0495668_0158116_14_1228 378
353 3300046663 Ga0495635_0065037 Ga0495635_0065037_751_1977 378
354 3300046681 Ga0495647_0081344 Ga0495647_0081344_57_1265 378
355 3300046683 Ga0495658_0043060 Ga0495658_0043060_297_1535 378
356 3300048906 Ga0496103_0058292 Ga0496103_0058292_66_1211 378
357 3300048907 Ga0496104_0196839 Ga0496104_0196839_199_1443 378
358 3300048909 Ga0496106_0087883 Ga0496106_0087883_718_1854 378
359 3300048913 Ga0496110_0089198 Ga0496110_0089198_1411_2613 378
360 3300048915 Ga0496112_0176533 Ga0496112_0176533_640_1782 378
361 3300048916 Ga0496113_0105533 Ga0496113_0105533_272_1408 378
362 3300049515 Ga0501292_000844 Ga0501292_000844_163_1368 378
363 3300049574 Ga0501038_0001767 Ga0501038_0001767_16074_17279 378
364 3300049649 Ga0501198_000894 Ga0501198_000894_1883_3028 378
365 3300049660 Ga0501216_002069 Ga0501216_002069_1640_2785 378
366 3300049661 Ga0501217_000690 Ga0501217_000690_2962_4107 378
367 3300049663 Ga0501223_009827 Ga0501223_009827_519_1664 378
368 3300049663 Ga0501223_013168 Ga0501223_013168_402_1607 378
369 3300049665 Ga0501227_014587 Ga0501227_014587_494_1639 378
370 3300049669 Ga0501235_003763 Ga0501235_003763_649_1854 378
371 3300049669 Ga0501235_020644 Ga0501235_020644_89_1234 378
372 3300049685 Ga0501256_003535 Ga0501256_003535_42_1187 378
373 3300049686 Ga0501257_003148 Ga0501257_003148_2326_3471 378
374 3300049690 Ga0501261_001615 Ga0501261_001615_395_1600 378
375 3300049705 Ga0501225_0002910 Ga0501225_0002910_2688_3833 378
376 3300049851 Ga0501212_002424 Ga0501212_002424_100_1245 378
377 3300050507 nmdc:mga05p37_102220_c1 nmdc:mga05p37_102220_c1_1425_2639 378
378 3300050507 nmdc:mga05p37_7927_c1 nmdc:mga05p37_7927_c1_11076_12389 378
379 3300050509 nmdc:mga0qj67_116525_c1 nmdc:mga0qj67_116525_c1_330_1475 378
380 3300050509 nmdc:mga0qj67_27436_c1 nmdc:mga0qj67_27436_c1_2460_3596 378
381 3300050510 nmdc:mga06r32_299743_c1 nmdc:mga06r32_299743_c1_63_1241 378
382 3300050511 nmdc:mga08y16_11316_c1 nmdc:mga08y16_11316_c1_3263_4399 378
383 3300050511 nmdc:mga08y16_2321_c1 nmdc:mga08y16_2321_c1_4773_5975 378
384 3300050513 nmdc:mga0rr50_135753_c1 nmdc:mga0rr50_135753_c1_588_1733 378
385 3300053085 Ga0495619_0016350 Ga0495619_0016350_860_2086 378

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

54

396

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.8266 2 362
8dwi-assembly1.cif.gz_A molecular mechanism of sialic acid transport mediated by sialin 0.8245 2 361
6e9n-assembly2.cif.gz_B e. coli d-galactonate:proton symporter in the inward open form 0.8214 2 364
8ex4-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1) 0.8143 2 376
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.8126 2 364
ID Description Score Start End Superfamily
af_P08194_240_451_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.874 176 364 1.20.1250.20
af_P36035_135_554_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8715 2 362 1.20.1250.20
af_Q5RGT2_295_489_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8699 183 364 1.20.1250.20
af_P21503_7_181_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8669 190 362 1.20.1250.20
af_Q9D232_48_473_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8659 2 364 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A849QNS0-F1-model_v4 MFS transporter 0.9803 2 368 GO:0005886
GO:0022857
AF-A0A0T5ZNW6-F1-model_v4 Major facilitator superfamily protein 0.9775 2 378 GO:0005886
GO:0022857
AF-A0A538H7Z1-F1-model_v4 MFS transporter 0.9751 2 368 GO:0005886
GO:0022857
AF-A0A7Y2N7F3-F1-model_v4 MFS transporter 0.9745 1 368 GO:0005886
GO:0022857
AF-A0A0M2T2W9-F1-model_v4 MFS transporter 0.9742 2 366 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
90.78 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map